Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.208.838ON51051023790.0
YML114C (TAF8)8.838ON51051019610.0
Suva_13.298.838ON50951018060.0
Skud_13.278.838ON51451417730.0
ZYRO0G14146g8.838ON5073774925e-55
NCAS0B003108.838ON5643784666e-51
TDEL0B005908.838ON5413684509e-49
Kpol_1068.108.838ON6173504478e-48
NDAI0E003008.838ON6644604083e-42
ABL128W8.838ON4743683942e-41
KLTH0C03916g8.838ON5703623912e-40
Kwal_27.102728.838ON5513963867e-40
TPHA0I002308.838ON6144023835e-39
Ecym_46098.838ON5203933645e-37
SAKL0D01518g8.838ON5744003641e-36
KLLA0D01617g8.838ON5624083065e-29
TBLA0D032508.838ON6834813004e-28
KAFR0A028208.838ON4533452921e-27
KNAG0G034108.838ON5263251767e-13
CAGL0B02299g8.838ON6431231563e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.20
         (510 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}...   920   0.0  
YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}  T...   759   0.0  
Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}...   700   0.0  
Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}...   687   0.0  
ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weak...   194   5e-55
NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}...   184   6e-51
TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {O...   177   9e-49
Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {O...   176   8e-48
NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}...   161   3e-42
ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic ho...   156   2e-41
KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {...   155   2e-40
Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {...   153   7e-40
TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838...   152   5e-39
Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar...   144   5e-37
SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {...   144   1e-36
KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {...   122   5e-29
TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.8...   120   4e-28
KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.8...   117   1e-27
KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.8...    72   7e-13
CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some s...    65   3e-10

>Smik_13.20 Chr13 complement(38299..39831) [1533 bp, 510 aa] {ON}
           YML114C (REAL)
          Length = 510

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/510 (89%), Positives = 458/510 (89%)

Query: 1   MTFRMSGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60
           MTFRMSGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA
Sbjct: 1   MTFRMSGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60

Query: 61  LDELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFI 120
           LDELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFI
Sbjct: 61  LDELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFI 120

Query: 121 KSNHAVEYGKLVRLSSFPALAHXXXXXXXXXXXXXXQQSEINVLLPPSNPLEKLIPSWLP 180
           KSNHAVEYGKLVRLSSFPALAH              QQSEINVLLPPSNPLEKLIPSWLP
Sbjct: 121 KSNHAVEYGKLVRLSSFPALAHNEEDEEDELSNIEEQQSEINVLLPPSNPLEKLIPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPV 240
           NFPPDHTYKFTPEFNHPITDL                ALLNLNKRLSHLSSASHTSPPPV
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESEESEKALLNLNKRLSHLSSASHTSPPPV 240

Query: 241 LDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQLKR 300
           LDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQLKR
Sbjct: 241 LDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQLKR 300

Query: 301 TKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKE 360
           TKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKE
Sbjct: 301 TKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKE 360

Query: 361 ERAKSLRRRQEELISERKKREQDEGHDLELLLNNEHAREATDNNTTPXXXXXXXXXXXXX 420
           ERAKSLRRRQEELISERKKREQDEGHDLELLLNNEHAREATDNNTTP             
Sbjct: 361 ERAKSLRRRQEELISERKKREQDEGHDLELLLNNEHAREATDNNTTPNVANNSTIIINAN 420

Query: 421 XXXXXXXXXLFGILGSSEDENEISSMPVENLAGESEPPTMIMQDTVNSTLAAHNTTNVDA 480
                    LFGILGSSEDENEISSMPVENLAGESEPPTMIMQDTVNSTLAAHNTTNVDA
Sbjct: 421 ANDEDDDMNLFGILGSSEDENEISSMPVENLAGESEPPTMIMQDTVNSTLAAHNTTNVDA 480

Query: 481 TANRSTHSTLSENTPTSPPTAMATDNDITM 510
           TANRSTHSTLSENTPTSPPTAMATDNDITM
Sbjct: 481 TANRSTHSTLSENTPTSPPTAMATDNDITM 510

>YML114C Chr13 complement(42043..43575) [1533 bp, 510 aa] {ON}
           TAF8TFIID subunit (65 kDa), involved in RNA polymerase
           II transcription initiation
          Length = 510

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/510 (74%), Positives = 406/510 (79%)

Query: 1   MTFRMSGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60
           MT + S S +GTQ TIVQLR LPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA
Sbjct: 1   MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60

Query: 61  LDELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFI 120
           LDELVNLV VQMDGMFRNLHNLTLLQRRS+ASQADLKLL REFN+DA SLYQQFQ SEFI
Sbjct: 61  LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFI 120

Query: 121 KSNHAVEYGKLVRLSSFPALAHXXXXXXXXXXXXXXQQSEINVLLPPSNPLEKLIPSWLP 180
           KS H+ EY KL+  SS  AL H              QQ+EINVLLPPSNPLEK IPSWLP
Sbjct: 121 KSKHSTEYEKLMSWSSLAALPHNEEDEEDELNNIEEQQNEINVLLPPSNPLEKQIPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPV 240
           NFPPDHTYKFTPEFNHPITDL                ALLNLNK LSH+SSAS+T  PP 
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPG 240

Query: 241 LDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQLKR 300
           LDD DA EQQLEIWGNAL+ERKPTIT  S NE+NIEQYAKYRVELARERV KFE+NQLKR
Sbjct: 241 LDDEDAIEQQLEIWGNALEERKPTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKR 300

Query: 301 TKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKE 360
           TKNPFLK+SETLY  E PHQSHKTIQ  I+LQFRKSMTLFMHNLPKVQKLKKE+IRMAKE
Sbjct: 301 TKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKE 360

Query: 361 ERAKSLRRRQEELISERKKREQDEGHDLELLLNNEHAREATDNNTTPXXXXXXXXXXXXX 420
           ERAKSL+RRQEELIS+R KREQDEGHDLELLLNNEHAR+A D+ TTP             
Sbjct: 361 ERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTN 420

Query: 421 XXXXXXXXXLFGILGSSEDENEISSMPVENLAGESEPPTMIMQDTVNSTLAAHNTTNVDA 480
                    LFGILGSSEDENE+SSMP ENL  ESEPPTM  QDT N+T  AHNTTN+DA
Sbjct: 421 AEDEDDDINLFGILGSSEDENEMSSMPAENLVAESEPPTMTAQDTTNTTPVAHNTTNIDA 480

Query: 481 TANRSTHSTLSENTPTSPPTAMATDNDITM 510
           T + S HST +EN PTSPP  +ATD+DITM
Sbjct: 481 TTSHSPHSTPNENAPTSPPADIATDHDITM 510

