Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.4468.773ON45845824540.0
YMR238W (DFG5)8.773ON45845823030.0
Skud_13.4078.773ON45845822640.0
Suva_13.4228.773ON45845822270.0
NDAI0K008408.773ON45944518780.0
NCAS0C008108.773ON45144718520.0
CAGL0M05049g8.773ON45345818350.0
Kpol_1030.208.773ON45145218230.0
KAFR0B034908.773ON45145318110.0
SAKL0B05412g8.773ON45145118100.0
TDEL0B033608.773ON43643517760.0
TBLA0B033208.773ON45044617590.0
TPHA0J016008.773ON46146217240.0
KNAG0J007008.773ON46343917000.0
KLLA0F24926g8.773ON45145316950.0
Kwal_55.202668.773ON45744316770.0
KLTH0E04048g8.773ON45443616510.0
ZYRO0F12210g8.773ON45343516420.0
Ecym_14748.773ON45445115430.0
AFR530W8.773ON45946015300.0
NCAS0A08740singletonON43440314790.0
ACL200WsingletonON46344914760.0
ACL201WsingletonON44844614490.0
NCAS0A08730singletonON63137514060.0
TBLA0C03850singletonON56738213790.0
ACL202WsingletonON45041213400.0
SAKL0D13574g2.570ON45145112961e-176
KLTH0D08008g2.570ON44843812851e-175
KLLA0E07723g2.570ON45045312581e-171
YKL046C (DCW1)2.570ON44943712421e-168
Smik_11.2022.570ON44945312401e-168
Suva_11.1802.570ON45044212401e-168
Kwal_26.82252.570ON44945112381e-168
NDAI0B015102.570ON44745212341e-167
TPHA0I024702.570ON45244212331e-167
Skud_11.1832.570ON44945812281e-166
KAFR0I017402.570ON44844812251e-166
NDAI0C006802.570ON45245012251e-166
NCAS0H029002.570ON45344812041e-162
TBLA0H02580singletonON44944211961e-161
KAFR0A021702.570ON44945311941e-161
NCAS0A127502.570ON44745111871e-160
TBLA0H02590singletonON45045011771e-158
CAGL0L01727g2.570ON44645411611e-156
TDEL0B065802.570ON44744211521e-155
ABR060W2.570ON45143411371e-152
Kpol_1056.42.570ON45042811321e-152
Ecym_45772.570ON45043511261e-151
TBLA0H026002.570ON44943611241e-150
ZYRO0E06380g2.570ON45345511101e-148
KNAG0A071802.570ON46339111081e-148
Smik_7.1312.335ON91051696.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.446
         (458 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   949   0.0  
YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   891   0.0  
Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   876   0.0  
Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   862   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   728   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   717   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   711   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   706   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   702   0.0  
SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   701   0.0  
TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   688   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   682   0.0  
TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   668   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   659   0.0  
KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   657   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   650   0.0  
KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   640   0.0  
ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   637   0.0  
Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   598   0.0  
AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   593   0.0  
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            574   0.0  
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   573   0.0  
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   562   0.0  
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            546   0.0  
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              535   0.0  
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   520   0.0  
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   503   e-176
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   499   e-175
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   489   e-171
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   483   e-168
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   482   e-168
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   482   e-168
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   481   e-168
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   479   e-167
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   479   e-167
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   477   e-166
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   476   e-166
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   476   e-166
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    468   e-162
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   465   e-161
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   464   e-161
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   461   e-160
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   457   e-158
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   451   e-156
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   448   e-155
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   442   e-152
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   440   e-152
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   438   e-151
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   437   e-150
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   432   e-148
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            431   e-148
Smik_7.131 Chr7 (232379..235111) [2733 bp, 910 aa] {ON} YGL141W ...    31   6.9  

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/458 (100%), Positives = 458/458 (100%)

Query: 1   MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA 60
           MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA
Sbjct: 1   MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA
Sbjct: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMY 300
           EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMY 300

Query: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDG 360
           ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDG
Sbjct: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDG 360

Query: 361 HTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420
           HTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST
Sbjct: 361 HTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           TNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF
Sbjct: 421 TNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  891 bits (2303), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/458 (93%), Positives = 439/458 (95%)

Query: 1   MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA 60
           MI+  S +MI  ICFT LSFF+  HAM+LD+TSKTSICDATALIQ GMLDYYEGTRYGG 
Sbjct: 1   MIVNISAKMILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGT 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIP+NQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFTDP DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPGDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNT+SNACLFQIAARLGRYTGNTTYL+VAEQVFDWLVDVGYVVLNDTANVFDGA
Sbjct: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMY 300
           EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGT EWETSLTKILNGAKSYFFKDSIMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMY 300

Query: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDG 360
           ESACQDY TCNTDQRTFKSIFSRMLGLTSVMAP+T DTIDDLIKTSAEAAAKSC+GG DG
Sbjct: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDG 360

Query: 361 HTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420
           HTCGLNW KQTNDGYYGLGEQM+ALEVIQNLLIHDRPAPYKE NGGTSKGDANAGMNSST
Sbjct: 361 HTCGLNWQKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           TNVLQNNLNIK GDRAGAAIITA+ILSVL GGAVWMLF
Sbjct: 421 TNVLQNNLNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/458 (93%), Positives = 445/458 (97%)

Query: 1   MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA 60
           MI+ SSM MIP ICFT LSF  I HAM+LD+TSKTSICDATALIQDGMLDYY+GTRYGGA
Sbjct: 1   MIVDSSMRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGA 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGMLENWFLCEN+TYQELLYDALLAQTGSNYDYIPANQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFTDP +GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTDPDEGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNT+SNACLFQIAARLGRYTGN+TYLDVAEQVFDWLVDVGYVVLNDTANVFDGA
Sbjct: 181 NSGYNYKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMY 300
           EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWET LT+ILNGAK+YFFKD+IMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMY 300

Query: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDG 360
           ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAP+TSDTIDDLIKTSAEAAAKSC+GG DG
Sbjct: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDG 360

Query: 361 HTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420
           HTCGL+WGKQT+DGYYGLGEQM+ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST
Sbjct: 361 HTCGLDWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           TNVLQNNLNI  G RAGAAIITAIILSVLIGGAVWMLF
Sbjct: 421 TNVLQNNLNITKGGRAGAAIITAIILSVLIGGAVWMLF 458

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/458 (89%), Positives = 437/458 (95%)

Query: 1   MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA 60
           MI+K+SM++   +CFTLLSFF+   AM+LD+TS TSICDATALIQDGMLDYYEGTRYGG 
Sbjct: 1   MIVKASMKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGT 60

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           VGMFQSPYYWWHAGEAFGGM+ENW+LC+NDTYQ LLYDALLAQTG++YDYIPANQTMVEG
Sbjct: 61  VGMFQSPYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEG 120

Query: 121 NDDQGIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQGIWGITVMGAVERNFT+P +G PGWLAMVQAVFNTMYSRWDSE+CGGGLRWQIFTW
Sbjct: 121 NDDQGIWGITVMGAVERNFTNPDNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTW 180

Query: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANV+DGA
Sbjct: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGA 240

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMY 300
           EIDTNCTDITKIEWTYNHGIVLGG+AYMYNATNGTSEW+TSL ++LNGA SYFFKD IMY
Sbjct: 241 EIDTNCTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMY 300

Query: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDG 360
           ESACQDY TCNTDQRTFKSIFSRMLGLTSVMAP+TSDTID LIKTSAEAAAKSCDGG DG
Sbjct: 301 ESACQDYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDG 360

Query: 361 HTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420
           HTCGL+W K+TNDGYYGLGEQM+ALEVIQNLLIHDRPAPYKE NGGTSKGDANAGMNSST
Sbjct: 361 HTCGLDWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSST 420

Query: 421 TNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           T+VLQNNLNI  GDRAGAAIITA+ILSVLIGGAVWMLF
Sbjct: 421 TSVLQNNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/445 (77%), Positives = 395/445 (88%), Gaps = 1/445 (0%)

Query: 15  FTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAG 74
           F LL       A++LD TSK SICDAT+LIQ GM+DYY GT+YGG VGMFQ PYYWW AG
Sbjct: 15  FQLLLTVHNTQAIDLDITSKESICDATSLIQGGMMDYYWGTQYGGTVGMFQPPYYWWEAG 74

Query: 75  EAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGA 134
           EAFGGM+ENW+LC+NDTY+++L  ALLAQTGSNYDYIPANQ+MVEGNDDQG+WG+T+MGA
Sbjct: 75  EAFGGMIENWYLCQNDTYEDMLKSALLAQTGSNYDYIPANQSMVEGNDDQGVWGLTLMGA 134

Query: 135 VERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNAC 194
            ERNFTDP DG PGWLAM QAVFNTM +RWDS HCGGGLRWQIFTWNSGYNYKNTISNAC
Sbjct: 135 AERNFTDPDDGTPGWLAMTQAVFNTMNARWDSAHCGGGLRWQIFTWNSGYNYKNTISNAC 194

Query: 195 LFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEW 254
           LFQ+AARLGRYTGNTTYL+VAE+VF WLVDVGYV+L+DTANVFDGAEID+NCTD+T+IEW
Sbjct: 195 LFQLAARLGRYTGNTTYLEVAEKVFTWLVDVGYVLLDDTANVFDGAEIDSNCTDMTQIEW 254

Query: 255 TYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFF-KDSIMYESACQDYSTCNTD 313
           TYNHG+VLGG AYMYNATNG+S+WE+ +TK+L GA +YFF  + IM+E+ACQ+Y+TCN D
Sbjct: 255 TYNHGVVLGGAAYMYNATNGSSDWESRVTKLLKGATTYFFDSNGIMFENACQEYNTCNND 314

Query: 314 QRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTND 373
           QR+FKSIFSRMLGLTSV+AP+TSDT+D LIKTSA AAAKSC GG DGHTCGLNW K ++D
Sbjct: 315 QRSFKSIFSRMLGLTSVLAPFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCGLNWAKGSHD 374

Query: 374 GYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNG 433
           GYYGLGEQM ALEV+QNLLIHDRPAP   + GG+SKGDA AG+NS+TTNVL+N + I NG
Sbjct: 375 GYYGLGEQMCALEVMQNLLIHDRPAPLTGNTGGSSKGDALAGLNSTTTNVLENKMTITNG 434

Query: 434 DRAGAAIITAIILSVLIGGAVWMLF 458
           DRAGAAI+TAIIL VL GGAVWM F
Sbjct: 435 DRAGAAIVTAIILGVLTGGAVWMFF 459

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/447 (74%), Positives = 387/447 (86%), Gaps = 2/447 (0%)

Query: 13  ICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWH 72
           I F LL    +  +++LD TSK SIC ATALIQ GMLDYYEG RYGGAVGMFQ PYYWW+
Sbjct: 6   ISFVLL-LPLLVQSIDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQPPYYWWN 64

Query: 73  AGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVM 132
            G AFGGMLEN +LCEN+T++ LL DAL+AQTG NYDYIP+NQ+MVEGNDDQG+WG+T+M
Sbjct: 65  GGVAFGGMLENMYLCENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQGVWGLTIM 124

Query: 133 GAVERNFTDPSD-GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTIS 191
            AVERNFT P+  G PGWLAM QAVFNTMY+RWD +HCGGGLRWQIFTWNSGYNYKNTI+
Sbjct: 125 DAVERNFTAPNKSGVPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGYNYKNTIA 184

Query: 192 NACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITK 251
           NACLFQ+AARLGRYTGN TYLDVAE+VFDW+VD+ Y+VLND ANVFDGA+ID NCTDIT 
Sbjct: 185 NACLFQMAARLGRYTGNQTYLDVAEKVFDWMVDINYIVLNDKANVFDGADIDENCTDITT 244

Query: 252 IEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCN 311
           +EWTYNHG+VLGG AYMYNATNG+S WET + KIL GA+ YFF+D++M ESACQ Y+TCN
Sbjct: 245 LEWTYNHGVVLGGCAYMYNATNGSSTWETRVNKILAGAQEYFFQDNVMLESACQSYNTCN 304

Query: 312 TDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQT 371
            DQR FKSIFSRMLG TSV+AP+T++TID LIK SAEAAA SC GG+DGHTCGL+W K +
Sbjct: 305 NDQRCFKSIFSRMLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHTCGLDWTKGS 364

Query: 372 NDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIK 431
           NDGYYGLGEQMNALE++ NLLIHDRPAP   + GGTS+GDA+AG+NS+TTNVL+N L I 
Sbjct: 365 NDGYYGLGEQMNALEIMSNLLIHDRPAPLTANTGGTSEGDASAGLNSTTTNVLENKLKIT 424

Query: 432 NGDRAGAAIITAIILSVLIGGAVWMLF 458
            GDRAGAAI+TA+IL + +GGAVWMLF
Sbjct: 425 QGDRAGAAIVTAVILGIFVGGAVWMLF 451

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/458 (73%), Positives = 387/458 (84%), Gaps = 5/458 (1%)

Query: 1   MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA 60
           M L  S+++  LI     + F    A+ L   +K SIC ATALIQ GMLDYYEGTRYGG 
Sbjct: 1   MKLLFSLQLWVLIG----TLFPDAGAINLQD-NKDSICAATALIQGGMLDYYEGTRYGGT 55

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           VGMFQ PYYWW AG AFGGMLENWFLC+NDTY++LL +AL+AQTG NYDYIPANQT VEG
Sbjct: 56  VGMFQPPYYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYDYIPANQTTVEG 115

Query: 121 NDDQGIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQG+WG+T++ AVERNF+ P DGKPGWLAM Q +FNTMY+RWD + C GGLRWQIFTW
Sbjct: 116 NDDQGVWGLTILDAVERNFSAPIDGKPGWLAMSQGIFNTMYARWDMQSCNGGLRWQIFTW 175

Query: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAE+VFDWLV VGY+VL++  NV+DGA
Sbjct: 176 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGYIVLSEKGNVYDGA 235

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMY 300
           +++ NCTDIT IEWTYNHG+VLGGLAYMYNATNG+S W++ LT +L GA +YFF+D IMY
Sbjct: 236 KVEDNCTDITAIEWTYNHGVVLGGLAYMYNATNGSSVWQSRLTSVLGGATAYFFQDDIMY 295

Query: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDG 360
           ESACQ Y TCN DQR FKSIFSRMLG TSV+AP+TSDTID L+K SA AAA SCDGG DG
Sbjct: 296 ESACQPYKTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDPLLKASAMAAAGSCDGGTDG 355

