Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.2502.534ON1671677222e-98
Skud_13.2272.534ON1671677203e-98
YMR071C (TVP18)2.534ON1671677195e-98
Suva_13.2482.534ON1671677143e-97
NDAI0H013902.534ON1671676144e-82
NCAS0F008902.534ON1671676145e-82
SAKL0A09504g2.534ON1671676051e-80
TDEL0A030802.534ON1671676042e-80
KAFR0A018702.534ON1671676014e-80
KNAG0C058002.534ON1671675963e-79
CAGL0K03025g2.534ON1671675954e-79
KLTH0D06864g2.534ON1671675685e-75
TBLA0G022402.534ON1671675572e-73
TPHA0G035202.534ON2041685482e-71
AGL072W2.534ON1671674618e-59
Ecym_72542.534ON1671674271e-53
ZYRO0B02024g2.534ON1661664098e-51
Kpol_348.92.534ON1301303953e-49
KLLA0E18525g2.534ON1711653672e-44
Kwal_26.80252.534ON64642532e-28
NDAI0D003707.492ON27855780.066
KNAG0E026002.481ON59575653.8
TDEL0D056503.497ON107772636.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.250
         (167 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {O...   282   2e-98
Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {O...   281   3e-98
YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}  ...   281   5e-98
Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {O...   279   3e-97
NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.53...   241   4e-82
NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.53...   241   5e-82
SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504...   237   1e-80
TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON...   237   2e-80
KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON...   236   4e-80
KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2....   234   3e-79
CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {...   233   4e-79
KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504...   223   5e-75
TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON...   219   2e-73
TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON...   215   2e-71
AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic hom...   182   8e-59
Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to...   169   1e-53
ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {O...   162   8e-51
Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON} c...   156   3e-49
KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} simil...   145   2e-44
Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}...   102   2e-28
NDAI0D00370 Chr4 (77608..78444) [837 bp, 278 aa] {ON} Anc_7.492 ...    35   0.066
KNAG0E02600 Chr5 complement(514921..516708) [1788 bp, 595 aa] {O...    30   3.8  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...    29   6.7  

>Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  282 bits (722), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 142/167 (85%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGV        
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  281 bits (720), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 142/167 (85%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGV        
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNF+EFIKKFETNGWRCIFYLAMA+IQY+SIAVMATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKKFETNGWRCIFYLAMAVIQYVSIAVMATSLI 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}
           TVP18Integral membrane protein localized to late Golgi
           vesicles along with the v-SNARE Tlg2p; may interact with
           ribosomes, based on co-purification experiments
          Length = 167

 Score =  281 bits (719), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 140/167 (83%), Positives = 142/167 (85%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGV        
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNFIEFIK+FETNGWRC+FYLAMAIIQYISIAVMATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFIEFIKRFETNGWRCLFYLAMAIIQYISIAVMATSLI 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167

>Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  279 bits (714), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 138/167 (82%), Positives = 141/167 (84%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGV        
Sbjct: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNF+EFIK+FETNGWRCIFYLAMA IQYISIAVMATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSDNFVEFIKRFETNGWRCIFYLAMATIQYISIAVMATSLI 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           VVAVGLTISSISYAVAYTKHQEFQNTNI+KNPTDDDFPHEAVVREML
Sbjct: 121 VVAVGLTISSISYAVAYTKHQEFQNTNILKNPTDDDFPHEAVVREML 167

>NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  241 bits (614), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 130/167 (77%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MAL + QFIN+ G+VKDLKSFNFSVYGRWFGYINIILCI LGI+NLFHV+ V        
Sbjct: 1   MALGITQFINIAGIVKDLKSFNFSVYGRWFGYINIILCIGLGISNLFHVNAVIAFGIVSI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLS+ FIEFIK+FETNG+RC+FYL MAIIQY SIA+MATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSERFIEFIKRFETNGYRCVFYLVMAIIQYCSIALMATSLI 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           VVAVGLTISSISYA+A+T HQEFQNT I+KNPTD DFP EAVVREML
Sbjct: 121 VVAVGLTISSISYAIAFTNHQEFQNTQILKNPTDPDFPREAVVREML 167

>NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  241 bits (614), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 129/167 (77%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MAL + QFIN  GM KDLKSFNFSVYGRWFGYINIILCIALG+ANLFHV+ V        
Sbjct: 1   MALDIKQFINFAGMAKDLKSFNFSVYGRWFGYINIILCIALGVANLFHVNAVIAFGIISI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLS+NFIEFIK+FETNG+RC+FYL MAIIQY SI +MATSLI
Sbjct: 61  IQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRCLFYLGMAIIQYCSIILMATSLI 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           VVA+GLTISS+SYAVA+  HQEFQNTNIIKNP D DFPHEAVVREM+
Sbjct: 121 VVAIGLTISSMSYAVAFANHQEFQNTNIIKNPADADFPHEAVVREMV 167

>SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  237 bits (605), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 115/167 (68%), Positives = 132/167 (79%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MAL + QFIN+ G+VKDLKSFNFSVYG+WFGYINIILC+ALGIANLFHV+ V        
Sbjct: 1   MALGIKQFINIAGIVKDLKSFNFSVYGQWFGYINIILCLALGIANLFHVNAVVAFGVLSI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNFIEFIK+FETNG R +FY AMAIIQ+ S+A+M TSLI
Sbjct: 61  IQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRTLFYTAMAIIQWCSLALMTTSLI 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           VVA+GLTIS+ SYAVA++KHQ+FQNTNIIKNPTD+DFPHEAVVREML
Sbjct: 121 VVAIGLTISAASYAVAWSKHQQFQNTNIIKNPTDEDFPHEAVVREML 167

>TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  237 bits (604), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 130/167 (77%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MAL + QFINV G+VKDLKSFNFS+YGRWFGYINI LCIALGIANLFHVS V        
Sbjct: 1   MALGVRQFINVAGIVKDLKSFNFSLYGRWFGYINIFLCIALGIANLFHVSAVIAFGIVAI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNFIEFIK+FETNG+R +FY+ MA+IQ+ SIAV ATSLI
Sbjct: 61  VQGLIILFVEIPFLLKICPLSDNFIEFIKRFETNGYRTLFYVVMAVIQWCSIAVQATSLI 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           VVAVGLTIS+ SYAVA TKHQEFQNT+I+K+PT DDFPHEAVVREML
Sbjct: 121 VVAVGLTISACSYAVALTKHQEFQNTHILKDPTSDDFPHEAVVREML 167

>KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  236 bits (601), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 128/167 (76%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MALS+ QFINV G+VKDLKSFNFSVYGRWFGYINIILCIALGI+NLFHV+ V        
Sbjct: 1   MALSIKQFINVAGIVKDLKSFNFSVYGRWFGYINIILCIALGISNLFHVNAVIAFGIISI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNF+EFIK+FETNG+RC+FYL MAIIQY SI +MATSLI
Sbjct: 61  IQGLIILFIEIPFLLKICPLSDNFVEFIKRFETNGYRCVFYLVMAIIQYCSIILMATSLI 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           VVA+ LT+S  SY +A  K QEFQNTNIIKNPTD DFPHEAVVREML
Sbjct: 121 VVAICLTVSCASYGIAAFKKQEFQNTNIIKNPTDTDFPHEAVVREML 167

>KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  234 bits (596), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 128/167 (76%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MALS+ QF N  GM+KDL+SFNFSVYGRWFG+INIILC+ALGIANLFHVSGV        
Sbjct: 1   MALSIKQFFNTAGMLKDLRSFNFSVYGRWFGFINIILCVALGIANLFHVSGVIAFGIVSI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNFIEFI +FETNG+R +FYLAMA+IQY S+ +M TSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDNFIEFISRFETNGYRAMFYLAMAVIQYCSVILMVTSLL 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           VVA+ LT+S++ YAVA+ KHQEFQNTNIIKNP D DFPHEAVVREML
Sbjct: 121 VVAICLTVSAVFYAVAFVKHQEFQNTNIIKNPADADFPHEAVVREML 167

>CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {ON}
           highly similar to uniprot|Q04767 Saccharomyces
           cerevisiae YMR071c
          Length = 167

 Score =  233 bits (595), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 110/167 (65%), Positives = 128/167 (76%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MAL + QFIN+ G++KDLKSFNFSVYG+WFGYINI LCIALGIANLFHVS V        
Sbjct: 1   MALGITQFINIAGLLKDLKSFNFSVYGKWFGYINIFLCIALGIANLFHVSAVIAFGIVGI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSD FIEFIK+FETNG+RCIFY  MAI+QY S+AVM TSL+
Sbjct: 61  VQGLIILFIEIPFLLKICPLSDRFIEFIKRFETNGYRCIFYTLMAIVQYCSLAVMTTSLL 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           V+ + LTIS++SY +A+TKHQEF NTNIIKNPTD+DFPH+AVVREML
Sbjct: 121 VLGITLTISAVSYGIAFTKHQEFANTNIIKNPTDEDFPHDAVVREML 167

>KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  223 bits (568), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 126/167 (75%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MAL++ QFINV G+V+DLKSFNFSVYG+WFGYINI LC+ALGIANLFHVS V        
Sbjct: 1   MALNIKQFINVAGLVRDLKSFNFSVYGQWFGYINIFLCVALGIANLFHVSAVIVFGIIAI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNFI FIK+FETNG R +FY+ MA +Q+ S+AVMATSLI
Sbjct: 61  VQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRTLFYVGMAAVQWCSLAVMATSLI 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
            VA+GLTIS+ SY VA+ KHQ+FQ T++IK+P DDDFPHEAVVREML
Sbjct: 121 AVAIGLTISAASYGVAFFKHQQFQGTSVIKSPADDDFPHEAVVREML 167

>TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  219 bits (557), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 128/167 (76%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           M ++L +F+N+ G+V+ LKSFNFS+YG+WFGYINI+LC+ALGIANLFHV+ V        
Sbjct: 1   MGVALQEFLNINGIVRGLKSFNFSLYGQWFGYINILLCVALGIANLFHVNPVIAFGIVSI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNFI FIK F+TNG+RCIFY+AMA +Q+ SI + ATSLI
Sbjct: 61  IQSFIILFVEVPFLLKICPLSDNFIAFIKHFQTNGFRCIFYIAMATVQWCSIILKATSLI 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           VVA+GLTIS+ISYAVAY K+QEFQN +IIKNPTDDDFP EAVVREML
Sbjct: 121 VVAIGLTISAISYAVAYFKNQEFQNVSIIKNPTDDDFPREAVVREML 167

>TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON}
           Anc_2.534 YMR071C
          Length = 204

 Score =  215 bits (548), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 105/168 (62%), Positives = 126/168 (75%), Gaps = 1/168 (0%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MALS+ QFIN  GM+KDLKSFNFSVYG++FGYINIILC+ALGIANLFHV+ V        
Sbjct: 37  MALSIKQFINGAGMLKDLKSFNFSVYGQYFGYINIILCMALGIANLFHVNAVIAFGIVAI 96

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNF+ F+K FETNGWRC+F+  MAI+Q+ S+ +  TSLI
Sbjct: 97  VQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRCLFFTGMAIVQWCSLILKVTSLI 156

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNT-NIIKNPTDDDFPHEAVVREML 167
           VVA+GL+IS+  YA+A+ K QEFQ+T N+IKNPTDDDFPHEAVVREML
Sbjct: 157 VVAIGLSISAAFYAIAFFKKQEFQHTSNVIKNPTDDDFPHEAVVREML 204

>AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR071C (TVP18)
          Length = 167

 Score =  182 bits (461), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 90/167 (53%), Positives = 110/167 (65%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MALS   F+NV G++ DL+SFNFSVYGRWFGYINI+LC+ALGIAN+FH S V        
Sbjct: 1   MALSWKSFVNVPGILADLRSFNFSVYGRWFGYINILLCLALGIANIFHFSIVIAFAIVAI 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLSDNFI  +KK +TNG R + Y A+AI+QY S++V  TSL+
Sbjct: 61  VQGLLLIFVEVPILLKICPLSDNFIGLVKKCDTNGRRTLLYTALAIVQYASLSVQVTSLL 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
            VA+GLTIS+I Y   Y K QEF   N+I+NPTD  F  EA VRE+L
Sbjct: 121 AVAIGLTISAIFYGTGYLKKQEFLEGNVIRNPTDPAFMREAAVREVL 167

>Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to
           Ashbya gossypii AGL072W
          Length = 167

 Score =  169 bits (427), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 107/167 (64%)

Query: 1   MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXX 60
           MA+SL  FINV G+V DLKSFNFSVYGRWFGYINIILCIALGIAN+FH   V        
Sbjct: 1   MAVSLKSFINVPGIVSDLKSFNFSVYGRWFGYINIILCIALGIANIFHFGPVIIFSILAL 60

Query: 61  XXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLI 120
                            CPLS+ F+  +K F +N  R + Y  MA+IQ++S+    TSL+
Sbjct: 61  GQGFFLLFVEVPFLVKICPLSERFVSNVKIFNSNMKRTMLYGVMAVIQWVSLVFEVTSLV 120

Query: 121 VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML 167
           V+A+ LT+S+I YA  +   QEF+ +N+++ P  D FPHEA VREML
Sbjct: 121 VLAICLTVSAIFYASGWLTKQEFKESNVLRGPGSDTFPHEASVREML 167

>ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {ON}
           similar to uniprot|Q04767 Saccharomyces cerevisiae
           YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa Integral
           membrane vesicle protein
          Length = 166

 Score =  162 bits (409), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 84/166 (50%), Positives = 107/166 (64%), Gaps = 1/166 (0%)

Query: 3   LSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXXXX 62
           + L Q   +G +V+ LKS+NFS+YG++  Y+NII CIA GIANLFHV+ V          
Sbjct: 1   MDLAQIKILGSLVQGLKSYNFSLYGKYVAYLNIIFCIAFGIANLFHVNAVIAFGVISIVQ 60

Query: 63  XXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLIVV 122
                          CPLSDNFIEF+ +FETNGWR IFY+  A++Q+ S+A+  TSLIVV
Sbjct: 61  GAIILFLEVPFLLRICPLSDNFIEFVSRFETNGWRTIFYIFNAVLQWASLALKITSLIVV 120

Query: 123 AVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDF-PHEAVVREML 167
           AVGLTIS+  Y VAY KHQ FQN++ IK P  +    +E  VREML
Sbjct: 121 AVGLTISAAFYGVAYFKHQNFQNSSHIKEPVGEGVEANEQNVREML 166

>Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON}
           complement(17797..18189) [393 nt, 131 aa]
          Length = 130

 Score =  156 bits (395), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 79/130 (60%), Positives = 94/130 (72%), Gaps = 1/130 (0%)

Query: 39  IALGIANLFHVSGVXXXXXXXXXXXXXXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRC 98
           +ALGIANLFHV+ V                         CPLS+NFI FIK FETNG+RC
Sbjct: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60

Query: 99  IFYLAMAIIQYISIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQN-TNIIKNPTDDDF 157
           IFY  MAI+Q+ S+A+M TSLIVVA+ LTIS+I YA+AY K+QEFQ+ TN+IKNPTDDDF
Sbjct: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120