>Suva_13.29 Chr13 complement(41778..43307) [1530 bp, 509 aa] {ON}
           YML114C (REAL)
          Length = 509

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/510 (69%), Positives = 395/510 (77%), Gaps = 1/510 (0%)

Query: 1   MTFRMSGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60
           MT     S SG   T+VQL  LPDLTE+SHLEIDAPV+EILKK+VLFQLNSLNICISNFA
Sbjct: 1   MTSATPESGSGASQTMVQLTNLPDLTEVSHLEIDAPVLEILKKSVLFQLNSLNICISNFA 60

Query: 61  LDELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFI 120
           LDE+VNLVAVQMDGMFRNLHNL LLQRRS+ SQADLKLLFREFN+++ASL+QQ Q+SE I
Sbjct: 61  LDEMVNLVAVQMDGMFRNLHNLALLQRRSQVSQADLKLLFREFNLNSASLFQQLQISEHI 120

Query: 121 KSNHAVEYGKLVRLSSFPALAHXXXXXXXXXXXXXXQQSEINVLLPPSNPLEKLIPSWLP 180
           KS H+VEY KLV+ SSF A++H              QQ+EINVLLPPSNPLEKLIPSWLP
Sbjct: 121 KSKHSVEYEKLVKSSSFTAVSHIEDDEEDEINNIEEQQNEINVLLPPSNPLEKLIPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPV 240
           NFPPDHTYKFTPEFNHPITDL                ALLNLNKRL  +SSASHT P P 
Sbjct: 181 NFPPDHTYKFTPEFNHPITDLKTIKREIVKESGESERALLNLNKRLFRISSASHT-PSPR 239

Query: 241 LDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQLKR 300
           L DA    ++LEIWGN L ERKP I A S NE NIEQYAKYR+ELARERV+KFE+NQLKR
Sbjct: 240 LPDASDASERLEIWGNTLHERKPAIIAKSFNEKNIEQYAKYRIELARERVSKFEVNQLKR 299

Query: 301 TKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKE 360
           TKNPFLK+SE+LY  + PHQSHK IQ +IDLQ RKS+TLFMHNLPKVQKLKKE+I++AKE
Sbjct: 300 TKNPFLKISESLYSFKNPHQSHKVIQRSIDLQLRKSVTLFMHNLPKVQKLKKEKIQLAKE 359

Query: 361 ERAKSLRRRQEELISERKKREQDEGHDLELLLNNEHAREATDNNTTPXXXXXXXXXXXXX 420
           ER KSL+RRQEELIS+RKK+EQDEGHDLELLLNNE ARE+TDNNT               
Sbjct: 360 ERQKSLKRRQEELISQRKKKEQDEGHDLELLLNNEQARESTDNNTNLNALNVSTIDINAN 419

Query: 421 XXXXXXXXXLFGILGSSEDENEISSMPVENLAGESEPPTMIMQDTVNSTLAAHNTTNVDA 480
                    LFGILGSSEDENE+SS+ VE +AGESEPPT   +DT N+T  A NTTN+D 
Sbjct: 420 ADGDDDDMNLFGILGSSEDENELSSIQVETVAGESEPPTAPARDTTNTTPVAQNTTNIDT 479

Query: 481 TANRSTHSTLSENTPTSPPTAMATDNDITM 510
           TAN S  ST +EN PTSPPTA ATDNDI +
Sbjct: 480 TANFSILSTPNENAPTSPPTATATDNDINI 509

>Skud_13.27 Chr13 complement(41670..43214) [1545 bp, 514 aa] {ON}
           YML114C (REAL)
          Length = 514

 Score =  687 bits (1773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/514 (69%), Positives = 395/514 (76%), Gaps = 4/514 (0%)

Query: 1   MTFRMSGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA 60
           MT   S S  GT+ T+VQL+ LPDLTEISHL+IDAPVVEIL+KTVLFQLNSL+ICISNFA
Sbjct: 1   MTSTTSESGFGTRRTLVQLKNLPDLTEISHLKIDAPVVEILRKTVLFQLNSLDICISNFA 60

Query: 61  LDELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFI 120
           LDELVNLVAVQMDGMFRNLHNL LLQRRS A+QADLKLLF+EFN+D ASLYQQ Q+SEFI
Sbjct: 61  LDELVNLVAVQMDGMFRNLHNLALLQRRSRATQADLKLLFKEFNLDPASLYQQLQISEFI 120

Query: 121 KSNHAVEYGKLVRLSSFPALAHXXXXXXXXXXXXXXQQSEINVLLPPSNPLEKLIPSWLP 180
           KSNH+VEY KLV  SSF A +H              QQ+EI+VLLPPSNPLEKL+PSWLP
Sbjct: 121 KSNHSVEYEKLVSSSSFSASSHNEEDEEDELNNIEEQQNEISVLLPPSNPLEKLMPSWLP 180

Query: 181 NFPPDHTYKFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPV 240
           NFPPDHTY+FTPEFNHPITDL                ALLNLNKRL H+S ASH  PP +
Sbjct: 181 NFPPDHTYRFTPEFNHPITDLKTIKREIVKESKESEKALLNLNKRLLHISLASHAPPPRL 240

Query: 241 LDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQLKR 300
            DDADA EQQLEIWGNALQE K T  + S NE+NIEQYAKYRVELARERV+KFE+NQLKR
Sbjct: 241 PDDADAGEQQLEIWGNALQEEKRTAISKSFNENNIEQYAKYRVELARERVSKFEVNQLKR 300

Query: 301 TKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKE 360
           TKNPFL++SETLY S+ PHQ H+ IQ AIDLQFRKSM LF HNLPKVQKLKKE+IRMA E
Sbjct: 301 TKNPFLRISETLYSSKSPHQPHRAIQRAIDLQFRKSMMLFAHNLPKVQKLKKEKIRMAIE 360

Query: 361 ERAKSLRRRQEELISERKKREQDEGHDLELLLNNEHAREATDNNTTPXXXXXXXXXXXXX 420
           ER++SL+RRQEELI ERKKREQDEGHDLELLL+NEHARE+T+NNT P             
Sbjct: 361 ERSRSLKRRQEELILERKKREQDEGHDLELLLHNEHARESTENNTNPNAPSSFTIDINAN 420

Query: 421 XXXXXXXXXLFGILGSSEDENEISSMPVENLAGESEPPTMIMQDTVNSTLAAHNTTNVDA 480
                    LFGILGSS DENE  S+   N+AGE EPPT  +QD  N+T   HNTTN+DA
Sbjct: 421 ADDEDDDMNLFGILGSSGDENEAPSIQNGNVAGEPEPPTATVQDNANTTSMTHNTTNIDA 480