Query: 361 HTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420
           HTCGL+W  +TNDGYYGLGEQM+ALEVIQ LLIH+RPAPY+  NGGTS GDA AG+NS+T
Sbjct: 356 HTCGLDWQLKTNDGYYGLGEQMSALEVIQQLLIHERPAPYRADNGGTSVGDAAAGLNSTT 415

Query: 421 TNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           TNVL+NNL I  GDRAGAAI+T I+L ++IGGA WM+F
Sbjct: 416 TNVLKNNLKITGGDRAGAAIVTTIVLGIIIGGAAWMMF 453

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  706 bits (1823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/452 (73%), Positives = 386/452 (85%), Gaps = 1/452 (0%)

Query: 7   MEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQS 66
           M ++  +     +F     A++LD  SK SIC AT+LIQ GMLDYYEGTRYGG VGMFQ 
Sbjct: 1   MVLLLTVLLQAFNFITTVTAIDLDVNSKDSICAATSLIQGGMLDYYEGTRYGGTVGMFQP 60

Query: 67  PYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AGEAFGGM+ENWFLC+NDTY +++YDALLAQTGSNYDY+PANQT VE    + +
Sbjct: 61  PYYWWEAGEAFGGMIENWFLCQNDTYHDIIYDALLAQTGSNYDYVPANQTFVEVMMIK-V 119

Query: 127 WGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           +G TVM A ERNFT PSDGKP WLAM QAVFNTMY+RWDS +CGGGLRWQI+TWNSGYNY
Sbjct: 120 FGGTVMDAAERNFTAPSDGKPDWLAMAQAVFNTMYARWDSANCGGGLRWQIYTWNSGYNY 179

Query: 187 KNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNC 246
           KNT+SNACLFQIAARLGRYTGN TYL+VAE+VFDWLVDV +VVLND ANVFDGA I +NC
Sbjct: 180 KNTVSNACLFQIAARLGRYTGNDTYLEVAEKVFDWLVDVNFVVLNDEANVFDGANITSNC 239

Query: 247 TDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQD 306
           + + K+EW+YNHGIVLGGLAYMYNATNGTS+WE+ LTK+LNGAKS FFK++IMYE ACQD
Sbjct: 240 SAVVKLEWSYNHGIVLGGLAYMYNATNGTSKWESGLTKVLNGAKSIFFKNNIMYEQACQD 299

Query: 307 YSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLN 366
           ++TCNTDQR+FKSIFSRMLGLTSV+APYTSDTI  LI+ SAE AAKSCDGG DGHTCGLN
Sbjct: 300 HNTCNTDQRSFKSIFSRMLGLTSVLAPYTSDTITPLIQASAEGAAKSCDGGTDGHTCGLN 359

Query: 367 WGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQN 426
           W   TNDG YGLGEQM ALE++ NLLI +RPAPY   NGGTS GD +AG+N+++T+VL N
Sbjct: 360 WNLGTNDGKYGLGEQMCALEIMSNLLILNRPAPYTMHNGGTSVGDPSAGLNATSTSVLSN 419

Query: 427 NLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           NL+IK  DRAGAAI+TA+IL VL+GG+VWMLF
Sbjct: 420 NLDIKQKDRAGAAIVTAVILFVLLGGSVWMLF 451

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/453 (73%), Positives = 388/453 (85%), Gaps = 5/453 (1%)

Query: 9   MIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPY 68
           M+  + F LL    +  A++LD++SKTSICDATALIQDGMLDYYEG RYGG VGMFQSPY
Sbjct: 1   MMITLLFPLL--LTVAKAIDLDTSSKTSICDATALIQDGMLDYYEGIRYGGTVGMFQSPY 58

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AGEAFGGMLENWFLCENDT++E++YDA+LAQTGS+YD++P NQTMVEGNDDQ +WG
Sbjct: 59  YWWEAGEAFGGMLENWFLCENDTFKEIIYDAILAQTGSDYDFMPENQTMVEGNDDQCVWG 118

Query: 129 ITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           +T+M AVERNFTDP+DG PGWL M QA+FN M+SRWDS +CGGGLRWQIFTWNSGY+YK+
Sbjct: 119 LTIMDAVERNFTDPTDGSPGWLYMTQAIFNEMWSRWDSANCGGGLRWQIFTWNSGYDYKS 178

Query: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYV-VLNDTANVFDGAEIDTNCT 247
           TISN CLFQ+A+RLGRYTGN TYLDVAE V+DWLVDVG++ V N TA V+DGA+I  NCT
Sbjct: 179 TISNVCLFQLASRLGRYTGNDTYLDVAESVYDWLVDVGFINVANGTAYVYDGADISENCT 238

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
           DIT I+W+YNHGI+LGG AY YNATNG+S WE+ +T I+ GAKS FF D IMYESACQDY
Sbjct: 239 DITTIDWSYNHGILLGGAAYAYNATNGSSVWESRVTDIVEGAKSIFFSDGIMYESACQDY 298

Query: 308 STCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNW 367
            TCN DQR+FKSIFSRMLG TSV+AP+T+ TID LIK+SA A A SCDGG DGHTCGLNW
Sbjct: 299 DTCNNDQRSFKSIFSRMLGFTSVLAPFTASTIDPLIKSSAAACALSCDGGTDGHTCGLNW 358

Query: 368 GKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTT--NVLQ 425
             +T DG YGLGEQM+ALEVIQNLLIHDRPAPY  S GG+S GDA+AG+N++T+  +VL+
Sbjct: 359 QDKTCDGNYGLGEQMSALEVIQNLLIHDRPAPYTASTGGSSVGDASAGLNTTTSSADVLE 418

Query: 426 NNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           NNL I + DRAGAAIITA+IL  + GGA+WMLF
Sbjct: 419 NNLTITSKDRAGAAIITAVILGCMAGGAIWMLF 451

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/451 (72%), Positives = 386/451 (85%), Gaps = 1/451 (0%)

Query: 9   MIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPY 68
           MI L+   +     I HA++LD++SK SIC AT+LIQ GMLDYYEGT+YGG VGMFQ PY
Sbjct: 1   MISLLISLIYMSLNIVHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPY 60

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AGEAFGGML+N +LC+N+TY++L+YDA++AQTG NYDYIPANQ+MVEGNDDQG+WG
Sbjct: 61  YWWQAGEAFGGMLDNIYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWG 120

Query: 129 ITVMGAVERNFTDPS-DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           IT+MGAVERNFT+P+ +G PGWLAMVQAVFNTMY+RWDS+HCGGGLRWQIFTWNSGYNYK
Sbjct: 121 ITIMGAVERNFTNPTKEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYK 180

Query: 188 NTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           NTI+N CLFQIAARLGRYTGN TYL+VA +V+DWL DVG+VVL D ANVFDGA I+ NC+
Sbjct: 181 NTIANGCLFQIAARLGRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCS 240

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
            I KIEWTYNHG+VLGG AYMYNATNG+  W+T LT++L+GA  +FF +SIMYE ACQ  
Sbjct: 241 SIVKIEWTYNHGVVLGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGS 300

Query: 308 STCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNW 367
            TCN DQR+FKSIFSRMLGLTSV+AP+T DTID LIK SAE AA+SC GG DGHTCGL+W
Sbjct: 301 GTCNNDQRSFKSIFSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDW 360

Query: 368 GKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNN 427
               +DGYYGLGEQM+ALE++QNLLI D P P+   NGG+S GD NAG+NSS+ NVL+NN
Sbjct: 361 TLGHHDGYYGLGEQMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENN 420

Query: 428 LNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           L+I + DR GAAIITAI+L V+IGG+VWM+F
Sbjct: 421 LSITHKDRVGAAIITAIVLGVMIGGSVWMVF 451

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/435 (74%), Positives = 376/435 (86%), Gaps = 2/435 (0%)

Query: 26  AMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWF 85
            ++LD +SK SIC ATALIQ GMLDYYEGTR GG VGMFQSPYYWW AGEAFGGM++NW+
Sbjct: 2   GLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNWY 61

Query: 86  LCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPSDG 145
            CEN T++ L+YD +LAQTG +YDY+P NQTMVEGNDDQG+WG+T+MGAVERNFT+P++G
Sbjct: 62  FCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPTNG 121

Query: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRY 205
            PGWLAM QA+FN + SRWD+ +CGGGLRWQIFTWN GYNYKNTISNACLFQIAARLGRY
Sbjct: 122 APGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLGRY 181

Query: 206 TGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265
           TGN TYL+VAE VFDWLVDVGYVVL D  NVFDGAEID NCT I K+EW+YNHG+VLGGL
Sbjct: 182 TGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLGGL 241

Query: 266 AYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQ--DYSTCNTDQRTFKSIFSR 323
           A+MYNATNG+SEWET +T+IL GA+SYFFKDSIMYES CQ    STCN+DQR+FK+IFSR
Sbjct: 242 AFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIFSR 301

Query: 324 MLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQMN 383
           MLGLTSV+ P T   +DDL+K SA AAA SC GG DGHTCGLNW KQ NDGYYGLGEQM+
Sbjct: 302 MLGLTSVLVPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQMS 361

Query: 384 ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAIITA 443
           ALEV+Q LLIH + AP+ E  GG+S GDANAG+N+S+ NVLQN L+I+  DRAGAAIITA
Sbjct: 362 ALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAIITA 421

Query: 444 IILSVLIGGAVWMLF 458
           +IL VL+GG++WMLF
Sbjct: 422 VILMVLVGGSIWMLF 436

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/446 (71%), Positives = 378/446 (84%), Gaps = 1/446 (0%)

Query: 13  ICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWH 72
           +  + LSF     AM+LD++SK SIC AT+LI  GMLDYY GT+YGG VGMFQ PYYWW 
Sbjct: 6   LILSALSFVSFTFAMDLDTSSKESICGATSLIIKGMLDYYWGTQYGGTVGMFQPPYYWWE 65

Query: 73  AGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVM 132
           AGEAFGGMLENW+LC+NDTY +LL+DAL AQTG +YDYIP NQTMVEGNDDQ IWG+TVM
Sbjct: 66  AGEAFGGMLENWYLCQNDTYADLLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIWGLTVM 125

Query: 133 GAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISN 192
            AVERNFT+P++G PGWLAM QAVFNTM+SRWD+  CGGGLRWQIFTWNSGY+YKNTISN
Sbjct: 126 DAVERNFTNPTEG-PGWLAMGQAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDYKNTISN 184

Query: 193 ACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKI 252
           ACLFQ+AARLGRYTGN TYLDVA  VFDWL  VGYV +++ A V+DGA+I  NCTDITK 
Sbjct: 185 ACLFQMAARLGRYTGNNTYLDVANDVFDWLTGVGYVNMDNAAEVYDGADISENCTDITKY 244

Query: 253 EWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNT 312
           +W+YN+G +LGG AYMYNATNG+S WET +T++LNGAK+YFF+D IMYESACQ   TCN 
Sbjct: 245 QWSYNNGCMLGGAAYMYNATNGSSIWETRVTQLLNGAKAYFFQDDIMYESACQTAKTCNN 304

Query: 313 DQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTN 372
           DQR+FKS+FSRMLG TSV+ P T D ID LI  SA+ AA++C+GG DGHTCGLNW   T+
Sbjct: 305 DQRSFKSLFSRMLGFTSVLVPSTRDIIDPLILASAQGAARTCNGGTDGHTCGLNWQASTH 364

Query: 373 DGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKN 432
           DGYYGLGEQM+ALEVIQNLLIHDRPAPY   +GG+S+GDANAG+N ++ NVL N+L+IK 
Sbjct: 365 DGYYGLGEQMSALEVIQNLLIHDRPAPYTSIDGGSSEGDANAGLNKTSKNVLSNDLDIKT 424

Query: 433 GDRAGAAIITAIILSVLIGGAVWMLF 458
           GD+ GAAI+TA +L++L+GGA+WMLF
Sbjct: 425 GDKVGAAILTAGVLAILVGGAIWMLF 450

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/462 (69%), Positives = 385/462 (83%), Gaps = 13/462 (2%)

Query: 9   MIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPY 68
           M  L    L+S      A+ LD  SK S+C+ATALIQ GMLDYY+GTRYGG VGMFQ PY
Sbjct: 1   MFYLTLLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPY 60

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AGEAFGGMLENW+LC+NDT++ L+ DAL+ Q GSNYDYIP+NQT+VEGNDDQG+WG
Sbjct: 61  YWWEAGEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWG 120

Query: 129 ITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           +TV+GAVERN  D  DG PGWLA+ QAVFNTMY+RWD+ +CGGGLRWQI+TWNSGYNYKN
Sbjct: 121 LTVLGAVERNLPD-RDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKN 179

Query: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           TISNACLFQIAARLGRYTGN TYL+VAE+VFDW+VDV Y+VL D ANV+DGA  + NC+D
Sbjct: 180 TISNACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSD 239

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYS 308
           I + EW+YNHG+VLGGLAYMYNATNGTS+WET+LT++L+GA +YFFK++IMYESACQ+  
Sbjct: 240 IVQYEWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAK 299

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWG 368
           TCNTDQR+FKSIFSRMLG T V+APYT+ T+D LI+TSA+AAA SCDGG DG TCGL+W 
Sbjct: 300 TCNTDQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWF 359

Query: 369 KQTNDGYYGLGEQMNALEVIQNLLI------------HDRPAPYKESNGGTSKGDANAGM 416
             TNDGYYGLGEQM+ALE+I  LL+                +PY  S+GG S GDA+AG+
Sbjct: 360 DSTNDGYYGLGEQMSALEIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASAGL 419

Query: 417 NSSTTNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           N+++TNVLQNNL+I++ D+AGAA+ TA+IL+VL+GG+VWMLF
Sbjct: 420 NTTSTNVLQNNLDIESKDKAGAAVATAVILAVLVGGSVWMLF 461

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/439 (70%), Positives = 365/439 (83%), Gaps = 6/439 (1%)

Query: 21  FRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGM 80
           F    A+ LD      +C ATAL+ DG+LDYY GTRYGG VGMFQ PYYWWHAGEAFGGM
Sbjct: 30  FTGASALSLDP-----VCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFGGM 84

Query: 81  LENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFT 140
           +ENWFLC+N TY+ LL DA +AQTG+NYDYIP NQTMVEGNDDQGIWG+T+M AVERNFT
Sbjct: 85  IENWFLCQNSTYETLLMDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERNFT 144

Query: 141 DPS-DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIA 199
            P+ DG PGWLAM QAVFNTM++RWD++HCGGGLRWQIFTWNSGYNYKNTISNACLF +A
Sbjct: 145 KPTKDGVPGWLAMSQAVFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFNLA 204