Query: 158 PHEAVVREML 167
           PH+AVVREML
Sbjct: 121 PHDAVVREML 130

>KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} similar
           to uniprot|Q04767 Saccharomyces cerevisiae YMR071C TVP18
           Tlg2-Vesicle Protein of 18 kDa Integral membrane vesicle
           protein
          Length = 171

 Score =  145 bits (367), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 98/165 (59%), Gaps = 2/165 (1%)

Query: 5   LGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVXXXXXXXXXXXX 64
           L    NV GMV DLKS NFS+YG+W  Y+NII C+A GIAN+FH S V            
Sbjct: 7   LKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHFSAVIVFSIIAIVQGL 66

Query: 65  XXXXXXXXXXXXXCPLSDNFIEFIKKFETNGWRCIFYLAMAIIQYISIAVMATSLIVVAV 124
                        CPLSDNFI F+ KF+TN  R +FYL M  IQ+ SI V +TSLIVVAV
Sbjct: 67  IILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTSLIVVAV 126

Query: 125 GLTISSISYAVAYTKHQEFQNTNII--KNPTDDDFPHEAVVREML 167
           GL+I++  YA+     QEF+N+ I+  +        +EAVVR+ML
Sbjct: 127 GLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML 171

>Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}
           YMR071C - Hypothetical ORF [contig 55] FULL
          Length = 64

 Score =  102 bits (253), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 57/64 (89%)

Query: 104 MAIIQYISIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVV 163
           MA +Q+ SIA+M TSLIVVAVGLTIS+ SY+VA+ KHQ+FQ T++IKNP D+DFPHEAVV
Sbjct: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQGTSVIKNPADEDFPHEAVV 60

Query: 164 REML 167
           REML
Sbjct: 61  REML 64

>NDAI0D00370 Chr4 (77608..78444) [837 bp, 278 aa] {ON} Anc_7.492
           YBL049W
          Length = 278

 Score = 34.7 bits (78), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 103 AMAIIQYISIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDF 157
           A  I++  S +V+ TSLI   +    S+ SY      H+  QN + + +PTD+DF
Sbjct: 65  AFRIVRTPS-SVVTTSLIYPHLNHESSTRSYRNGRRNHRNHQNRHTVFSPTDNDF 118

>KNAG0E02600 Chr5 complement(514921..516708) [1788 bp, 595 aa] {ON}
           Anc_2.481 YKL100C
          Length = 595

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 15/75 (20%)

Query: 101 YLAMAIIQY--------ISIAVMATSLIVVAVGLTISSI-SYAVAYTKHQEFQNTNIIKN 151
           YL   I+Q+        +S  VMAT LIV+   L++ SI + A+  T+         + +
Sbjct: 67  YLTHKIMQFHDNFVSYQVSFLVMATVLIVLGTLLSVKSIPTTALPPTREHH------LFD 120

Query: 152 PTDDDFPHEAVVREM 166
           PTD++   E ++++M
Sbjct: 121 PTDNEVNSECMIKDM 135

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON}
           Anc_3.497 YGR134W
          Length = 1077

 Score = 28.9 bits (63), Expect = 6.7,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 89  KKFETNGWRCIFYLAMAIIQYISIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQNTNI 148
           +KF+ +   C+F L   ++ +I I   A +L      L I+  S A   T  QE +N   
Sbjct: 913 EKFDFSESECVFELQALLMNWIGIIPEAKTLFFELKSL-IAGFSTA---TSVQEQKNAE- 967

Query: 149 IKNPTDDDFPHE 160
           +KN T +D P E
Sbjct: 968 VKNDTQEDVPKE 979

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.141    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,453,080
Number of extensions: 438008
Number of successful extensions: 1868
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1858
Number of HSP's successfully gapped: 27
Length of query: 167
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 66
Effective length of database: 41,900,133
Effective search space: 2765408778
Effective search space used: 2765408778
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 61 (28.1 bits)