Query: 481 TANR----STHSTLSENTPTSPPTAMATDNDITM 510
           TA      S  ST +EN PTSPP   ATD+DITM
Sbjct: 481 TATNPSFSSFQSTPNENAPTSPPILKATDHDITM 514

>ZYRO0G14146g Chr7 (1126767..1128290) [1524 bp, 507 aa] {ON} weakly
           similar to uniprot|Q03750 Saccharomyces cerevisiae
           YML114C TAF8 TFIID subunit (65 kDa) involved in RNA
           polymerase II transcription initiation
          Length = 507

 Score =  194 bits (492), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 122/377 (32%), Positives = 204/377 (54%), Gaps = 16/377 (4%)

Query: 17  VQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVAVQMDGMF 76
           +Q+ +LP L E+ H + +  VV++L K+V  QL  +N  I+ FA D L+ LV  Q++ M 
Sbjct: 5   IQITKLPTLQELQHEDREPNVVKVLAKSVALQLKPMNAQITQFAFDRLLQLVDGQLNDMI 64

Query: 77  RNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRLSS 136
             LH ++ LQRR   ++ D+ +L   FN+  +S+  Q ++SEF    +  E+  L  L  
Sbjct: 65  SQLHRMSNLQRRETIAKGDISMLMEGFNISPSSIELQSRISEFYSQKYFKEFNHLHSLRD 124

Query: 137 F-PALAHXXXXXXXXXXXXXXQQSEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFN 195
              +LAH              +Q+   VL+PP+NPL+  +P WLP+FPPDHTYKFTP+++
Sbjct: 125 LQSSLAH---EMVPFEDQEAVRQNVSTVLVPPTNPLQDFLPKWLPDFPPDHTYKFTPQYS 181

Query: 196 HPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPVLDDADATEQQLEIWG 255
           HPITD                 AL +L+++ +      + S     D   A ++ L I+G
Sbjct: 182 HPITDETTIRRQIVEEAKQSELALSHLSQKKNPTDDIVNRS---QYDSELAEQETLAIYG 238

Query: 256 NALQERK---PTITA----TSLNESN--IEQYAKYRVELARERVAKFELNQLKRTKNPFL 306
           + L++RK   P   +    + L ++N  +E+YA  R+E+AR++V +FE  QL+  ++PFL
Sbjct: 239 SQLKKRKTQHPQANSADLLSKLPQTNFSVEEYAHNRIEVARKKVLEFEERQLQSQQDPFL 298

Query: 307 KLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKEERAKSL 366
           KLS   +       + K +     L  ++S    + ++P++++ K E    AKEER+K L
Sbjct: 299 KLSRIAFTQCNDKFTKKQVHREFQLALQRSFIHLVKSIPELERNKLETEEKAKEERSKRL 358

Query: 367 RRRQEELISERKKREQD 383
           +  + +   + KK E+D
Sbjct: 359 QELRAQREEQEKKGERD 375

>NCAS0B00310 Chr2 complement(37876..39570) [1695 bp, 564 aa] {ON}
           Anc_8.838 YML114C
          Length = 564

 Score =  184 bits (466), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 126/378 (33%), Positives = 196/378 (51%), Gaps = 26/378 (6%)

Query: 19  LRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVAVQMDGMFRN 78
           +  L + TEI     D  V ++L K++  QL  LN+ +S  A +EL  LV  Q+D +   
Sbjct: 30  MNELTNPTEIPSNSSDEQVRKLLNKSIALQLKPLNLELSQLAFNELSLLVNDQLDFLISE 89

Query: 79  LHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRLSSFP 138
           LH ++++QRR+ A++ D++LL R  N++ + L+ Q QVS F+KS +  +Y  L++ SS  
Sbjct: 90  LHRMSVIQRRNAAAKTDIELLLRGLNLNMSELHYQLQVSNFMKSKNGKDYDTLIKDSS-- 147

Query: 139 ALAHXXXXXXXXXXXXXXQQSEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFNHPI 198
                               +  N+L+ P+NP E  IP+WLP FPPDHTYKFTP+FN PI
Sbjct: 148 -TIFDSSDTMANPGHDSMVNNPSNILIKPNNPFEISIPNWLPAFPPDHTYKFTPQFNKPI 206

Query: 199 TDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPVLDDADATEQQLEIWG-NA 257
           TD                 +LLNL   ++  SS  +       D   A E+ + I+G +A
Sbjct: 207 TDQVLIKQKLIEEGKKSEKSLLNLLNDITEQSSIENEETSN-FDSELAREENIAIYGYDA 265

Query: 258 L--QERKP----TITATSLN---------ESNIEQYAKYRVELARERVAKFELNQLKRTK 302
           +  ++RKP    +I  T  N           N+  YA +RVEL R+RV +FEL QLK  K
Sbjct: 266 MSRKKRKPPHLISIHDTEQNFFNHPQGSKHFNVGNYAHFRVELTRKRVEEFELEQLKWEK 325

Query: 303 NPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMA---K 359
           NPFL+LS  +        S   ++  I    ++S      N PK+++ +  R+ +A   +
Sbjct: 326 NPFLRLSRMI---NDKKVSRSDLKLEIKNSLQRSYKSIFRNYPKLKQERDRRLELARQKR 382

Query: 360 EERAKSLRRRQEELISER 377
           EE+ + L+ + E+L  +R
Sbjct: 383 EEKIEKLKIQNEQLKKDR 400

>TDEL0B00590 Chr2 complement(113785..115410) [1626 bp, 541 aa] {ON}
           Anc_8.838 YML114C
          Length = 541

 Score =  177 bits (450), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 115/368 (31%), Positives = 183/368 (49%), Gaps = 36/368 (9%)

Query: 17  VQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVAVQMDGMF 76
           +QL  LP L EI H + +A VV+IL K V  QL  +   IS FA + L+ L+  Q++ M 
Sbjct: 10  IQLTHLPTLDEIDHGKTEAAVVKILSKAVALQLKPMKADISKFAFEHLMILIDDQLNDMI 69

Query: 77  RNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRLSS 136
             LH  + +QRR   ++ D+ L  + +N+  A L +Q Q S++    +  E+  L     
Sbjct: 70  GQLHRFSNVQRRESIAKGDVHLFLQGYNLTPADLDKQHQASQYYSKTYGKEFDSL----- 124

Query: 137 FPALAHXXXXXXXXXXXXXXQQSE--INVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEF 194
                H                SE  IN L+ P+NPL + IP W+P FPPDHTYKFTP++
Sbjct: 125 -----HSLKETFTDAVVDEDNGSEDVINELVRPNNPLIRYIPKWMPAFPPDHTYKFTPQY 179