Query: 200 ARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHG 259
           ARLGRYTGN+TYLDVA+QVFDW+V VGYVVL DTANVFDGA I+ NCT IT  EW+YNHG
Sbjct: 205 ARLGRYTGNSTYLDVADQVFDWMVSVGYVVLGDTANVFDGANIEDNCTTITTFEWSYNHG 264

Query: 260 IVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRTFKS 319
           +VLGG A+MYNATNG+S WE  + +IL GA +YFF+DSIM+ESACQD   CN DQRTFK+
Sbjct: 265 VVLGGTAFMYNATNGSSVWEDRVNRILKGATTYFFRDSIMFESACQDTGKCNNDQRTFKA 324

Query: 320 IFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLG 379
           IFSRML  T+V+ P T+ TID L+++SA+AAA+SC GG DGHTCGLNW     DG YGLG
Sbjct: 325 IFSRMLSFTAVLVPSTASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYGLG 384

Query: 380 EQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAA 439
           EQM+ALEV+  LL+HDRPAPY  + GG+S GDA+AG+NS+ TNV  N+LNI+  D+AGAA
Sbjct: 385 EQMSALEVMNYLLVHDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSLNIRGKDKAGAA 444

Query: 440 IITAIILSVLIGGAVWMLF 458
           I+T +IL  L GG++WMLF
Sbjct: 445 IVTTVILGTLAGGSIWMLF 463

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/453 (69%), Positives = 369/453 (81%), Gaps = 3/453 (0%)

Query: 7   MEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQS 66
           M++ PL  ++L        A++LD++SK+SIC ATALIQ G+ DYYEG  YGG VGMF S
Sbjct: 1   MKISPL--YSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVS 58

Query: 67  PYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AG  FGGM+ENW+LC+N +Y+++LYDAL+AQTGS+YDY+P+NQTMVEGNDDQG+
Sbjct: 59  PYYWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGV 118

Query: 127 WGITVMGAVERNFTDPS-DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185
           W +TVM AVERNFT+P  DG PGWLAMVQAVFN MYSRWDS+HC GGLRWQIFTWNSGYN
Sbjct: 119 WALTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYN 178

Query: 186 YKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTN 245
           YKNTISN CLFQ+AARLGRYTGNTTYL+VAE+VFDWLVD+ +VV+ + ANVFDGA ID N
Sbjct: 179 YKNTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDN 238

Query: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQ 305
           CT I K EW+YNHG+VLGG AYMYNATNG+  W+T   +IL GA S+FF+D IMYES CQ
Sbjct: 239 CTSIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQ 298

Query: 306 DYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGL 365
             + CNTDQR FK+IFSRMLG TSV+AP+T+DTI  LI TSA AAAKSC GG DGHTCGL
Sbjct: 299 ASNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSAAAAAKSCSGGTDGHTCGL 358

Query: 366 NWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQ 425
           NW     DG YGLGEQ  ALE+I  LL+HD PAP  ES GG+S GDA+AG+N STTNVLQ
Sbjct: 359 NWFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTGGSSSGDASAGLNVSTTNVLQ 418

Query: 426 NNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
            N+NI  GD+AGA IIT I+L VL+ G VWM+ 
Sbjct: 419 KNINITAGDKAGAGIITTIVLGVLVLGTVWMVL 451

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/443 (67%), Positives = 367/443 (82%), Gaps = 4/443 (0%)

Query: 20  FFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGG 79
           F     A++LD++SK SICDAT+LIQ G++DYYEG R+GG VGMFQ PYYWW AGE FGG
Sbjct: 15  FTSQVSAIDLDTSSKDSICDATSLIQKGVMDYYEGNRFGGTVGMFQQPYYWWEAGEVFGG 74

Query: 80  MLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNF 139
           M+ENWFLC+NDTY++ LYDA++AQ G +YD++P+NQ+MVEGNDDQG+WG+T+M AVERNF
Sbjct: 75  MMENWFLCQNDTYEKTLYDAMIAQAGPDYDFMPSNQSMVEGNDDQGVWGLTLMSAVERNF 134

Query: 140 TDPSD-GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQI 198
           T+P++ G PGWLAMVQ VFNTM+SRWDS+HCGGGLRWQIFTWNSGYNYKNT+SNACLFQ+
Sbjct: 135 TNPTEKGVPGWLAMVQGVFNTMWSRWDSDHCGGGLRWQIFTWNSGYNYKNTVSNACLFQL 194

Query: 199 AARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDT--ANVFDGAEIDTNCTDITKIEWTY 256
           AARLGRYTGN TYL  AE V++WLVD+G+V  N++  ANV+DGA ID NCTDI +IEW+Y
Sbjct: 195 AARLGRYTGNETYLTKAETVWNWLVDIGFVRFNESGNANVYDGATIDKNCTDIVEIEWSY 254

Query: 257 NHGIVLGGLAYMYNAT-NGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQR 315
           N GIVLGG AYMYNAT NGTS+WE+ L +I+ G+   FF++ IMYE+ CQD   CN DQR
Sbjct: 255 NQGIVLGGAAYMYNATHNGTSDWESRLNQIVGGSTDIFFRNKIMYEATCQDSGKCNQDQR 314

Query: 316 TFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGY 375
           +FKSIFSRML LT  +APYT+D ID L+K SAE AAKSC GG DGHTCGLNW K  +DG+
Sbjct: 315 SFKSIFSRMLSLTRTLAPYTADKIDPLMKASAEGAAKSCTGGTDGHTCGLNWEKGEHDGW 374

Query: 376 YGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDR 435
           YGLGEQ  ALE IQ+ L   RPAPY   NGGTS GD  AG+N ++TNVL ++LNI   D+
Sbjct: 375 YGLGEQACALEGIQSQLYSMRPAPYTADNGGTSVGDTEAGLNKTSTNVLHSDLNITQKDK 434

Query: 436 AGAAIITAIILSVLIGGAVWMLF 458
            GA+IITA++L+VL+GG++WM+F
Sbjct: 435 VGASIITAVLLAVLVGGSIWMIF 457

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/436 (67%), Positives = 361/436 (82%), Gaps = 4/436 (0%)

Query: 27  MELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFL 86
           ++LD++  +SICDAT+LIQ G++DYY GTR GG VGMFQ PYYWW AGE FGGMLENWFL
Sbjct: 19  IDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFL 78

Query: 87  CENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPS-DG 145
           C+NDTY +++YDA++ Q G +YD++P+NQ+MVEGNDDQG+WG+TVM A ERNFT+P+ DG
Sbjct: 79  CQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDG 138

Query: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRY 205
            PGWLAM Q VFNTM+ RWDSEHCGGG+RWQIFTWNSGYNYKNT+SNAC+FQ+AARLGRY
Sbjct: 139 VPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRY 198

Query: 206 TGNTTYLDVAEQVFDWLVDVGYVVLNDT--ANVFDGAEIDTNCTDITKIEWTYNHGIVLG 263
           TGN TYL  AE V+DWLVDVG+VVLN+   ANV+DGA ID NCTDI K EW+YN GIVLG
Sbjct: 199 TGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLG 258

Query: 264 GLAYMYNAT-NGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRTFKSIFS 322
           G AYMYNAT N TS W++ L +I+ G+  +FFKD +MYES CQD  TCN DQR+FKSIFS
Sbjct: 259 GAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIFS 318

Query: 323 RMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQM 382
           RML LT  +APYT++TID L++ SAE AAKSC GG DGHTCGLNW    +DGYYGLGEQ 
Sbjct: 319 RMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQA 378

Query: 383 NALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAIIT 442
            ALE IQ+L+   RPAPY   NGG+S GD  A +NS++TNVLQ+++ I + D+ GA+IIT
Sbjct: 379 CALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASIIT 438

Query: 443 AIILSVLIGGAVWMLF 458
           A+IL+VL+GG++WM+F
Sbjct: 439 AVILAVLVGGSIWMIF 454

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/435 (69%), Positives = 357/435 (82%), Gaps = 2/435 (0%)

Query: 26  AMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWF 85
           A++L    K S+C ATALIQ GMLDYY G +YGGA+GMFQ PYYWW AGEAFGGM++NW 
Sbjct: 19  AVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEAFGGMIDNWH 78

Query: 86  LCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPSDG 145
            C+N+T++EL+ +A+L Q G +YDY+P NQTMVEGNDDQG+WG+TVM AVERNFTDP DG
Sbjct: 79  FCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVERNFTDPGDG 138

Query: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRY 205
           KPGWLAM QAVFN +  RWD + C GG+RWQIFTWNSGYNYKNTISN C FQ+AARLGRY
Sbjct: 139 KPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCYFQLAARLGRY 198

Query: 206 TGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265
           T N TYL+VAE+VFDWL DVG+VVL D  NVFDGA  D NCT +T++EWTYNHGI+LGG 
Sbjct: 199 TNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWTYNHGIILGGS 258

Query: 266 AYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQ--DYSTCNTDQRTFKSIFSR 323
           AYMYNATNG+S+WE  + +ILNGA  YFF+D++MYES CQ  D S CN DQR+FKSIFSR
Sbjct: 259 AYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNNDQRSFKSIFSR 318

Query: 324 MLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQMN 383
           MLGLTSV+ P  SD +D L+  SAE AAKSC GG DGHTCGLNW K + D  YGLGEQM+
Sbjct: 319 MLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWDNQYGLGEQMS 378

Query: 384 ALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAIITA 443
           ALEVIQN LIH+   PY+ES GG+SKGD+ AG+N++TTNVLQ  L I++ DRAGAAIIT 
Sbjct: 379 ALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSKDRAGAAIITG 438

Query: 444 IILSVLIGGAVWMLF 458
           ++L V++GG+VWMLF
Sbjct: 439 VVLMVVVGGSVWMLF 453

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/451 (63%), Positives = 346/451 (76%), Gaps = 1/451 (0%)

Query: 9   MIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPY 68
           ++ L    LL    +C  ++LD  SK SIC AT  IQ G++DYY G+  GG VGMF  PY
Sbjct: 4   IVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPY 63

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AG  F GMLENW+LC+N  Y   LY++++AQTG+NYDYIP+NQ+M EGNDDQGIWG
Sbjct: 64  YWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWG 123

Query: 129 ITVMGAVERNFTDPSDGK-PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           + +MGAVERNF D   G  PGWL M QAVFNTMY+RWDS+HCGGGLRWQIFTWN GY+YK
Sbjct: 124 LFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYK 183

Query: 188 NTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           NTI+N CLFQ+AARLGRYTGN+TYLD+A + F WLVDV +VVL D ANVFDGA I  NC 
Sbjct: 184 NTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQ 243

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
           DI  IEWTYNHG++LGG AYMYNATNG   WET L +IL GA+++FF+++IMYE ACQD 
Sbjct: 244 DIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDN 303

Query: 308 STCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNW 367
             CN DQR+FKSIFSRML +TSV+AP+T +TID L++ SA AAA SC GG+DG TCGL+W
Sbjct: 304 KICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEASAAAAAASCSGGKDGETCGLDW 363

Query: 368 GKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNN 427
              + DGYYGLGEQ +ALEVIQNLLIH +  P  ++ GGTS GD  AG+ +   NVL + 
Sbjct: 364 TTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSR 423

Query: 428 LNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           LNI + DR  AA+ITA+ L +L+G A+WM+ 
Sbjct: 424 LNIGSKDRIKAALITAVCLGLLVGTALWMVI 454

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/460 (60%), Positives = 349/460 (75%), Gaps = 3/460 (0%)

Query: 1   MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA 60
           M L + M  + L+   LL    +  A++LD +S+  +C  T  IQ G++DYY G++YGG 
Sbjct: 1   MYLSAGMTGL-LVGLFLLMQGMLSRALDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGI 59

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           VGMFQ PYYWW AGE FGGMLENW+LC+N  Y+ +L ++++AQTG  +DYIPANQ+  EG
Sbjct: 60  VGMFQPPYYWWEAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEG 119

Query: 121 NDDQGIWGITVMGAVERNFTDP-SDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFT 179
           NDDQG+W + +MGAVERNF DP  +G PGWL MVQ VFN M +RWD+E+CGGGLRWQIF 
Sbjct: 120 NDDQGVWALFIMGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQ 179

Query: 180 WNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDG 239
           WN+GY YKNTI+N CLFQ+AARLGRYTGN TYLDVA +VF WLVDV Y+VL D A VFDG
Sbjct: 180 WNNGYTYKNTIANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDG 239

Query: 240 AEIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIM 299
           A I  NC+DI  IEW+YNHGI+L G AYMYNAT G+ EWE+ +TKIL GA  ++F+D IM
Sbjct: 240 AHIHENCSDIKGIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIM 299

Query: 300 YESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRD 359
           YE ACQDY+TC+ DQR+FKSIFSRML +TSV+AP+T  TID+LI  SA AA+KSC+ G  
Sbjct: 300 YERACQDYNTCDNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTH 359

Query: 360 GHTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNS- 418
           G+TCGLNW K T DG YGLGEQ +ALE+IQN+LIH +  P     GG S+G+ +AG++  
Sbjct: 360 GYTCGLNWHKGTYDGVYGLGEQASALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHD 419

Query: 419 STTNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           S   +L+   NI   DR GA++ITAI L +++G A+WM+F
Sbjct: 420 SQPAILRGMHNITGKDRVGASLITAISLGLMLGCALWMIF 459

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/403 (68%), Positives = 323/403 (80%), Gaps = 12/403 (2%)

Query: 23  ICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLE 82
           +  +++L+ TS TSICDAT++I  G+LDYYEGTR+ G VGMFQ PYYWW AG AFGGMLE
Sbjct: 23  VGSSIKLNVTSNTSICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGMLE 82

Query: 83  NWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDP 142
           NW+LC+NDT++ LL DA+L Q G +YDY+P NQTMVE NDDQG+WG+T+MGAVERNFTDP
Sbjct: 83  NWYLCQNDTFESLLTDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTDP 142

Query: 143 SDGK--PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAA 200
             GK  PGWLAM Q++FN MYSRWD+  CGGGLRWQI+ WN GYNYKNTIS ACLFQ+AA
Sbjct: 143 Q-GKDVPGWLAMAQSIFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAA 201

Query: 201 RLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTA-NVFDGAEIDTNCTDITKIEWTYNHG 259
           RLGRYTGN+TYL VA++ F W+VD+GY+ LN ++  VFDGA I++NC+DITK+EW+YNHG
Sbjct: 202 RLGRYTGNSTYLKVADKTFQWMVDIGYIQLNTSSGRVFDGAHIESNCSDITKLEWSYNHG 261

Query: 260 IVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQ--DYSTCNTDQRTF 317
           IVLGG AYMYNAT  + EW  +  KILNGA +YFF++  M E+ACQ  D   CN DQRTF
Sbjct: 262 IVLGGCAYMYNATK-SPEWGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTF 320

Query: 318 KSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYG 377
           KSIFSRMLGLTSVMAP+TS+ ID LI  SAEAAA SC GG D  TCGLNW +  NDGYYG
Sbjct: 321 KSIFSRMLGLTSVMAPFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYG 380

Query: 378 LGEQMNALEVIQNLLIHDRPAPY-----KESNGGTSKGDANAG 415
           LGEQ++ALEVIQNLLIH RP PY     K   GG SKGD  AG
Sbjct: 381 LGEQLSALEVIQNLLIHKRPPPYMAKTDKNKVGGVSKGDPAAG 423

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/449 (59%), Positives = 332/449 (73%), Gaps = 3/449 (0%)

Query: 10  IPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYY 69
           +P+    ++    + +A+++D  S  SICDAT LIQ G+LDYYEG R GG VG FQ PYY
Sbjct: 14  LPMYVLLVILNIVLSNALDVDFNSSESICDATKLIQVGILDYYEGLRPGGRVGFFQKPYY 73

Query: 70  WWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGI 129
           WW AGEAFGGM+ENW+LC N  YQ+LL DA+++Q G N DY+P++Q M+EGNDDQGIWG+
Sbjct: 74  WWMAGEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYVPSHQKMIEGNDDQGIWGL 133

Query: 130 TVMGAVERNFTD-PSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
            VMGA ERNF D P +  PGWLA+ QAVFNTM++RWD E+CGGGLRWQIF WN+GY+YKN
Sbjct: 134 LVMGAAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNNGYDYKN 193

Query: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           TISNACLFQIAARL R+TGN+TY DVAE VFDWLVD   V L + A V DGA I   C D
Sbjct: 194 TISNACLFQIAARLARFTGNSTYQDVAETVFDWLVDSKLVQLENDAKVLDGAHISERCED 253

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYS 308
            +K+EWTYNHG+VL G AYMYN TNG++ W   L K+LNG+   FF + I+YE ACQD  
Sbjct: 254 HSKLEWTYNHGVVLAGCAYMYNITNGSAVWGDRLNKVLNGSL-LFFPNGILYERACQDVQ 312

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWG 368
            CN DQR+F+SIFSRML LTSV+AP+T   I+  I+ SAEAAAKSC GGRDGHTCG+ W 
Sbjct: 313 KCNDDQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWR 372

Query: 369 KQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQ-NN 427
             T DG YGLGEQ++ALE+IQN LIH +P P   + G  SKGD +AG+  ++ N++  + 
Sbjct: 373 NYTWDGKYGLGEQLSALEIIQNTLIHTKPPPTTANEGAKSKGDPSAGLYDNSPNIITLST 432

Query: 428 LNIKNGDRAGAAIITAIILSVLIGGAVWM 456
             I   DR GA  +T ++L   I G++WM
Sbjct: 433 RQIGLKDRVGAGFMTVVLLIPFITGSIWM 461

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/446 (60%), Positives = 326/446 (73%), Gaps = 5/446 (1%)

Query: 15  FTLLSFFRIC--HAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWH 72
           + LL    I   +A+++D  S  SICDAT LIQ G+LDYYEG + GG  G    PYYWW 
Sbjct: 2   YVLLVILNIVLSNALDVDFNSSESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYYWWM 61

Query: 73  AGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVM 132
           AGEAFGGM+ENW+LC N  YQ+LL DA+++Q G N DY+P++Q MVEGNDDQGIWG+ VM
Sbjct: 62  AGEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGLLVM 121

Query: 133 GAVERNFTD-PSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTIS 191
           GA ERNF D P +  PGWLA+ QAVFNTM++RWD E+CGGGLRWQIF WN GY+YKNTIS
Sbjct: 122 GAAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKNTIS 181

Query: 192 NACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITK 251
           NACLFQIAARL R+TGN+TY DVAE VFDWLVDV  V L + A V DGA I   C D ++
Sbjct: 182 NACLFQIAARLARFTGNSTYQDVAETVFDWLVDVKLVELENDARVLDGAHISERCEDHSQ 241

Query: 252 IEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCN 311
           +EWTYNHG+VLGG AYMYN TNG++ W   L K+LNG+   FF++ I+YE ACQD + CN
Sbjct: 242 LEWTYNHGVVLGGCAYMYNITNGSAVWGDRLNKVLNGSL-LFFENGILYERACQDVNKCN 300

Query: 312 TDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQT 371
            DQR+F+SIFSRML LTSV+AP+T   I+  I+ SAEAAAKSC GGRDGHTCG+ W   T
Sbjct: 301 DDQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYT 360

Query: 372 NDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTN-VLQNNLNI 430
            DG YGLGEQ++ALE+IQN LIH +P P   + G  S+GD  AG+  S+ N +      I
Sbjct: 361 WDGKYGLGEQLSALEIIQNTLIHTKPPPTTANEGAKSQGDPGAGLQLSSPNSITLPTRQI 420

Query: 431 KNGDRAGAAIITAIILSVLIGGAVWM 456
           +  DR GA   T + L   I G++WM
Sbjct: 421 RLKDRVGAGFATVVFLLPFITGSIWM 446

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/375 (63%), Positives = 305/375 (81%), Gaps = 2/375 (0%)

Query: 26  AMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWF 85
           ++ LD TS  SICDAT+L+Q G+LDYYEGT YGG VGMFQ+PYYWWH+G AFG M+ENW+
Sbjct: 28  SLTLDQTSSKSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHSGCAFGSMIENWY 87

Query: 86  LCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPSDG 145
           LC++DTY+ L+ DA+LAQ G NYD++P NQTMVEGNDDQG+WG+ +M A ER F     G
Sbjct: 88  LCQDDTYESLITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMDAAEREFPQ-VKG 146

Query: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRY 205
           +P WL M + +F +M++RWD+ +CGGGLRWQI++WN+GY+YKNT+S  CLFQ+AARLGRY
Sbjct: 147 QPSWLTMAENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVSTTCLFQLAARLGRY 206

Query: 206 TGNTTYLDVAEQVFDWLVDVGYVVL-NDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGG 264
           TGN TY+  A Q FDWL  VG+V+  N+   VFDGA+I TNCT+I K EW+YNHGIVLGG
Sbjct: 207 TGNETYVKAANQAFDWLQGVGFVMFKNNDGYVFDGADISTNCTNIKKYEWSYNHGIVLGG 266

Query: 265 LAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRTFKSIFSRM 324
            AYMYN T+G+S WET  +++LN A SYFF++ IM+E+ CQ  + CN DQR+F+SIF+RM
Sbjct: 267 AAYMYNLTDGSSTWETRTSQLLNLASSYFFQNGIMFEAECQTSNICNNDQRSFRSIFARM 326

Query: 325 LGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQMNA 384
           LG TS+MAP+T++TID L+KT+++AAA +C GG+DGHTCGLNW     DG YGLGE+M+A
Sbjct: 327 LGKTSIMAPFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLNSNFDGNYGLGEEMSA 386

Query: 385 LEVIQNLLIHDRPAP 399
           +EVIQNLLIH RPAP
Sbjct: 387 MEVIQNLLIHQRPAP 401

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/382 (63%), Positives = 301/382 (78%), Gaps = 2/382 (0%)

Query: 27  MELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFL 86
           +E+D+ SK SIC+AT+LIQDG+LDYYEG RYGG VG+FQ PYYWW +GEAFG +L NW+L
Sbjct: 17  IEIDTHSKESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYL 76

Query: 87  CENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPSDGK 146
           C+NDTY++L+YDA+LAQ G NYD++P NQTMVEGNDDQG++ +T++ A+ERNFT P  G 
Sbjct: 77  CQNDTYEKLIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPKGS 136

Query: 147 PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYT 206
           P WL M Q VFN+MY RWD+  C GG+RWQI++WN+GY+YKN +S   LF IAARL RYT
Sbjct: 137 PSWLDMNQRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARYT 196

Query: 207 GNTTYLDVAEQVFDWLVDVGYVVLNDT-ANVFDGAEIDTNCTDITKIEWTYNHGIVLGGL 265
           GN +Y  VA+ +FDWL  V YV+ +D    V DGA I+ NCTDIT+IEWTYN GI++ G 
Sbjct: 197 GNASYFQVADTIFDWLTSVNYVMFDDKYGYVMDGASIEQNCTDITRIEWTYNFGIIMDGC 256

Query: 266 AYMYNATNGTSEWETSLTKILNGAKSYFF-KDSIMYESACQDYSTCNTDQRTFKSIFSRM 324
           AY+YNATNG+++WE   TK+L GAK  FF K+ IMYE+ACQ  + CN DQR+FK++ +R 
Sbjct: 257 AYLYNATNGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTNNKCNNDQRSFKALLARF 316

Query: 325 LGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQMNA 384
           LG TSV+APYT  TI  +I  SA  AAKSC+GG DGHTCGL+W K TNDGYYG+GEQM+A
Sbjct: 317 LGTTSVLAPYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQMSA 376

Query: 385 LEVIQNLLIHDRPAPYKESNGG 406
           LE+IQNLLI+D P P    NGG
Sbjct: 377 LEIIQNLLINDYPPPLVAPNGG 398

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/412 (60%), Positives = 304/412 (73%), Gaps = 6/412 (1%)

Query: 9   MIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPY 68
           M  L+ F ++    +C+A++++  S  SIC+AT LIQ G+LDYYEG R GG VG FQ PY
Sbjct: 1   MYALVIFNIV----LCNALDVNFNSSASICNATKLIQQGILDYYEGLRPGGRVGFFQEPY 56

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AG+ FGGM+ENW+LC+N  Y++LL +A+++Q G N DY+P +Q MVEGNDDQGIWG
Sbjct: 57  YWWMAGDVFGGMVENWYLCDNTEYKDLLTEAMVSQIGENKDYVPWHQRMVEGNDDQGIWG 116

Query: 129 ITVMGAVERNFTD-PSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           + VM A ER+F D P D  PGWLA+ QAVFNTM++RWD ++C GGL WQI+ WN GY+YK
Sbjct: 117 LLVMDAAERDFPDAPPDQAPGWLALAQAVFNTMWARWDMDNCAGGLLWQIYPWNVGYDYK 176

Query: 188 NTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           NTISN  LFQIAARL R+TGN+TY  VAE VFDWLVD   V L++ A V DGA + TNCT
Sbjct: 177 NTISNGYLFQIAARLARFTGNSTYGRVAETVFDWLVDSKLVQLDNVALVLDGAHVYTNCT 236

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
           D T+ EWTYN+G+VLGG AYMYN TNG+  W   L ++LNGA   FF++ IMYE  CQD 
Sbjct: 237 DFTRYEWTYNYGVVLGGCAYMYNFTNGSPVWANRLNRVLNGAL-LFFENGIMYERTCQDV 295

Query: 308 STCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNW 367
             CN DQR FKSIF+RML LTSV+AP+T   I+  I+ SAEAAAKSC+GG DGHTCGL W
Sbjct: 296 DRCNNDQRFFKSIFTRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCNGGSDGHTCGLVW 355

Query: 368 GKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSS 419
              T DG  GLGEQ+ ALE+IQN LIH +  P     G  SKGD  AG+NSS
Sbjct: 356 RNYTWDGKAGLGEQLCALEIIQNTLIHTKRPPLTAKQGAKSKGDPAAGLNSS 407

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  503 bits (1296), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 238/451 (52%), Positives = 319/451 (70%), Gaps = 4/451 (0%)

Query: 8   EMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSP 67
           ++I ++C +LL  +    AM+LD     S+ +ATAL+  G++DYY G +YG  +GMF +P
Sbjct: 5   KLINVLCGSLL-LYSPTGAMDLDVDDLNSLKNATALVAYGLMDYYTGLQYGQTIGMFSNP 63

Query: 68  YYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIW 127
           YYWW AG A+G ML+ W+  ENDTY +++  ALL QTG ++DY+P NQ+  EGNDDQ  W
Sbjct: 64  YYWWEAGGAWGSMLDYWWYMENDTYNDIVKQALLYQTGDDHDYVPLNQSTTEGNDDQAFW 123

Query: 128 GITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187
           G+ VM A ERNF++P   +P WL + QAVFNTM  RWD++ CGGGLRWQIFTWNSGY+YK
Sbjct: 124 GLAVMAAAERNFSNPDPDQPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFTWNSGYDYK 183

Query: 188 NTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247
           N++SN  LF IAARL RYTGN +Y+D AE+VFDW+ DVG +   D A V DG  ID NCT
Sbjct: 184 NSVSNGALFHIAARLARYTGNQSYVDWAEKVFDWMRDVGLITEGDWAFVHDGVSIDDNCT 243

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
            +T  +WTYNHG+++ G AY+YN T G+  W     + L+ +  +F   SI++E+ACQ  
Sbjct: 244 SVTPYQWTYNHGLIMAGSAYLYNFT-GSEVWHNRTKEFLHSSSVFFKNGSILWEAACQAS 302

Query: 308 STCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNW 367
           +TCNTDQR+FK+ FSR LGLT+ + P +   I + I++SA+ AA+SC GGRDGHTCG+NW
Sbjct: 303 NTCNTDQRSFKAYFSRFLGLTAQLVPESRSQIMEWIRSSAKGAAESCSGGRDGHTCGINW 362

Query: 368 GKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNN 427
              + DG+YGLGEQM ALE+IQN+   DRPAPY  + GG+S+GD+ AG  +  TN+    
Sbjct: 363 FNGSWDGFYGLGEQMAALEIIQNVRCLDRPAPYTSTTGGSSQGDSAAGTETHPTNL--TP 420

Query: 428 LNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           L I  G RAGA IITA+I   ++  AVW++ 
Sbjct: 421 LTITAGSRAGAGIITAVIGISIVACAVWLVL 451

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  499 bits (1285), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 238/438 (54%), Positives = 311/438 (71%), Gaps = 4/438 (0%)

Query: 21  FRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGM 80
           FR   A++ D  ++ SI +ATAL+  G+LDYY G +YG  +GMF +PYYWW AG A+G +
Sbjct: 15  FRSSQALDFDVDNEGSIKNATALVAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSI 74

Query: 81  LENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFT 140
           L+ W+  +NDTY  +L +ALL Q G N+DYIP NQ+  EGNDDQ  WG+ VM A ERNFT
Sbjct: 75  LDFWWYTQNDTYNAMLEEALLYQAGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFT 134