Query: 195 NHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPVLDDADAT------- 247
           N PITD                 ALL+L K +         +PP    DAD         
Sbjct: 180 NQPITDETIIRRRIVDEGKQSEVALLHLLKNM---------NPPTPSSDADGASYDEALV 230

Query: 248 -EQQLEIWGNALQERKPTITATSLNES-------NIEQYAKYRVELARERVAKFELNQLK 299
            E+   I+GN  ++RK   +++S   S       +IE+YA+ RVE+AR++V ++E  Q+K
Sbjct: 231 REETAAIYGNEQKKRKKNASSSSDLLSKLPQTNFSIEEYARSRVEIARKKVVEYEERQMK 290

Query: 300 RTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAK 359
             +NPF+K S+    +       +     I    ++S+   + ++P++Q  K++  R A+
Sbjct: 291 LQRNPFIKYSKIALSNSSDKSGRRQATREIHSMLQRSLQHLIKSIPELQMTKQDARRKAE 350

Query: 360 EERAKSLR 367
           ++R + L+
Sbjct: 351 QKRDERLQ 358

>Kpol_1068.10 s1068 complement(18964..20817) [1854 bp, 617 aa] {ON}
           complement(18964..20817) [1854 nt, 618 aa]
          Length = 617

 Score =  176 bits (447), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 113/350 (32%), Positives = 179/350 (51%), Gaps = 16/350 (4%)

Query: 10  SGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNI--CISNFALDELVNL 67
           +G     +QL  LP LTE  + E +  + +IL K V  QL S+N    I+ FA + L++L
Sbjct: 2   TGEATKYIQLTELPTLTEYKYEETEPAIEKILAKAVALQLKSMNCDTSITKFAFEHLMSL 61

Query: 68  VAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVE 127
           V  Q+D M   LH L+ LQRR+  ++AD+ +  R FN+    L +Q Q S+++   +  +
Sbjct: 62  VVGQIDDMVLELHRLSSLQRRNTVAKADISVWLRGFNLTPEDLEEQNQKSQYLSKLYDKD 121

Query: 128 YGKLVRLSSFPALAHXXXXXXXXXXXXXXQQSEINVLLPPSNPLEKLIPSWLPNFPPDHT 187
           Y  L ++++                      ++ + L+P SNPL+KLIPSWLP+FPPD+T
Sbjct: 122 YESLTKIATT-TTRTLSTYQKLDLTHKDTSTAQTSKLVPISNPLQKLIPSWLPDFPPDYT 180

Query: 188 YKFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNL-----NKRLSHLSSASHTSPPPVLD 242
           YKFTP++N PITD                 ALLNL       R+S     S +      +
Sbjct: 181 YKFTPQYNTPITDETIIRRKVVEEGKQSEKALLNLLRGGQEDRISRDLKFSSSEMELATE 240

Query: 243 DADATEQQLEIWGNALQ---ERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQLK 299
           +  AT   + +    L    E++P       N  N+E+YA+ RVE+ R++V  +E  QL+
Sbjct: 241 ETLATYSAITLRNKHLTSFFEKEPI-----QNSLNVEEYARTRVEIERKKVLGYEERQLQ 295

Query: 300 RTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQK 349
             +NPFLK+S  +  +     S     + I    ++S+  F+H++PK Q+
Sbjct: 296 IQRNPFLKISRLISANNDNKVSKSVANTEIRKYLKRSLLNFIHSIPKTQQ 345

>NDAI0E00300 Chr5 complement(41787..43781) [1995 bp, 664 aa] {ON}
           Anc_8.838 YML114C
          Length = 664

 Score =  161 bits (408), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 133/460 (28%), Positives = 209/460 (45%), Gaps = 107/460 (23%)

Query: 27  EISHLEIDAPVVEILKKTVLFQLNSLNICISNFALDELVNLVAVQMDGMFRNLHNLTLLQ 86
           EI+H  +D  + ++L+K++  QL +  +  S  A ++L  LV  Q++ +   LH L+LLQ
Sbjct: 20  EIAHNHMDMQIEKLLQKSIAIQLKAFKVDFSKLAFNQLTLLVDDQLNSLITELHRLSLLQ 79

Query: 87  RRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSN-HAVEYGKLVRLSS--FPALAHX 143
           RR+  ++ DL+L  R FN++ + L  Q++ S++I+      EY  L  L+        H 
Sbjct: 80  RRNSMAKVDLELWMRGFNINPSDLNYQYESSKYIQEKLSGKEYRILRDLNEEVVKQRTHI 139

Query: 144 XXXXXXXXXXXXXQQ--------SEINVLLPPSNPLEKL-IPSWLPNFPPDHTYKFTPEF 194
                        +Q           N+L+ P+NP + + I SWLP+FPPDHTYKFTP+F
Sbjct: 140 MESSTSDDNYDLTKQFRNISDATDSSNILIKPTNPFKGINISSWLPSFPPDHTYKFTPQF 199

Query: 195 NHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSH----LSSASHTSPP--------PVLD 242
           N+PITD                 ALLN  K +S+     S A  T PP        P+ D
Sbjct: 200 NNPITDEKLIKQKLVEEGTKSEKALLNFLKNISNAKKGTSIAPMTIPPSPSLSNEGPITD 259

Query: 243 ------------------------DAD---ATEQQLEIWGNALQ----ER----KPTIT- 266
                                   D D   A E+ L I+G   Q    ER    KP I  
Sbjct: 260 TDEEEKQAKNEKEKEQEDTVIIPKDIDMNLANEETLAIYGTKSQSYEIERDSSSKPNIIS 319

Query: 267 ------------ATSLNESNIEQYAKYRVELARERVAKFELNQLKRTKNPFLKLSETLYF 314
                       ++S  + ++ +Y+ +RVEL R++V  FE  +L+  KNPFLKLS+ +  
Sbjct: 320 IHDEKIVNFFGHSSSDKKFDVNKYSHHRVELVRKKVEAFENKKLRLEKNPFLKLSKLVCL 379

Query: 315 SE-----------------------------GPHQSHKTIQSAIDLQFRKSMTLFMHNLP 345
            +                              P +    I + I    ++S    ++N P
Sbjct: 380 EKEDYYDYDNDEDDLEERKNYNNNNDNDNRLSPIRKRAQINNEIISNLKRSFYSILNNYP 439

Query: 346 KVQKLKKERIRMA---KEERAKSLRRRQEELISERKKREQ 382
           K++K KK+R+++A   +++R + LR+ QEE   ERK +EQ
Sbjct: 440 KLKKAKKQRVKLAIEKRDQRLQELRKIQEE---ERKVKEQ 476

>ABL128W Chr2 (155096..156520) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML114C (TAF65)
          Length = 474