Query: 141 DPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAA 200
           +P + +P WL + QAVFNTM  RWD E CGGGLRWQIFTWNSGY+YKNT+SN  LF +AA
Sbjct: 135 NPPETEPQWLYLAQAVFNTMALRWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAA 194

Query: 201 RLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGI 260
           RL RYTGN TY+D AE+VFDW+  +G +  ND + V+DGA++D NC+ ITK+ WTYN G+
Sbjct: 195 RLARYTGNNTYVDWAEKVFDWMKGIGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGL 254

Query: 261 VLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRTFKSI 320
           ++ G AY+YN T G+  W T   + LN +   FF +SI+YE  CQ+ +TCNTDQR+FK+ 
Sbjct: 255 LMSGCAYLYNYT-GSETWHTRTFEFLN-SSDIFFNNSILYERTCQEANTCNTDQRSFKAY 312

Query: 321 FSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGE 380
           FSR LGLT+ + P   + I D I+ SA+ AA+SC GG DGHTCGLNW     DG +GLGE
Sbjct: 313 FSRFLGLTAQLVPAARNQIMDWIRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGE 372

Query: 381 QMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAI 440
           QM ALE++QN+L  DRPAPY  + GG+S G+  AG  +S TN+  + L+I  G RA A I
Sbjct: 373 QMAALEIMQNVLCLDRPAPYTAATGGSSVGNGAAGTETSATNL--SPLDITTGSRAAAGI 430

Query: 441 ITAIILSVLIGGAVWMLF 458
           ITA+I   ++   VW++ 
Sbjct: 431 ITAVIGLSIVACTVWLVL 448

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  489 bits (1258), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 238/453 (52%), Positives = 307/453 (67%), Gaps = 6/453 (1%)

Query: 7   MEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQS 66
           M +  L+   +  F  +   ++LD     S+ +AT+L+  G++DYY G +YG  +GMF S
Sbjct: 1   MRVFKLVLSLVTLFSSVSFGLDLDVNDLNSLKNATSLVAYGLMDYYTGLQYGKTIGMFAS 60

Query: 67  PYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           P YWW AG A+G +L+ WF  ENDTY ++L  ALL QTG N+DY+P NQT+ EGNDDQ  
Sbjct: 61  PSYWWQAGGAWGSILDYWFYMENDTYNDILTQALLYQTGDNHDYMPLNQTVTEGNDDQAF 120

Query: 127 WGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           WG  VM A ERN+ +P D +P WL + QAVFNTM SRWD + CGGGLRWQIFTWNSGY+Y
Sbjct: 121 WGFAVMAAAERNYPNPPDDEPQWLYLAQAVFNTMSSRWDMDSCGGGLRWQIFTWNSGYDY 180

Query: 187 KNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTAN--VFDGAEIDT 244
           KN++SNA LF ++ARL RYTGN++Y + AE+++DW+ D+  +V  +     V+DGA I+ 
Sbjct: 181 KNSVSNAALFHLSARLARYTGNSSYTEWAEKIYDWMQDIQLLVDEEPTQYYVYDGASIEE 240

Query: 245 NCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESAC 304
           NCTD  K +WTYN G++L G AY+YN T  +  W       LN +   FF +SIMYE+AC
Sbjct: 241 NCTDTVKYQWTYNQGLMLSGSAYLYNFTE-SETWHERTKNFLN-SSGIFFNNSIMYEAAC 298

Query: 305 QDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCG 364
           Q    CN DQR+FK+ FSR LGLT+ + P T DT+  L++ SA+ AA SC GG DGHTCG
Sbjct: 299 QGSGYCNNDQRSFKAYFSRFLGLTAQLVPETRDTVLALLQASAQGAADSCSGGTDGHTCG 358

Query: 365 LNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVL 424
           LNW     DG YGLGEQM ALEV+QNL   DRPAPY   +GGTS G+  AG   S TN+ 
Sbjct: 359 LNWFYGGWDGKYGLGEQMAALEVMQNLRCLDRPAPYTADDGGTSAGNPAAGTEQSPTNLA 418

Query: 425 QNNLNIKNGDRAGAAIITAIILSVLIGGAVWML 457
              L I  GD+AGA IITA+I   +IG  VW++
Sbjct: 419 P--LTIGKGDQAGAGIITAVIGITIIGSVVWLI 449

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  483 bits (1242), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 236/437 (54%), Positives = 301/437 (68%), Gaps = 4/437 (0%)

Query: 22  RICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGML 81
           R  +A+ELD  +  S+ +AT+LI  G++DYY G +YG  VGMF  PYYWW AG A+G ML
Sbjct: 17  RFTNAVELDLDNYESLQNATSLIAYGLMDYYTGNQYGKTVGMFSDPYYWWEAGGAWGCML 76

Query: 82  ENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTD 141
           + WF  +NDTY + +  A++ Q G + DYIP NQ+  EGNDDQ  WGI  M A ERNFT+
Sbjct: 77  DYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTN 136

Query: 142 PSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAAR 201
           P + +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKNT+SN  LF IAAR
Sbjct: 137 PPENEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALFHIAAR 196

Query: 202 LGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIV 261
           L RYTGN TY+D AE+V++W+V V  +       V+DG  ID NCT +T  +WTYN G++
Sbjct: 197 LARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTYNQGLL 256

Query: 262 LGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRTFKSIF 321
           L G AY+YN T G+  W T   + LN A   FF D I+YE+ACQ  ++CNTDQR+FK+ F
Sbjct: 257 LAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQGPNSCNTDQRSFKAYF 314

Query: 322 SRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQ 381
           +R LG+T+ + P T + I   + TSA AAAKSC GG DGHTCGLNW   T DG YGLGEQ
Sbjct: 315 ARFLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMYGLGEQ 374

Query: 382 MNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAII 441
           M+ALEV+ N    D+PAPY   NGG+S GD  AG  +  TN+    LNI  G +AGA II
Sbjct: 375 MSALEVMVNTRALDKPAPYTAENGGSSVGDGAAGTQAQPTNLAP--LNITKGSKAGAGII 432

Query: 442 TAIILSVLIGGAVWMLF 458
           TA+I   ++  A+W++F
Sbjct: 433 TAVIGISIVACALWLVF 449

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  482 bits (1240), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 240/453 (52%), Positives = 307/453 (67%), Gaps = 5/453 (1%)

Query: 7   MEMIPLICF-TLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQ 65
           M M  +I F ++L   R  +A+ELD  +  S+ +AT+L+  G++DYY G +YG  +GMF 
Sbjct: 1   MLMNKVIGFLSVLFATRFTNAVELDLDNYESLQNATSLVAYGLMDYYTGNQYGKTIGMFS 60

Query: 66  SPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQG 125
            PYYWW AG A+G ML+ WF  +NDTY + +  A++ Q G + DYIP NQ+  EGNDDQ 
Sbjct: 61  DPYYWWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQA 120

Query: 126 IWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185
            WGI  M A ERNFT+P +  P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+
Sbjct: 121 FWGIAAMTAAERNFTNPPEDDPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYD 180

Query: 186 YKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTN 245
           YKNT+SN  LF IAARL RYTGN TY+D AE+V++W+V V  +       V+DG  ID N
Sbjct: 181 YKNTVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVDLISNGTYKYVYDGVSIDDN 240

Query: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQ 305
           CT +T  +WTYN G++L G AY+YN T G+  W T   + LN A   FF D I+YE+ACQ
Sbjct: 241 CTKVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQ 298

Query: 306 DYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGL 365
             ++CNTDQR+FK+ F+R LG+T+ + P T   I   + TSA AAAKSC GG DGHTCGL
Sbjct: 299 GPNSCNTDQRSFKAYFARFLGVTAQLVPETRHQIMSWLNTSAIAAAKSCSGGTDGHTCGL 358

Query: 366 NWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQ 425
           NW   T DG YGLGEQM+ALEV+ N    DRPAPY   NGG+S GD  AG  +  TN+  
Sbjct: 359 NWFNGTWDGMYGLGEQMSALEVLVNTRALDRPAPYTAENGGSSVGDGAAGTQARPTNLAP 418

Query: 426 NNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
             LNI  G +AGA IITA+I   ++  A+W++F
Sbjct: 419 --LNITKGSKAGAGIITAVIGISIVACALWLVF 449

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  482 bits (1240), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 238/442 (53%), Positives = 301/442 (68%), Gaps = 4/442 (0%)

Query: 17  LLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEA 76
           L +  R  +A+ELD  +  S+ +AT+LI  G++DYY G +YG  VGMF  PYYWW AG A
Sbjct: 13  LFATTRFTNAVELDLDNYQSLQNATSLIAYGLMDYYTGDQYGKTVGMFSDPYYWWEAGGA 72

Query: 77  FGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVE 136
           +G ML+ WF  ENDTY + +  A++ Q G + DYIP NQ+  EGNDDQ  WGI  M A E
Sbjct: 73  WGCMLDYWFFMENDTYNDEITAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIAAMTAAE 132

Query: 137 RNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLF 196
           RNFT+P   +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKNT+SN  LF
Sbjct: 133 RNFTNPPSDEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNTVSNGALF 192

Query: 197 QIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTY 256
            IAARL RYTGN TY+D AE+V++W+V V  +       V+DG  ID NCT +T  +WTY
Sbjct: 193 HIAARLARYTGNETYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKVTSYQWTY 252

Query: 257 NHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRT 316
           N G++L G AY+YN T G+  W T   + LN A   FF D I+YE+ACQ  ++CNTDQR+
Sbjct: 253 NQGLLLAGSAYLYNFT-GSDLWHTRTKEFLN-ASQVFFHDGIVYEAACQGPNSCNTDQRS 310

Query: 317 FKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYY 376
           FK+ F+R LG+T+ + P T   I   + TSA AAAKSC GG DGHTCGLNW   T DG Y
Sbjct: 311 FKAYFARFLGVTAQLVPETRSQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFNGTWDGMY 370

Query: 377 GLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRA 436
           GLGEQM ALEV+ N    DRP+PY   NGG+S GD  AG  +  TN+  + LNI  G +A
Sbjct: 371 GLGEQMAALEVMVNTRALDRPSPYTADNGGSSVGDGAAGTQAQPTNL--SPLNITKGSKA 428

Query: 437 GAAIITAIILSVLIGGAVWMLF 458
           GA IITA+I   ++  A+W++F
Sbjct: 429 GAGIITAVIGISIVACALWLVF 450

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  481 bits (1238), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 238/451 (52%), Positives = 308/451 (68%), Gaps = 6/451 (1%)

Query: 10  IPLIC-FTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPY 68
           I L C FTLL   R    + LD  +  SI +ATAL+  G+LDYY G +YG  +GMF  PY
Sbjct: 3   ISLTCVFTLLVTLRGSLGIYLDVNNTESIKNATALVAGGLLDYYTGLQYGETIGMFSDPY 62

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AG A+G +L+ W   +NDTY ++L  ALL Q+G N+DYIP NQ+  EGNDDQ  WG
Sbjct: 63  YWWEAGGAWGSILDYWHYTQNDTYNKILEQALLYQSGENHDYIPLNQSTTEGNDDQAFWG 122

Query: 129 ITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           + VM A ERNFT+P   +P WL + QAVFNTM  RWD + CGGGLRWQIFTWNSGY+YKN
Sbjct: 123 LVVMAAAERNFTNPPPDQPQWLYLAQAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDYKN 182

Query: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           T+SN  LF +AARL RYTGN TY++ AE+VFDW+  +  +   +   V+DGA++D NCT 
Sbjct: 183 TVSNGALFHLAARLARYTGNDTYVEWAEKVFDWMKGIKLLTEENENFVYDGAKVDDNCTV 242

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYS 308
           ITK+ WTYN G+++ G AY+YN T G  +W T   + LN +   FF +S++YE ACQ  +
Sbjct: 243 ITKLIWTYNQGLLMSGSAYLYNYT-GAEKWHTRTFEFLN-SSHIFFNNSVLYERACQGVT 300

Query: 309 -TCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNW 367
            +CNTDQR+FK+ FSR +GLT+ + P +   I   I+ SA  AA+SC GGRDGHTCGLNW
Sbjct: 301 VSCNTDQRSFKAYFSRFMGLTAQLVPESRSKIMAWIQASALGAAQSCSGGRDGHTCGLNW 360

Query: 368 GKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNN 427
                DG +GLGEQM+ALE++QNLL  DRPAPY    GG+S G+  AG  +S TN+  + 
Sbjct: 361 FYDGWDGKWGLGEQMSALEIMQNLLCLDRPAPYTAETGGSSVGNGAAGTETSATNL--SP 418

Query: 428 LNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           L I  G RA A IITA+I   ++   +W++ 
Sbjct: 419 LAITAGSRAAAGIITAVIGLSIVACTIWLVL 449

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  479 bits (1234), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 237/452 (52%), Positives = 306/452 (67%), Gaps = 5/452 (1%)

Query: 7   MEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQS 66
           M+ +  I F LL+F    +A+ LD  +  S+ + TAL+  G++DYY G +YG  VGMF +
Sbjct: 1   MKRVFNILF-LLTFTHRANALSLDLNNYQSLENDTALVAYGLMDYYNGDQYGQTVGMFSN 59

Query: 67  PYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AG A+G ML+ WF  ENDTY +L+  ALL QTG N DYIP NQ+  EGNDDQ  
Sbjct: 60  PYYWWEAGGAWGTMLDYWFFMENDTYNDLIMSALLHQTGENNDYIPLNQSTTEGNDDQAF 119

Query: 127 WGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           WGI  M A ERNFT+P +  P WL + QAVFNTM  RWD+++CGGGLRWQIF WNSGY+Y
Sbjct: 120 WGIAAMTAAERNFTNPPESSPQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYDY 179

Query: 187 KNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNC 246
           KN++SN  LF +AARL RYTGN +Y+D AE+ +DW+ DVG +       V+DG  I+TNC
Sbjct: 180 KNSVSNGALFHLAARLARYTGNQSYVDWAEKTYDWMSDVGLISNGTQKYVYDGTSIETNC 239

Query: 247 TDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQD 306
           T IT  +W+YN G++L G AY+YN T G++ W      +L+ A S FF +SIMYE ACQ 
Sbjct: 240 TTITSYQWSYNQGLMLAGAAYLYNFT-GSTIWLNRTMDLLD-ATSVFFNNSIMYEVACQP 297

Query: 307 YSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLN 366
             TCN DQR+FKS  +R LGLT+ +   T   I + + TSA A A SC GG DGHTCGLN
Sbjct: 298 TGTCNNDQRSFKSYLARFLGLTAQLVTITQSRIMNWLNTSAIAVAHSCSGGTDGHTCGLN 357

Query: 367 WGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQN 426
           W     DGYYGLGEQM+AL+V+ N  + DRPAPY  +NGG+S GD  AG  ++ TN+   
Sbjct: 358 WFDNGWDGYYGLGEQMSALDVLVNTRVLDRPAPYNSTNGGSSIGDGAAGTEATPTNLAP- 416

Query: 427 NLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
            L+I  G + GAA ITA I   ++  ++W++ 
Sbjct: 417 -LHITKGSKVGAAFITAAIGLSIVFTSIWIIL 447

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  479 bits (1233), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 236/442 (53%), Positives = 305/442 (69%), Gaps = 5/442 (1%)

Query: 17  LLSFFR-ICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGE 75
           +LS +  +  A+ LD  +  S+ +ATAL+  G++DYY G +YG  +GMF  PYYWW AG 
Sbjct: 14  ILSLYSSLTSAVYLDLDNYESLQNATALVAYGLMDYYTGLQYGKTIGMFSDPYYWWEAGG 73

Query: 76  AFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAV 135
           A+G ML+ WF  ENDTY +++  ALL Q G+  DY+P NQ+  EGNDDQ  WGI  M A 
Sbjct: 74  AWGCMLDYWFFMENDTYNDIIKQALLYQVGTANDYVPLNQSTTEGNDDQAFWGIAAMMAA 133

Query: 136 ERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACL 195
           ERNFT+P++ +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+YKN++SN  L
Sbjct: 134 ERNFTNPAEDEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYKNSVSNGAL 193

Query: 196 FQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWT 255
           F IAARL RYTGN +Y + AE+V+DW+VDV  +  +    V+DG + + NCT ITK +WT
Sbjct: 194 FHIAARLARYTGNDSYAEWAEKVYDWMVDVDLITQDQYYFVYDGVDSNDNCTTITKYQWT 253

Query: 256 YNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQR 315
           YN G++L G AY+YN T G+  W T     L+ + S FF D+I+YE+ACQ+  TCNTDQR
Sbjct: 254 YNQGLILSGCAYLYNYT-GSELWHTRTKNFLS-SSSVFFNDTILYEAACQNQETCNTDQR 311

Query: 316 TFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGY 375
           +FK+ FSR LG+T+ + P T D I   I  SA  AA+SC GG DGHTCG+NW     DG 
Sbjct: 312 SFKAYFSRFLGVTAQLVPETRDNIMKWIDASAYGAAESCSGGTDGHTCGINWFYGGWDGK 371

Query: 376 YGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDR 435
           YGLGEQM ALE++ N    DRPAPY  SNGG+S GD  AG  +S TN+  + LNI  G R
Sbjct: 372 YGLGEQMAALEILVNTRALDRPAPYTSSNGGSSTGDGAAGTETSATNL--SPLNITAGSR 429

Query: 436 AGAAIITAIILSVLIGGAVWML 457
           AGA IITA+I   ++  A W++
Sbjct: 430 AGAGIITAVIGISIVACACWLV 451

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  477 bits (1228), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 235/458 (51%), Positives = 310/458 (67%), Gaps = 9/458 (1%)

Query: 1   MILKSSMEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGA 60
           M+L   + ++ ++ FT     +  +A+ELD  +  S+ +AT+LI  G++DYY G +YG  
Sbjct: 1   MLLNKVIGLLSVLFFT-----KFSNAVELDLDNYESLENATSLIAYGLMDYYTGNQYGKT 55

Query: 61  VGMFQSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEG 120
           +GMF  PYYWW AG A+G ML+ WF  +NDTY + +  A++ Q+G + DYIP NQ+  EG
Sbjct: 56  IGMFSDPYYWWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMVHQSGDDNDYIPLNQSTTEG 115

Query: 121 NDDQGIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTW 180
           NDDQ  WGI  M A ERNFT+P   +P WL + QAVFNTM  RWD++ CGGGLRWQIF W
Sbjct: 116 NDDQAFWGIAAMTAAERNFTNPPADEPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVW 175

Query: 181 NSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGA 240
           NSGY+YKNT+SN  LF IAARL RYTGN TY+D AE+V++W+V V  +       V+DG 
Sbjct: 176 NSGYDYKNTVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGV 235

Query: 241 EIDTNCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMY 300
            I  NCT +T  +WTYN G++L G AY+YN T G+  W T   + LN ++  FF+D I+Y
Sbjct: 236 SIGDNCTKVTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFLNSSQ-VFFQDGIVY 293

Query: 301 ESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDG 360
           E+ACQ  ++CNTDQR+FK+ F+R LG+T+ + P T + I   + TSA AAAKSC GG DG
Sbjct: 294 EAACQGPNSCNTDQRSFKAYFARFLGVTAQLVPETRNQIMTWLNTSAIAAAKSCSGGTDG 353

Query: 361 HTCGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSST 420
           HTCGLNW   T DG YGLGEQM ALEV+ N    D+PAPY    GG+S GD  AG  +  
Sbjct: 354 HTCGLNWFNGTWDGMYGLGEQMAALEVMVNTRALDKPAPYTADEGGSSAGDGAAGTQAQP 413

Query: 421 TNVLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           TN+    LNI  G +AGA IITA+I   ++  A+W++F
Sbjct: 414 TNLAP--LNITKGSKAGAGIITAVIGISIVACALWLVF 449

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  476 bits (1225), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 236/448 (52%), Positives = 305/448 (68%), Gaps = 6/448 (1%)

Query: 12  LICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWW 71
           LI   L +F    +++ELD  S  S+ +ATAL+  G++DYY G +YG  VGMF  PYYWW
Sbjct: 6   LILLILSTFIGRVYSLELDLDSFESLQNATALVAYGLMDYYTGNQYGKTVGMFSDPYYWW 65

Query: 72  HAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITV 131
            AG A+G M++ W+  +N+TY + +  ALL QTG ++DYIP NQ+  EGNDDQ  WGI V
Sbjct: 66  EAGGAWGSMIDFWYYMDNNTYNDDIMAALLHQTGDDWDYIPLNQSTTEGNDDQAFWGIAV 125

Query: 132 MGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTIS 191
           M A ERNFT+P D +P WL + QAVFNTM  RWD   CGGGLRWQIFTWNSGY+YKNT+S
Sbjct: 126 MTAAERNFTNPPDDQPQWLYLAQAVFNTMALRWDDATCGGGLRWQIFTWNSGYDYKNTVS 185

Query: 192 NACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTAN-VFDGAEIDTNCTDIT 250
           N  LF +AARL RYTGNT+Y+D AE+V++W+ D  Y++ N T   V+DGA +  NCT +T
Sbjct: 186 NGALFHLAARLARYTGNTSYVDWAEKVYNWMEDT-YLISNGTQMFVYDGASVTDNCTTVT 244

Query: 251 KIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTC 310
           K +WTYN G++L G AY+YN T  +  W       LN A   FF +SIMYE+ACQ   TC
Sbjct: 245 KYQWTYNQGLLLSGSAYLYNFTE-SELWHERTKGFLN-ASVVFFNNSIMYEAACQGPQTC 302

Query: 311 NTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQ 370
           NTDQR+FK+ FSR LG T+ + P T DT+   + TSA AAA SC GG DGHTCG+NW   
Sbjct: 303 NTDQRSFKAYFSRFLGATAQLVPETRDTVMHWVNTSAVAAATSCSGGTDGHTCGINWFYG 362

Query: 371 TNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNI 430
             DGYYGLGEQM+ALE++ N     +P PY   NGG+S GD  AG  ++ TN+  + LN+
Sbjct: 363 GWDGYYGLGEQMSALEIMVNTRALHKPGPYTSENGGSSMGDGAAGTQATATNL--SPLNV 420

Query: 431 KNGDRAGAAIITAIILSVLIGGAVWMLF 458
             G +A A IITA+I   +    +W+++
Sbjct: 421 TPGSKAAAGIITAVIGISIFACVLWLIY 448

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  476 bits (1225), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 236/450 (52%), Positives = 302/450 (67%), Gaps = 4/450 (0%)

Query: 9   MIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPY 68
           ++ ++  T L       A+E+D     S+ +AT+L+  G++DYY G +YG  +GMF  PY
Sbjct: 7   LLSIVTTTTLLLSHSTKALEIDLDDIDSLRNATSLVAYGLMDYYTGNQYGKTIGMFSDPY 66

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AG A+G ML+ W+  +NDTY + +  ALL QTG N DY+P NQ+  EGNDDQ  WG
Sbjct: 67  YWWEAGGAWGSMLDYWYYMDNDTYNDEIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWG 126

Query: 129 ITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           I VM A ERNFT+P +  P WL + QAVFNTM  RWD + CGGGLRWQIF WNSGY+YKN
Sbjct: 127 IAVMTAAERNFTNPPEDSPQWLYLAQAVFNTMALRWDGDTCGGGLRWQIFVWNSGYDYKN 186

Query: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTD 248
           T+SN  LF +AARL RYTGN +Y+D AE+V+DW+ +VG V    +  V+DG  I  NC+ 
Sbjct: 187 TVSNGALFHMAARLARYTGNQSYVDWAEKVYDWMYEVGLVSNGSSMFVYDGVNIANNCST 246

Query: 249 ITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYS 308
           IT  +WTYNHG+V+ G AY+YN T   +E   + TK+L  A + FF +SIMYE+ACQ  +
Sbjct: 247 ITPYQWTYNHGLVMAGAAYLYNFTE--NEVWHNRTKMLVDASTVFFNNSIMYEAACQGPN 304

Query: 309 TCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWG 368
           +CNTDQR+FK+ FSR LG T+ + P T   I  LI  SA AA KSC GG DGHTCGLNW 
Sbjct: 305 SCNTDQRSFKAYFSRFLGATAQLVPETRSKILPLINASAIAAGKSCSGGTDGHTCGLNWF 364

Query: 369 KQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNL 428
               DG YGLGEQM ALEV+ N     +PAPY  +NGG+S GD  AG     TN+    L
Sbjct: 365 IGDWDGMYGLGEQMCALEVMVNTRCLHKPAPYTSTNGGSSVGDGAAGTEHHPTNLAP--L 422

Query: 429 NIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
           +I  G RAGA IITA+I   ++  A+W++F
Sbjct: 423 HITKGSRAGAGIITAVIGISILACALWLVF 452

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  468 bits (1204), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 237/448 (52%), Positives = 297/448 (66%), Gaps = 8/448 (1%)

Query: 15  FTLLSFFRI----CHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYW 70
           F LLS   I      A+ LD     S+ +AT+L+  G++DYY G +YG  VGMF  PYYW
Sbjct: 10  FLLLSLASILPSQVSALTLDLNDTESLQNATSLVAYGLMDYYTGNQYGKTVGMFSDPYYW 69

Query: 71  WHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGIT 130
           W AG A+G ML+ W+   NDTY + +  ALL QTG + DY+P NQ+  EGNDDQ  WGI 
Sbjct: 70  WQAGGAWGSMLDYWYYMNNDTYNDDIMAALLHQTGDDNDYVPLNQSTTEGNDDQAFWGIA 129

Query: 131 VMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTI 190
           VM A ERNFT+P + +P WL + QAVFNTM  RWDS+ CGGGLRWQIF WNSGY+YKNT+
Sbjct: 130 VMTAAERNFTNPPEDQPQWLYLAQAVFNTMAMRWDSDTCGGGLRWQIFIWNSGYDYKNTV 189

Query: 191 SNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDIT 250
           SN  LF IA+RL RYTGN +Y+D AE+V+DW+ DV  +       V+DG  I  NCT +T
Sbjct: 190 SNGALFHIASRLARYTGNQSYVDWAEKVYDWMYDVHLISNGSYMYVYDGVNIGDNCTTVT 249

Query: 251 KIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTC 310
             +WTYN G++L G AY+YN T G   W    TK L  A   FF +SI+YE+ACQ ++TC
Sbjct: 250 PYQWTYNQGLLLSGCAYLYNFT-GEELWHNR-TKNLLTAAGVFFNNSILYEAACQGHNTC 307

Query: 311 NTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQ 370
           NTDQR+FK+ FSR LG T+ + P T + I   I TSA AAA+SC GG DGHTCG+NW   
Sbjct: 308 NTDQRSFKAYFSRFLGTTAQLVPETRNQIMHWINTSAVAAAQSCSGGTDGHTCGINWFAD 367

Query: 371 TNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNI 430
             DG YGLGEQM ALE++ N     + APY  SNGG+S GD  AG     TN+    L+I
Sbjct: 368 GWDGMYGLGEQMAALEIMVNTKALSKAAPYTSSNGGSSVGDGAAGTEPHPTNLAP--LHI 425

Query: 431 KNGDRAGAAIITAIILSVLIGGAVWMLF 458
             G RAGA IITA+I   ++  A+W++F
Sbjct: 426 TKGSRAGAGIITAVIGISIVTCALWLVF 453

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  465 bits (1196), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 233/442 (52%), Positives = 305/442 (69%), Gaps = 10/442 (2%)

Query: 12  LICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWW 71
           +I  ++L+ F     + L+ TS  S+ +A +L+  G++DYY G +YG  +GMF +PYYWW
Sbjct: 8   IIQISILASFSTAVHLNLNVTS--SLQNAASLVAVGLMDYYNGDQYGQTIGMFSNPYYWW 65

Query: 72  HAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITV 131
            AG A+G M++ W+  +NDTY +++  ALL QTG   DYIP NQ+  EGNDDQ  WGITV
Sbjct: 66  EAGGAWGCMIDYWYFMQNDTYNDIISQALLYQTGDRNDYIPLNQSTTEGNDDQAFWGITV 125

Query: 132 MGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTIS 191
           M A ERNFT+P   KP WL + QAVFNTM  RWD   C GGLRWQIF WNSGY+YKN++S
Sbjct: 126 MSAAERNFTNPPPDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSVS 185

Query: 192 NACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDT--ANVFDGAEIDTNCTDI 249
           N  LF +AARL RYTGN +Y+D A +V+DW+   G ++ NDT    V+DGA I+TNCTDI
Sbjct: 186 NGALFHMAARLARYTGNQSYVDWAVKVYDWMEKTG-LISNDTYFKFVYDGASIETNCTDI 244

Query: 250 TKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYST 309
           T+ +WTYN G++L G AY+YN T   S+W T   + +NG+ + FF +SI+YE+ACQ    
Sbjct: 245 TQFQWTYNQGLILSGCAYLYNHTE-DSKWLTRTEQFVNGS-AVFFNNSIVYEAACQGSKR 302