 Score =  156 bits (394), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 106/368 (28%), Positives = 176/368 (47%), Gaps = 22/368 (5%)

Query: 6   SGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSL--NICISNFALDE 63
           +G++ G     +QL++LPDLTE++      P+ ++L + V   L ++  ++ I+    + 
Sbjct: 13  AGAKEG-----IQLKKLPDLTEVTK---SNPMQKLLAQAVGLHLKTMRSDVGITQLGFEN 64

Query: 64  LVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSN 123
           LV  V +Q+D M + LH    +QRR+E S  D++L      V+  SLY+++  S++++  
Sbjct: 65  LVQFVELQLDDMLQILHRFANVQRRNEVSLKDVRLFLHGCGVEEESLYEEYVRSQYVRQQ 124

Query: 124 HAVEYGKLVRLSSFPALAHXXXXXXXXXXXXXX------QQSEINVLLPPSNPLEKLIPS 177
           HA    + +   S   + H                    +  +I  L+PP+N     +P 
Sbjct: 125 HAGAV-RSIEEQSASLMGHWHQPMSEEELLSSSHAEFFFKDVDILNLVPPTNNNNHYVPK 183

Query: 178 WLPNFPPDHTYKFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSP 237
           WLP FPPDHTYKFT  +N PITD                 ALL++    +    A     
Sbjct: 184 WLPEFPPDHTYKFTSIYNQPITDERQMKRKLFEESKLSEKALLHMLGTATKKPRADDAQL 243

Query: 238 PPVLDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVELARERVAKFELNQ 297
           P ++  +D  ++ L I+G   +   P    T     NIE YA+ RVELAR RV +FE  +
Sbjct: 244 PQII--SDGQQENLLIYGPERRRLAPEPAPT--RGFNIEDYARCRVELARRRVEEFEQQK 299

Query: 298 LKRTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRM 357
           L+  KNPF++ +           S K I+    +   +S    +H +P++++ K   +  
Sbjct: 300 LQVQKNPFIRAAAACSPYATTRLSRKAIEREFGVLLHRSYIGVLHAIPRLRRTKARELAA 359

Query: 358 AKE-ERAK 364
           A E ERA+
Sbjct: 360 AYERERAR 367

>KLTH0C03916g Chr3 complement(342430..344142) [1713 bp, 570 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 570

 Score =  155 bits (391), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 112/362 (30%), Positives = 180/362 (49%), Gaps = 21/362 (5%)

Query: 17  VQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVAVQMDG 74
           VQLR LP+L EI    +D P+ ++L+K V  QL ++N  + IS FA + L+ LV   +  
Sbjct: 19  VQLRHLPNLEEIPRTALDDPLRKLLEKAVAIQLKAVNSNVSISQFAFENLIILVEQMLSN 78

Query: 75  MFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRL 134
           M  +LH +  +QRR   S+ DL L+   +N+  A L  + + S++++S H +E  + VR 
Sbjct: 79  MLVDLHKMVNIQRRHCISKKDLLLIIDGYNLTCADLMVELERSQYVRS-HNLERVRKVRE 137

Query: 135 SSFPALAHXXXXXXXXXXXXXX------QQSEINVLLPPSNPLEKLIPSWLPNFPPDHTY 188
            S    A                     Q  EI  L+PP+    K +P WLP FPPDHTY
Sbjct: 138 ESEVVEAKEKTPLSEKELLESKHLEFFIQDKEILTLVPPTPKNTKYVPRWLPEFPPDHTY 197

Query: 189 KFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPVLDDADATE 248
           +FT +FN PITD                 AL++L+K LSH  S S  +    +      +
Sbjct: 198 RFTSQFNRPITDERLMKRKLAEEADLSEKALIHLSK-LSHEESPSEGADSDEIFKESQQD 256

Query: 249 QQLEIWGNALQERKPTITATS-------LNESNIEQYAKYRVELARERVAKFELNQLKRT 301
            QL I+G A + +   I   S           N+E+YA+ RVE+AR +V ++E +QL   
Sbjct: 257 TQL-IFGPAKKTKIAAINGASDLLRTLPQQNYNVEEYARNRVEIARRKVEEYERHQLLLQ 315

Query: 302 KNPFLKLSETLY-FSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKE 360
           K  F+K +  L  F++   ++ K ++  +     +S    + + P +++ +K  + +A+E
Sbjct: 316 KGAFIKAAHLLSPFAK--KRNCKQVEKEVRTLLHRSYIGLLKSAPLLREQRKREVELAEE 373

Query: 361 ER 362
            R
Sbjct: 374 NR 375

>Kwal_27.10272 s27 complement(271405..273060) [1656 bp, 551 aa] {ON}
           YML114C (TAF8) - TAF65, subunit of transcription factor
           TFIID [contig 37] FULL
          Length = 551

 Score =  153 bits (386), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 117/396 (29%), Positives = 193/396 (48%), Gaps = 26/396 (6%)

Query: 16  IVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNI--CISNFALDELVNLVAVQMD 73
           +VQL+ LP L EI   ++D P+ ++L+K +  QL S+N    IS  A + L+ LV   + 
Sbjct: 18  VVQLKNLPTLHEIPKADMDDPLKKLLEKAIAIQLKSINADASISQLAFENLIILVEEMLS 77

Query: 74  GMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVR 133
            M  +LH +  +QRR   S+ DL L+   +N+ ++ L  + + S +++S H  +  K+  
Sbjct: 78  NMLMDLHKMANIQRRHCISKKDLLLIIEGYNLSSSDLMLELERSRYVRSRHLEQIKKVEE 137

Query: 134 LSSF-PALAHXXXXXXXXXXXXXXQ----QSEINVLLPPSNPLEKLIPSWLPNFPPDHTY 188
            S +     H              +      ++  L+PPS    K +P WLP+FPPDHTY
Sbjct: 138 DSKYVEKQEHTPLTQNELLSSTHPEFFVLDKDVLTLVPPSVKDTKHVPRWLPDFPPDHTY 197

Query: 189 KFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPVLDDADATE 248
           +FT ++N PITD                 AL++L+  LSH  ++S     P+  D    E
Sbjct: 198 RFTAQYNKPITDERLMKRKLAEEANLSEKALIHLS-MLSHEEASSG----PIDSDTIYEE 252

Query: 249 QQLE---IWGNALQERKPTITAT-----SLNESN--IEQYAKYRVELARERVAKFELNQL 298
            Q E   ++G   +++   I        +L + N  +E+YA+ RVE+AR RV ++E +QL
Sbjct: 253 AQQETQLLFGPVKKKKTAAINEVNDLLRTLPQQNFSVEEYARNRVEIARRRVNEYERHQL 312