Query: 310 CNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGK 369
           C+ DQR+F++ F+R LG+T+ + P T D I D I TSA AAA++C GG DGHTCGLNW  
Sbjct: 303 CDNDQRSFRAYFARFLGVTAQLVPTTKDIIMDWINTSAYAAAQACSGGTDGHTCGLNWFN 362

Query: 370 QTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLN 429
              DGYYGLGEQM ALE + N    D PAPY  SNGG+S G+  AG     TN+    L+
Sbjct: 363 IGWDGYYGLGEQMGALEFLVNTRALDMPAPYTSSNGGSSTGNGAAGTEKPPTNL--GPLH 420

Query: 430 IKNGDRAGAAIITAII-LSVLI 450
           I +G +AGA IIT +I LS+L+
Sbjct: 421 ITDGSKAGAGIITCVIGLSILL 442

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  464 bits (1194), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 230/453 (50%), Positives = 311/453 (68%), Gaps = 7/453 (1%)

Query: 9   MIPLI---CFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQ 65
           MIP I      L +      ++ELD     S+ +ATAL+  G++DYYEGT+YGG VGMF 
Sbjct: 1   MIPRIKTFALILSTLIWRSQSLELDLDDYQSLQNATALVAWGLMDYYEGTKYGGTVGMFS 60

Query: 66  SPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQG 125
           SPYYWW AG AFG +L+ W+  +NDTY + +  A++ Q G+++DYIP NQ+  EGNDDQ 
Sbjct: 61  SPYYWWEAGGAFGTLLDFWYFMDNDTYNDEILAAMVYQAGNDWDYIPLNQSTTEGNDDQA 120

Query: 126 IWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185
            WGI  M A ERNFT+P+  +P WL + QAVFNTM  RWD++ CGGGLRWQIFTWNSGY+
Sbjct: 121 FWGIAAMTAAERNFTNPASDEPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFTWNSGYD 180

Query: 186 YKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTN 245
           YKN++SN  LF +AARL RYTGN +Y+D AE+V++W+ D G++   +T  V+DGA  + N
Sbjct: 181 YKNSVSNGALFHLAARLARYTGNDSYVDWAEKVYNWMEDTGFITTGNTLYVYDGASTEDN 240

Query: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQ 305
           C+ +TK +WTYN G++L G AY+YN +  +  +  ++T +   +   F  +SIM E+ACQ
Sbjct: 241 CSSVTKYQWTYNQGLILSGAAYLYNYSESSLWYNRTMTAL--SSSGVFLNNSIMCEAACQ 298

Query: 306 DYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGL 365
              TC+TDQR+FK+ F+R LG+T+ + P T   I   +  SA A A+SC GG DGHTCGL
Sbjct: 299 PAGTCDTDQRSFKAYFARFLGVTAQLVPSTRTQIMTWMNASAYAVAESCSGGTDGHTCGL 358

Query: 366 NWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQ 425
           NW   + DGYYGLGEQM+ALEV+ N    D+P PY  +NGG+S+GD  AG  ++ TN+  
Sbjct: 359 NWFLGSWDGYYGLGEQMSALEVLVNTRALDKPGPYNSTNGGSSQGDGAAGTETTATNLAP 418

Query: 426 NNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
             LNI  G +A AAIITA+I   LI   +W++F
Sbjct: 419 --LNITGGSKAAAAIITAVIGISLIACTLWIIF 449

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  461 bits (1187), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 228/451 (50%), Positives = 305/451 (67%), Gaps = 5/451 (1%)

Query: 7   MEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQS 66
           M +I L+ FT+ SF     A++L+  S  S+ +AT+L+  G++DYY G +YG  VGMF  
Sbjct: 1   MNIIYLL-FTVSSFSFPIAAVDLNLNSLQSLQNATSLVAYGLMDYYTGDQYGQTVGMFSD 59

Query: 67  PYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126
           PYYWW AG A+G ML+ W+  +NDTY +++  ALL Q G++ +YIP NQ+  EGNDDQ  
Sbjct: 60  PYYWWEAGGAWGTMLDYWYFMQNDTYNDIITAALLHQVGTDNNYIPLNQSTTEGNDDQAF 119

Query: 127 WGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNY 186
           WGITVM A ERNFT+P + +P WL + QAVFNTM  RWD++ CGGGLRWQIF WNSGY+Y
Sbjct: 120 WGITVMTAAERNFTNPPEDQPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDY 179

Query: 187 KNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNC 246
           KN++SN  LF +AARL RYTGN +Y+D AE+V+DW+ DVG +       V+DGA    NC
Sbjct: 180 KNSVSNGALFHMAARLARYTGNQSYVDWAERVYDWMSDVGLISNGSYKFVYDGASTTDNC 239

Query: 247 TDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQD 306
           T +T  +WTYN G++L G AY+YN T G+  W     ++LN A S FF +SI+YE+ACQ 
Sbjct: 240 TVLTTYQWTYNQGLLLSGAAYLYNYT-GSDTWLLRTNQLLN-ASSVFFNNSILYEAACQK 297

Query: 307 YSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLN 366
             TCN DQR+FK+ F R LG T+ +   T  TI   +  SA AAA+SC GG DGHTCGLN
Sbjct: 298 SGTCNNDQRSFKAYFLRFLGQTAQLVSETQPTIMKWLNASAYAAAQSCSGGTDGHTCGLN 357

Query: 367 WGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQN 426
           W     DG YGLGEQM+ALE + N  +   P PY  ++GG+S G++ AG     TN+   
Sbjct: 358 WFSGGWDGMYGLGEQMSALEALVNTRVLHLPGPYNSTDGGSSIGNSAAGTEQEATNLAP- 416

Query: 427 NLNIKNGDRAGAAIITAIILSVLIGGAVWML 457
            L+I +G +A AAIIT+++   ++   VW++
Sbjct: 417 -LHITDGSKAAAAIITSVVGISIVAAGVWLI 446

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  457 bits (1177), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 227/450 (50%), Positives = 303/450 (67%), Gaps = 12/450 (2%)

Query: 12  LICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWW 71
           L   +LL  F   +A+++D    +S+ +AT+LI  GM+DYY G  YG  +GMF  PYYWW
Sbjct: 8   LFQISLLPLF--TNALKIDLDDFSSLQNATSLIAYGMMDYYNGHDYGQVIGMFAKPYYWW 65

Query: 72  HAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITV 131
            AG A+G +L+ W+  +NDTY +L+ +ALL QTG   DY+P NQ+  EGNDDQ  WGI  
Sbjct: 66  EAGGAWGCLLDYWYYMQNDTYNDLITEALLYQTGDRNDYVPLNQSTTEGNDDQAFWGIAA 125

Query: 132 MGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTIS 191
           + A ERNFT+P   KP WL + QAVFNTM  RWD   C GGLRWQIF WNSGY+YKN++S
Sbjct: 126 ITAAERNFTNPPPDKPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSVS 185

Query: 192 NACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTAN----VFDGAEIDTNCT 247
           N  LF IAARL RYTGN +Y++ A++++DW+   G  +++D       V+DGA I+TNCT
Sbjct: 186 NGALFHIAARLARYTGNQSYVEWADKIYDWMFGTG--IISDEYETYKFVYDGANIETNCT 243

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
           DIT+ +WTYN G+VL G AY+YN T    +W     + LNG+   FF+D+++YE+ACQ  
Sbjct: 244 DITRYQWTYNQGLVLAGCAYLYNHTQ-DEKWLIRTEQFLNGSVV-FFRDNVIYEAACQPN 301

Query: 308 STCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNW 367
             CN DQR+FK+ F+R LG+T+ + P T DTI   I TSA AAA++C GG DGHTCG++W
Sbjct: 302 KNCNNDQRSFKAYFARFLGVTAQLIPSTRDTIMRWINTSAYAAAQACSGGTDGHTCGMDW 361

Query: 368 GKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNN 427
             +  DGYYGLGEQM ALE + N    D P PY   NGG+S G   AG     TN+  + 
Sbjct: 362 VWKGWDGYYGLGEQMAALEFMVNTRALDMPPPYTSFNGGSSTGSGAAGTERDPTNL--SP 419

Query: 428 LNIKNGDRAGAAIITAIILSVLIGGAVWML 457
           L+I  G +AGA+IIT I+   ++ GA+W++
Sbjct: 420 LHITAGSKAGASIITCIVSISILTGAMWLV 449

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  451 bits (1161), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 240/454 (52%), Positives = 301/454 (66%), Gaps = 10/454 (2%)

Query: 7   MEMIPLIC--FTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMF 64
           M ++ L+    +L+S F     +ELD     S+ +ATAL+  G++DYY G +YG  VGMF
Sbjct: 1   MRLVTLLSGLVSLVSVF----GLELDLDDYASLQNATALVAYGLMDYYTGDQYGKTVGMF 56

Query: 65  QSPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQ 124
             PYYWW AG A+G ML+ W+  +NDTY + +  ALL QTG N DY+P NQ+  EGNDDQ
Sbjct: 57  SDPYYWWQAGGAWGCMLDYWYFMQNDTYNDKIMAALLHQTGDNNDYVPLNQSTTEGNDDQ 116

Query: 125 GIWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGY 184
             WGI VM A ER F +P D KP WL + QAVFNTM  RWDSE CGGGLRWQIF WNSGY
Sbjct: 117 AFWGIAVMQAAERKFPNPPDDKPQWLYLTQAVFNTMALRWDSETCGGGLRWQIFVWNSGY 176

Query: 185 NYKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDT 244
           +YKNT+SN  LF IAARL RYTGN +Y+D AE+V+DW+ DV  +       V+DG  I+ 
Sbjct: 177 DYKNTVSNGALFHIAARLARYTGNQSYVDWAERVYDWMEDVHLIDNGTYRYVYDGVSIND 236

Query: 245 NCTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESAC 304
           NCT +TK +WTYN G++L G AY++N T G+  W       LN ++  FF +SI+YE+AC
Sbjct: 237 NCTTVTKYQWTYNQGLMLSGSAYLFNMT-GSDLWHERTHAFLNASRV-FFNNSILYEAAC 294

Query: 305 QDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCG 364
           Q  +TCNTDQR+FK+ F+R LG T+ + P T   I   + TSA AAAKSC GG DGHTCG
Sbjct: 295 QGPNTCNTDQRSFKAYFARFLGSTAELVPETRQQIMTWLNTSALAAAKSCSGGTDGHTCG 354

Query: 365 LNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVL 424
           LNW +   DG YGLGEQM ALEV+ N     R  PY  +NGG S GD  AG     TN+ 
Sbjct: 355 LNWFRDDWDGMYGLGEQMAALEVMVNTQALKRAPPYNATNGGNSTGDGAAGTKPHPTNLA 414

Query: 425 QNNLNIKNGDRAGAAIITAIILSVLIGGAVWMLF 458
              L+I  G RAGA IITAII   +I  A+W+++
Sbjct: 415 P--LHITGGSRAGAGIITAIIGISIIACALWLVY 446

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  448 bits (1152), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 218/442 (49%), Positives = 294/442 (66%), Gaps = 4/442 (0%)

Query: 17  LLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEA 76
           L S F   +A+ +D  +  SI +A++L+  G++DYY G +YG  +GMF  PYYWW AG A
Sbjct: 10  LASTFACANAVWIDLNNTESIHNASSLVAVGLMDYYTGLQYGETIGMFSDPYYWWEAGGA 69

Query: 77  FGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVE 136
           +G ML+ W+  +NDTY +++  ALL Q G++ DY+P NQ+  EGNDDQ  WGI  M A E
Sbjct: 70  WGCMLDYWWYMQNDTYNDIIMQALLYQVGTHNDYVPLNQSTTEGNDDQAFWGIAAMTAAE 129

Query: 137 RNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLF 196
           RNFT+P   +P WL + QAVFNTM  RWD+  C GGLRWQIF WN+GY+YKNT+SN  LF
Sbjct: 130 RNFTNPPSDQPQWLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGYDYKNTVSNGALF 189

Query: 197 QIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCTDITKIEWTY 256
            +AARL RYTGN +Y+D A++V+DW+  VG +   ++  V+DG  I  NC +IT  +W+Y
Sbjct: 190 NLAARLARYTGNQSYVDWADKVYDWMYGVGLISNGNSRFVYDGVNIAHNCANITGYQWSY 249

Query: 257 NHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRT 316
           NHG++L G AY+YN T    +W     + LN A S F+ +S++YE ACQ  + CNTDQR+
Sbjct: 250 NHGLMLSGCAYLYNMTK-DEKWGNRTFEYLNSA-SIFYNNSVLYEVACQTVNKCNTDQRS 307

Query: 317 FKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYY 376
           FK+ F+R LG+T+ + P   D     I  SA  AA+SC GG DGHTCG+NW     DG Y
Sbjct: 308 FKAYFTRFLGVTAELIPQARDQAMKWINASALGAAQSCSGGYDGHTCGINWFYDGWDGMY 367

Query: 377 GLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRA 436
           GLGEQM+ALE + N    +RP PY  +NGG+S GD  AG   S TN+  + L+I  G RA
Sbjct: 368 GLGEQMSALEALVNTQALNRPPPYNSTNGGSSTGDGAAGTEESPTNL--SPLDITAGSRA 425

Query: 437 GAAIITAIILSVLIGGAVWMLF 458
           GA IIT +I   ++  A+W++ 
Sbjct: 426 GAGIITCVIGISILSCALWLIL 447

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  442 bits (1137), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 220/434 (50%), Positives = 285/434 (65%), Gaps = 6/434 (1%)

Query: 27  MELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWFL 86
           + LD     SI +AT+L+  G++DYY G  YG  VG F  PYYWW AG A+G +L+ W+ 
Sbjct: 22  LNLDVDDLQSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYY 81

Query: 87  CENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPSDGK 146
            EN TY +LL D+LL Q G +  Y P N+T  EGNDDQ  WG+ VM A ER   +P   +
Sbjct: 82  MENSTYNDLLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPPADQ 141

Query: 147 PGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYT 206
           P  LA+ QAVFNTM  RWD E C GGLRWQIF WN GY+YKN++SN  LF +AARL RYT
Sbjct: 142 PQRLALAQAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRYT 201

Query: 207 GNTTYLDVAEQVFDWLVDVGY--VVLNDTANVFDGAEIDTNCTDITKIEWTYNHGIVLGG 264
           GN TYL+ AE+V+DW+  VG   +V  +   V+DG +I+ NCT++ K++WTYNHG+++ G
Sbjct: 202 GNATYLEWAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMAG 261

Query: 265 LAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRTFKSIFSRM 324
            A++YN T     W     + L+ A+  F  +  +YE+ CQ    CN DQR+FK+ FSR 
Sbjct: 262 CAFIYNHTQ-DELWHQRTLRFLDSAR-IFLSNDTLYEAGCQGGDNCNIDQRSFKAYFSRF 319

Query: 325 LGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQMNA 384
           LGLT+ + P + +TI   I+ SA+ AA SC GGRDGHTCGLNW     DG +GLGEQM A
Sbjct: 320 LGLTAQLVPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQMAA 379

Query: 385 LEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAIITAI 444
           LE+IQNL   +RPAPY   NGGTS GD  AG  +   N+    L+IK GDRAGA IITA+
Sbjct: 380 LEIIQNLRCLERPAPYTAMNGGTSPGDPAAGTKTKAENLPP--LDIKAGDRAGAGIITAL 437

Query: 445 ILSVLIGGAVWMLF 458
           I S  +   +W++ 
Sbjct: 438 IGSSFLACTLWLII 451

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  440 bits (1132), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 218/428 (50%), Positives = 285/428 (66%), Gaps = 8/428 (1%)

Query: 9   MIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPY 68
           +I L+C     +FR  HA+ELD  +  S+ +AT+L+  G++DYY G +YG  +GMF +PY
Sbjct: 7   LISLLCTV---WFRAGHAVELDLNNLDSLRNATSLVAYGLMDYYNGLQYGQTIGMFSNPY 63

Query: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWG 128
           YWW AG A+G M++ W+  +NDTY +++  AL  QTG N DY+P NQ+  EGNDDQ  WG
Sbjct: 64  YWWEAGGAWGTMIDYWYYMQNDTYNDIIMQALQYQTGVNNDYVPLNQSTTEGNDDQAFWG 123

Query: 129 ITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKN 188
           I VM A ERNFT+P   +P WL + QAVFNTM  RWD + C GGLRWQIF WNSGY+YKN
Sbjct: 124 IAVMSAAERNFTNPPADRPQWLYLAQAVFNTMALRWDDQTCNGGLRWQIFVWNSGYDYKN 183

Query: 189 TISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDT-ANVFDGAEIDTNCT 247
           ++SN  LF I ARL R+TGN +Y++ AE+V+DW+  V  +  +   A V+DG  I  NCT
Sbjct: 184 SVSNGALFHIGARLARFTGNDSYVEWAEKVYDWMESVNLIEDDGKGAFVYDGVNIGDNCT 243

Query: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDY 307
            +T ++WTYNHG++L G AY+YN T G ++W     + L  A   FF  ++M+E+ACQ  
Sbjct: 244 KVTNLQWTYNHGLILSGCAYLYNYT-GDAKWYNRTERFLEYAYV-FFNRTVMFEAACQGV 301

Query: 308 STCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNW 367
            TC TDQRTFK+ FSR LG+T+ + P T  TI   +  SA  AA+SC GG DGHTCG+NW
Sbjct: 302 HTCTTDQRTFKAYFSRFLGMTAQLVPDTQHTIMTYMNASAYGAAQSCSGGYDGHTCGINW 361

Query: 368 GKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNN 427
                DGYYGLGEQM ALEV+ N      P PY  +NGG+S GD  AG     TN+  + 
Sbjct: 362 FYGGWDGYYGLGEQMCALEVMINTRALHVPGPYNSTNGGSSTGDGAAGTEQHPTNL--SP 419

Query: 428 LNIKNGDR 435
           LNI +G R
Sbjct: 420 LNITSGSR 427

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  438 bits (1126), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 218/435 (50%), Positives = 291/435 (66%), Gaps = 9/435 (2%)

Query: 26  AMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLENWF 85
           A+ELD    +S+  AT+LI  G+LDYY G   G  +GMF SPYYWW AG A+G +++ WF
Sbjct: 21  ALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFSSPYYWWEAGAAWGALIDYWF 80

Query: 86  LCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPSDG 145
             ENDTY +++  ALL Q G   DY+P NQ+  EGNDDQ  WGI VM A E+ F +P   
Sbjct: 81  YMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQAFWGIAVMSAAEKGFPNPDPD 140

Query: 146 KPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRY 205
           +P WLA+ QAVFNTM  RWDS  C GGLRWQIFTWN+GY+YKN++SN  LF +AARL RY
Sbjct: 141 QPQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYDYKNSVSNGALFHLAARLARY 200

Query: 206 TGNTTYLDVAEQVFDWLVDVGYVVLNDTAN---VFDGAEIDTNCTDITKIEWTYNHGIVL 262
           TGN +Y D AE+V+DW+  V   ++N T +   V+DGA I  NC+  + ++W+YNHG++L
Sbjct: 201 TGNQSYADWAEKVYDWMASV--QLINQTGDWTFVYDGAFIHDNCSRPSVLQWSYNHGLIL 258

Query: 263 GGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRTFKSIFS 322
           GG AY+ + T G+  W     ++L  A S FF + ++ E ACQ+  TCNTDQR+FK+ F 
Sbjct: 259 GGCAYLTDFT-GSDVWHNRTLRLLRSA-SIFFPNGVVTEVACQEAGTCNTDQRSFKAYFM 316

Query: 323 RMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQM 382
           R LGLT+ + P + +     I+ SA+ AA SC GGRDGHTCG+N+ + + D  YGLGEQ+
Sbjct: 317 RFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHTCGMNYSRGSYDESYGLGEQL 376

Query: 383 NALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAIIT 442
            ALE IQNL   ++ +P   S GGTS G+  AG N +   +  + L+I N DRAGA IIT
Sbjct: 377 AALETIQNLRCLEKGSPLTASEGGTSIGNPGAGGNRNLGTL--SPLDISNADRAGAGIIT 434

Query: 443 AIILSVLIGGAVWML 457
           A++   LI   VW++
Sbjct: 435 ALVGFSLISCIVWLV 449

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  437 bits (1124), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 223/436 (51%), Positives = 293/436 (67%), Gaps = 5/436 (1%)

Query: 23  ICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLE 82
           I +A+ L+    +S+ +A AL+  G++DYY G +YG  +GMF  PYYWW AG A+G ML+
Sbjct: 17  ITNAVSLNLNDSSSLDNAAALVAYGLMDYYNGNQYGQTIGMFSDPYYWWEAGGAWGCMLD 76

Query: 83  NWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDP 142
            W+  +NDTY +++Y+AL  QTG + DYIP NQ+  EGNDDQ  WGI  + A ERNFT+P
Sbjct: 77  YWYYMQNDTYNDVIYEALQYQTGDDNDYIPLNQSTTEGNDDQAFWGIAAITAAERNFTNP 136

Query: 143 SDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARL 202
              KP WL + QAVFNTM  RWDS+ C GGLRWQIF WNSGY+YKN++SN  LF IAARL
Sbjct: 137 PPDKPQWLYLAQAVFNTMALRWDSDTCNGGLRWQIFVWNSGYSYKNSVSNGALFHIAARL 196

Query: 203 GRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTAN-VFDGAEIDTNCTDITKIEWTYNHGIV 261
            RYTGN +Y+D +E+V+DW++  G +    T   V DG  I+TNCTDIT  +WTYN G++
Sbjct: 197 ARYTGNQSYVDWSEKVYDWMLGTGLISNGTTYKFVHDGVNIETNCTDITPYQWTYNQGLL 256

Query: 262 LGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQDYSTCNTDQRTFKSIF 321
           L G AY+YN T    +W     + LNG+   FF +S++YE+ACQ    CN DQR+FK+ F
Sbjct: 257 LAGCAYLYNFTQ-DEKWLIRTNQFLNGS-GVFFNNSVIYEAACQPNKNCNNDQRSFKAYF 314

Query: 322 SRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQ 381
           +R LG+T+ + P T DTI   I TSA AAA++C GG DGHTCG++W     DGYYGLGEQ
Sbjct: 315 ARFLGVTAQLLPSTRDTIMQWIDTSAYAAAQACSGGTDGHTCGMDWNWNGWDGYYGLGEQ 374

Query: 382 MNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQNNLNIKNGDRAGAAII 441
           M ALE + N    D P PY  SNGG+S G   AG     TN+    LNI  G +AGA II
Sbjct: 375 MAALEFMVNTRALDLPPPYTSSNGGSSTGSGAAGTEQKPTNL--GPLNITAGSKAGAGII 432

Query: 442 TAIILSVLIGGAVWML 457
           T ++   ++  ++W++
Sbjct: 433 TCVVGISILACSMWLV 448

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  432 bits (1110), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 216/455 (47%), Positives = 297/455 (65%), Gaps = 7/455 (1%)

Query: 7   MEMIPLICFTLL-SFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQ 65
           M +  L  F  L S+F    A+++D     ++ +A+AL+  G++DYY G +YG  +GMF 
Sbjct: 1   MLLCKLWVFGFLASWFPSASALDIDLNDFKTLQNASALVAKGLMDYYTGDQYGQTIGMFS 60

Query: 66  SPYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQG 125
            PYYWW AG A+  +++ WF  +NDTY + + +ALL Q+G N+DY+P NQ+ VEGNDDQ 
Sbjct: 61  WPYYWWEAGGAWNTLIDYWFYMKNDTYNDKVTEALLYQSGDNHDYVPLNQSTVEGNDDQA 120

Query: 126 IWGITVMGAVERNFTDPSDGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185
            WGI V+ A ER F +P D +P WL + QAVFNTM  RWD+  CGGGLRWQIFTWN+GY+
Sbjct: 121 FWGIAVLNAAERKFPNPPDDQPQWLYLGQAVFNTMALRWDTATCGGGLRWQIFTWNTGYD 180

Query: 186 YKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVL--NDTANVFDGAEID 243
           YKNT+SN  LF IAARL  +TGN++Y+D AE+V+DW+ DV  +    +D   V+DG ++ 
Sbjct: 181 YKNTVSNGALFHIAARLAYFTGNSSYVDWAERVYDWMHDVKLIEPENDDNKYVYDGVDVS 240

Query: 244 TNCT-DITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYES 302
            NC+  +T+I WTYNHG+VL G AY+Y  T G   W       L  A   F+ DSI+YE 
Sbjct: 241 NNCSGPVTRIVWTYNHGLVLSGCAYLYKET-GDKIWYNRSKAFLETAAKLFYNDSILYEY 299

Query: 303 ACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHT 362
           +CQ   TCN DQR+FKS +S  L  T+ + P   + I  ++  +A AAA++C GG DGHT
Sbjct: 300 SCQQSKTCNVDQRSFKSYYSTFLAATAQLIPDFREQIMKVVNATAYAAAQACVGGYDGHT 359

Query: 363 CGLNWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTN 422
           CG+NW ++  DG YGLGEQM ALE +      ++PAPY  +NGG S GD  AG  ++ TN
Sbjct: 360 CGINWNQKGWDGQYGLGEQMAALEALVVTQAMNKPAPYNSTNGGNSTGDGAAGTQTAPTN 419

Query: 423 VLQNNLNIKNGDRAGAAIITAIILSVLIGGAVWML 457
           +    L+I  G RAGA IIT ++   +I   +W++
Sbjct: 420 L--KPLHITAGSRAGAGIITCVVGFSIIASFLWLV 452

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  431 bits (1108), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 214/391 (54%), Positives = 276/391 (70%), Gaps = 6/391 (1%)

Query: 26  AMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQSPYYWWHAGEAFGGMLE-NW 84
           A+++D  +  SI +AT+LI  G++DYY G +YG  VGMF  PYYWW AG A+G ML+ +W
Sbjct: 28  ALDIDLDNLDSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYWWEAGGAWGSMLDYSW 87

Query: 85  FLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGIWGITVMGAVERNFTDPSD 144
           F+ +NDTY   +  A+L QTG + +YIP NQ+  EGNDDQ  WGI  M A ERNFT+P +
Sbjct: 88  FM-DNDTYDSQIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPE 146

Query: 145 GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGR 204
            KP WL + QAVFNTM  RWD+E CGGGLRWQIF WNSGY+YKNT+SN  LF +A+RL R
Sbjct: 147 DKPQWLYLAQAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNTVSNGALFHMASRLAR 206

Query: 205 YTGNTTYLDVAEQVFDWLVDVGYVVLNDT-ANVFDGAEIDTNCTDITKIEWTYNHGIVLG 263
           YTGN +Y+D AE+V+DW+ DV +V+ N T   V+DG + + NC+ +T+ +WTYNHG++L 
Sbjct: 207 YTGNQSYVDWAEKVYDWMWDV-HVISNSTYMFVYDGVDANDNCSTVTQYQWTYNHGLLLA 265

Query: 264 GLAYMYNATNGTSEWETSLTKILNGAKSYFFKDS-IMYESACQDYSTCNTDQRTFKSIFS 322
           G AY+YN T G   W     K++  A+ +F   + IMYE+ACQ   TCN DQR+FK+ FS
Sbjct: 266 GSAYLYNFT-GDEVWHNRTKKLVTAAQVFFNSTTGIMYEAACQAALTCNNDQRSFKAYFS 324

Query: 323 RMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGLNWGKQTNDGYYGLGEQM 382
           R LGLT+ + P T   I   + TSA AA KSC GG DGHTCGLNW K   DG YGLGEQM
Sbjct: 325 RFLGLTAQLVPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNWFKDGWDGMYGLGEQM 384

Query: 383 NALEVIQNLLIHDRPAPYKESNGGTSKGDAN 413
           +ALE I N     +PAPY  +NGG+SKG+++
Sbjct: 385 SALECILNTRALMKPAPYTATNGGSSKGESS 415

>Smik_7.131 Chr7 (232379..235111) [2733 bp, 910 aa] {ON} YGL141W
           (REAL)
          Length = 910

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 32/51 (62%), Gaps = 4/51 (7%)

Query: 285 ILNGAKSYFFKDSI-MYESACQDYSTCNTDQRTFKSIFSRMLGLTSVMAPY 334
           I NG+K+Y  KD++ +Y +   DY     ++R FK + +   GL++++AP+
Sbjct: 731 IPNGSKTYVTKDNVLLYITKVTDYK---LNKRCFKPVSAFHGGLSAIIAPH 778

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,162,931
Number of extensions: 2290446
Number of successful extensions: 6413
Number of sequences better than 10.0: 57
Number of HSP's gapped: 6469
Number of HSP's successfully gapped: 57
Length of query: 458
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 345
Effective length of database: 40,524,141
Effective search space: 13980828645
Effective search space used: 13980828645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)