Query: 299 KRTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKERIRMA 358
           +  K  F+K +  L        S K ++  I     +S    + + P +++ +K  I +A
Sbjct: 313 QLQKGAFIKAAHLLSPFSKKRTSCKQVEKEIRTLLHRSRIGLLKSAPSLKERRKREIALA 372

Query: 359 KEERAKSLRRRQEELISERKKREQDEGHDLELLLNN 394
           +E R    R R E+L  ER+ R +       L LNN
Sbjct: 373 EENR----RLRDEKLRKEREARSKSSNEFDVLDLNN 404

>TPHA0I00230 Chr9 (41435..43279) [1845 bp, 614 aa] {ON} Anc_8.838
           YML114C
          Length = 614

 Score =  152 bits (383), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 118/402 (29%), Positives = 187/402 (46%), Gaps = 44/402 (10%)

Query: 13  QHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVAV 70
           Q   VQL +LP LTE  + +   P+  IL K +  QL  +N    I+ FA   L +LV  
Sbjct: 42  QKKYVQLTKLPTLTEFKYEDTKGPMEVILAKAIALQLKLMNRDTTITKFAFTHLTSLVDE 101

Query: 71  QMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGK 130
           Q+  M   +  L  LQRR E ++ D+ L  R FN+  + L    Q SE+IK  +  E   
Sbjct: 102 QLSDMVNQMEKLAALQRRKEVAKKDIDLWLRGFNLQPSDLTITHQQSEYIKEKYGGEVTL 161

Query: 131 LVRLSSFPALAHXXXXXXXXXXXXXXQQSEINVL--LPPSNPLEKLIPSWLPNFPPDHTY 188
           L RL++     +                S +  L  +P +N LE +IP WLP+FPPD+TY
Sbjct: 162 LNRLATD---TNEVLTVFKKTDKTLKDDSTLETLKLVPITNTLENIIPDWLPSFPPDYTY 218

Query: 189 KFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPVL------- 241
           KFTP+FN  ITD                 ALL       HL  +   +   +L       
Sbjct: 219 KFTPQFNKHITDATVIRKKVAAEGKKSEKALL-------HLLESEKITTSKLLNLDKFDS 271

Query: 242 DDADATEQQLEIW--GNALQERKPTI-------------TATSLNESNIEQYAKYRVELA 286
           DD D  + +++    G +   +K T                ++ N+ +IE+Y   R+ + 
Sbjct: 272 DDMDTAKLEMDALYSGGSCDRKKRTAFFEDEEDRMVDEHGNSTSNKFDIEKYVHKRINIV 331

Query: 287 RERVAKFELNQLKRTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPK 346
           R +V ++E  QL+   +PFLK++  L        S + I + I+   ++S    ++++P 
Sbjct: 332 RNKVKQYEDKQLRLQNDPFLKMTALLSEQTDKKVSREVINTNIENVLKRSFLQLINSIPT 391

Query: 347 VQKLKK---ERIRMAKEER-AKSLRRRQEELISERKKREQDE 384
           + + KK   ER  + K+ R  + L+RR+E+L    KK EQ++
Sbjct: 392 LNQNKKDTRERAMVEKKRRHDEWLKRREEKL----KKLEQEK 429

>Ecym_4609 Chr4 (1186861..1188423) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ABL128W
          Length = 520

 Score =  144 bits (364), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 103/393 (26%), Positives = 183/393 (46%), Gaps = 34/393 (8%)

Query: 7   GSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSL--NICISNFALDEL 64
           GS  G +   +QL++LP L E++      P+  +L ++V  QL ++  +  I+    + +
Sbjct: 10  GSTEGAKE-FIQLKKLPGLQEVAK---HNPMQILLSQSVALQLKTMKSDFSITELGFNNM 65

Query: 65  VNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNH 124
           +  + +QM+ MF+ LH    +QRR+E S  DLKL  +   ++  SLY +F+ S +IK  +
Sbjct: 66  MQFIEMQMNDMFQILHRFANIQRRNEISIKDLKLFLKGTGIEVQSLYDEFEKSRYIKKTY 125

Query: 125 AVEYGKLVRLS-----SFPALAHXXXXXXXXXXXXXXQQSEINVLLPPSNPLEKLIPSWL 179
             E+  + R S      +                   +  +I  L+PP+N     +P+WL
Sbjct: 126 EAEFKNIERQSLDLVEKWQKPLRDEELLSSNHAEFFFKDVDILNLVPPTNINNSYVPTWL 185

Query: 180 PNFPPDHTYKFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNL-----NKRL-------- 226
           P FPPDHTYKFT  +N PI+D                 ALLN+      K L        
Sbjct: 186 PEFPPDHTYKFTAIYNKPISDERQMKRMLFEEGKLSEKALLNMLGSAQAKMLKVEDEETI 245

Query: 227 --SHLSSASHTSPPPVLDDADATEQQLEIWGNALQERKPTITATSLNESNIEQYAKYRVE 284
             ++  S   T     ++      +   + GN+       + ++     NI++YA+ R+ 
Sbjct: 246 AQTYKESQEETQLIYGVEKQRPRRENAYVGGNSTNNDDLPLNSSHSKGFNIQEYARSRIG 305

Query: 285 LARERVAKFELNQLKRTKNPFLKLSETLY-FSEGPHQSHKTIQSAIDLQFRKSMTLFMHN 343
           LAR +V +FE ++L+  KNPF++ S     +      + K  +   ++  R+S    + +
Sbjct: 306 LARRKVEEFENHKLQAQKNPFIRASSICSPYGNAQKTTRKAAEREFNILLRRSYVGVLKS 365

Query: 344 LPKVQKLKK-------ERIRMAKEERAKSLRRR 369
           +PK+++LK        ER R+ ++ER   L ++
Sbjct: 366 IPKLRQLKANEMAAAIERERIKQKEREMELEKK 398

>SAKL0D01518g Chr4 complement(122448..124172) [1725 bp, 574 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 574

 Score =  144 bits (364), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 117/400 (29%), Positives = 191/400 (47%), Gaps = 33/400 (8%)

Query: 17  VQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVAVQMDG 74
           ++L++LP L    H  ++ P+ +IL + V  +L  +N  + +S FA + LV LV+  +  
Sbjct: 19  IRLKKLPTLHAAPHDSLEQPMHKILSQAVAIRLKPMNKDVAMSQFAFENLVQLVSENLSF 78

Query: 75  MFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRL 134
           M   LH    +QRR E S+ DL LL + +++  + L ++ + S++I SNH  +  K+ + 
Sbjct: 79  MLTTLHRFVDIQRRREISKKDLLLLLKGYDLSNSELMRELESSQYIVSNHPEKVNKIAQK 138

Query: 135 SSFPALAHXXXXXXXXXXXXXXQQSE-------INVLLPPSNPLEKLIPSWLPNFPPDHT 187
           S    L                  SE       I  L+PP+N   + IP WLP FPPDHT
Sbjct: 139 SK--ELKSKLLKPMTEKELLNSAHSEFFFKDMDILDLVPPTNKNNQYIPKWLPEFPPDHT 196

Query: 188 YKFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPVLDDADAT 247
           Y+FT ++N P+ D                 AL+NL K   H S+         ++     
Sbjct: 197 YRFTSQYNKPVVDERQLRRKLVEEGKQSERALVNLLKH--HDSTNQDLGNNERVEKRSLY 254

Query: 248 EQQLE----IWGNALQERKPTITATS---------LNESNIEQYAKYRVELARERVAKFE 294
           E+  E    I+G    ERK + T  +         L   ++E+YA+ RVE+AR +V ++E
Sbjct: 255 EETQEETFLIFG---PERKKSHTTENSHELLRTLPLKNFSVEEYARNRVEIARRKVLEYE 311

Query: 295 LNQLKRTKNPFLKLSETLYFSEGPHQSHKTIQSAIDLQFRKSMTLFMHNLPKVQKLKKER 354
             QL+  KNPF+K +      +    S K I   +    ++S    + ++PK+ ++K   
Sbjct: 312 QYQLRLQKNPFIKAANLCSPLKKSTMSRKAIDKELKSMLQRSYIGLLRSVPKLNEVKARE 371

Query: 355 IRMAKEERAKSLRRRQEELISERKKREQDEGHDLELLLNN 394
             +A E R + L    E+L  ER+++ +  G D  L LNN
Sbjct: 372 RELANERRREML----EKLNEERQRQAEAGGGDEVLDLNN 407

>KLLA0D01617g Chr4 complement(143940..145628) [1689 bp, 562 aa] {ON}
           weakly similar to uniprot|Q03750 Saccharomyces
           cerevisiae YML114C TAF8 TFIID subunit (65 kDa) involved
           in RNA polymerase II transcription initiation
          Length = 562

 Score =  122 bits (306), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 110/408 (26%), Positives = 180/408 (44%), Gaps = 47/408 (11%)

Query: 12  TQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVA 69
           T    V+L +LP+L E+ H     P+  +  + VL QL +LN  + IS  A D+L  +  
Sbjct: 16  TDQRRVRLDKLPNLNEVPHAN---PMERLFAQAVLLQLKTLNKNVVISQLAFDDLCYVSL 72

Query: 70  VQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYG 129
           +Q+D + ++L  +T +QRR++ S+ DL L F+   +D   L  Q ++S F+      E  
Sbjct: 73  LQLDDLLQSLKKITQVQRRTKISKLDLNLYFKGIGMDLKDLNGQVEISNFVHGKFKDEAN 132

Query: 130 KLVRL-----SSFPALAHXXXXXXXXXXXXXXQQSEINVLLPPSNPLEKLIPSWLPNFPP 184
            L          F                   Q  +I  LLP SN   K +PSWLP  PP
Sbjct: 133 ALNETVLKVKQQFMKELEEKELLSSKHSEFFVQDVDILNLLPSSNKSNKYVPSWLPELPP 192

Query: 185 DHTYKFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPVLD-D 243
           DHTYKFT  +  PITD                 ALLN+      LS   +  P   L+ D
Sbjct: 193 DHTYKFTSLYKRPITDERLMKKKLLEEGRLSEKALLNM------LSQVVNQDPLVALNKD 246

Query: 244 ADAT-----------EQQLEI---------------WG-NALQERKPTITATSLNESNIE 276
           +D +           E QLE                WG   +     +   + +   N+ 
Sbjct: 247 SDQSANNAALSEHIKESQLETDLIFDPHKTIPTDKEWGTTTVLHGIESFNLSPVKNFNVL 306

Query: 277 QYAKYRVELARERVAKFELNQLKRTKNPFLKLSETLY-FSEGPHQSHKTIQSAIDLQFRK 335
           +Y K R  + + R  + E     + +NPF++ +     + +G  +S K++++ +    R+
Sbjct: 307 EYCKKRDAIVKRRAERAENQVSNKRRNPFIRGAMICSPYGQGSTKSRKSVENQLKTMLRR 366

Query: 336 SMTLFMHNLPKVQKLKKERIRMAKEERAKSLRRRQEELISERKKREQD 383
           S    + ++P+V+++ +ER R   EER + L + Q  +  E+K  EQ+
Sbjct: 367 SYLGLIDSIPRVKEV-RERARKEAEERER-LLQEQRRIEKEKKMAEQE 412

>TBLA0D03250 Chr4 (807946..809997) [2052 bp, 683 aa] {ON} Anc_8.838
           YML114C
          Length = 683

 Score =  120 bits (300), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 123/481 (25%), Positives = 193/481 (40%), Gaps = 120/481 (24%)

Query: 19  LRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLN--ICISNFALDELVNLVAVQMDGMF 76
           L+ LPDL +  +    + + ++L K++  QL  +N    IS  A + L+ LV +Q++ M 
Sbjct: 42  LKNLPDLIQSPNRLESSCIGQLLAKSIALQLKPMNDNTSISTVAFNRLLTLVDLQLNDMI 101

Query: 77  RNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRLSS 136
             L  L++ QRR   +  DL L  R FN++ + L    + S FIKS    +Y  L  L  
Sbjct: 102 YQLARLSITQRRLTIASNDLSLWLRSFNLNPSDLTLYLEESNFIKSKFNKDYNLLYEL-- 159

Query: 137 FPALAHXXXXXXXXXXXXXXQQSEI----------NVLLPPSNPLEKLIPSWLPNFPPDH 186
              L                  S++          + ++PPSN + + +P WLP+ PPDH
Sbjct: 160 ---LRDYNTETNHNFKNPNYSTSDLLNNKSSESSSSRIVPPSNTILRSMPEWLPSLPPDH 216

Query: 187 TYKFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRLSHLSSASHTSPPPVLDDADA 246
           TYKFTP +N PITD                 AL+ L +  +  +S  ++ P P  D  + 
Sbjct: 217 TYKFTPLYNEPITDETVMKKILVNEGKLAESALIKLLE--ASTTSEINSLPTPETDREND 274

Query: 247 TEQQLE---------------------------------------IWGNALQERK----- 262
            EQ +                                        I+G+ALQ RK     
Sbjct: 275 LEQNINIDTNTNGNSMTLKSVSENEKTNTNERLNDELLAQDETKAIYGSALQVRKIKKRF 334

Query: 263 ----PTITATSLNES-------NIEQYAKYRVELARERVAKFELNQLKRTKNPFLKLSET 311
                    T L+E        N+E+YA+ +V+  RE+V  +E  QL+  KNPF K S+ 
Sbjct: 335 ELMIDPKAETQLSEEFVYPSTFNVEEYARKQVQKIREQVLFYEEKQLQAQKNPFWKYSKM 394

Query: 312 LYFSEGPHQ---------------------------------------SHKTIQSAIDLQ 332
           +    GP Q                                       S K I   I   
Sbjct: 395 IV---GPSQFHHGPHHHHHHHHHHHRRYSNSSTSSVSSSPSPGLFGGVSKKQINHDIQQM 451

Query: 333 FRKSMTLFMHNLPKVQKLKKERIRMAKEERAKS----LRRRQEELISERKKREQDEGHDL 388
           F +S+   +++LP + K K     +A+ ER K     L+++Q+EL  ++      + HDL
Sbjct: 452 FNRSLNNLINSLPNLAKEKASAREIAENEREKKVQEMLKKKQKELNEKQSSAGALDLHDL 511

Query: 389 E 389
           +
Sbjct: 512 Q 512

>KAFR0A02820 Chr1 (584984..586345) [1362 bp, 453 aa] {ON} Anc_8.838
           YML114C
          Length = 453

 Score =  117 bits (292), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 99/345 (28%), Positives = 167/345 (48%), Gaps = 40/345 (11%)

Query: 40  ILKKTVLFQLNSLNI--CISNFALDELVNLVAVQMDGMFRNLHNLTLLQRR-SEASQADL 96
           +L K+V  +L  +N+   + N A D L+ L+ VQ++ + + L  L+LLQRR S A+++D+
Sbjct: 29  LLVKSVAMRLKPVNLHTQLPNSAFDYLIYLMDVQLNDLIKQLGRLSLLQRRNSNATKSDI 88

Query: 97  KLLFREFNVDAASLYQQFQVSEFIKSNHAVEYGKLVRLSSFPALAHXXXXXXXXXXXXXX 156
            LL + FN+  + L  + ++S  IK  ++ +  KL    S  ++ +              
Sbjct: 89  LLLLKGFNLSESELNTELEISNHIKRLYSEDEKKL----SEDSIHYNQHTDFVGPVETSS 144

Query: 157 QQSEINVLLPPSNPLEKLIPSWLPNFPPDHTYKFTPEFNHPITDLXXXXXXXXXXXXXXX 216
            Q     LL P+NPL+  IPSW P+ PPDHTYKFTP++N+ I D                
Sbjct: 145 FQ-----LLNPTNPLKDAIPSWFPSLPPDHTYKFTPKYNNFINDPKIIKQKRFDESKTVK 199

Query: 217 XALLNLNKRLSHLSSASHTSPPPVLDDADATEQQLEIWGNALQERKPT--ITATSLN--- 271
            AL NL  ++      +        D+  A  +   ++G  ++E+  T      SLN   
Sbjct: 200 TALFNLINKIESNEERNDLH----YDETLAKLESQALFG-TVEEKMNTNKKVYKSLNSII 254

Query: 272 ----ESNIEQYAKYRVELARERVAKFELNQLKRTKNPFLKLSETLYFSEGPHQSHKTIQS 327
               + +IE+Y+  RV +AR +V+KFE   L    NPF+ L                 Q+
Sbjct: 255 VPITKFDIEEYSHKRVNIARNKVSKFENKMLALKYNPFINLIND--------------QT 300

Query: 328 AIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKEERAKSLRRRQEE 372
            +     +S  L ++++P++   KK+ IR A+ ER + + R +E+
Sbjct: 301 DVKSYLNRSFQLMINSIPELTLEKKKAIRQAEIERDERINRLRED 345

>KNAG0G03410 Chr7 (731420..733000) [1581 bp, 526 aa] {ON} Anc_8.838
           YML114C
          Length = 526

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 84/325 (25%), Positives = 139/325 (42%), Gaps = 33/325 (10%)

Query: 6   SGSESGTQHTIVQLRRLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA----- 60
           S  +SG +  +V     P   E+ H   DA V ++L  +V FQ+++              
Sbjct: 6   SDEKSGVKGALVGDVSAP--VELPHEPWDARVDQMLANSVAFQMSAGLARGGGGGGVGMA 63

Query: 61  ---LDELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVS 117
                 L+ LV  Q+ GM   LH +  +QRR  A+  D+ LL + F +    + +Q  +S
Sbjct: 64  GQAFQLLLQLVEEQLSGMVTELHRIATVQRRQHATHDDVALLLQGFQLTPEDIEEQMYLS 123

Query: 118 EFIKSNH-AVEYGKLVRL-SSFPALAHXXXXXXXXXXXXXXQQSEINVLLPPSNPLEKLI 175
           + I  N   V   + V+L  +  +                   S+++  L    P+ + I
Sbjct: 124 KKIGYNRMQVPREQTVQLQDATGSYDRFKLVENQQLIASGLSGSDMSQEL----PIAEKI 179

Query: 176 PSWLPNFPPDHTYKFTPEFNHPITDLXXXXXXXXXXXXXXXXALLNLNKRL-----SHLS 230
           P+WLP  PP+HTYKFT E+N  + D                 +L NL +       + + 
Sbjct: 180 PAWLPKLPPNHTYKFTTEYNKLLNDEKVLKEKIIKESMEIEVSLSNLVRNCDRDADTKVD 239

Query: 231 SASHTSPPPVLDDADATEQQLEIWGNALQE--------RKPTITATSLNES-NIEQYAKY 281
             +  +PP  L   D  ++ + ++G  L+E        R    T   L +S +++ Y+  
Sbjct: 240 ERARETPPEELKRID--DEIVALYG-PLEEIAERHEGPRTKRRTPLYLKKSFDVQAYSLG 296

Query: 282 RVELARERVAKFELNQLKRTKNPFL 306
           RV+LAR  V +FE     R +NPFL
Sbjct: 297 RVKLARNAVQRFEWETKYRPRNPFL 321

>CAGL0B02299g Chr2 (217341..219272) [1932 bp, 643 aa] {ON} some
           similarities with uniprot|Q03750 Saccharomyces
           cerevisiae YML114c TAF65 TBP Associated Factor
          Length = 643

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 68/123 (55%), Gaps = 3/123 (2%)

Query: 5   MSGSESGTQHTIVQLRRLPDLTEI-SHLEIDAPVVEILKKTVLFQLNSLN--ICISNFAL 61
           M   ES      VQ  R  D+ EI S   +D  + E+LK+ V  QL +++  + ++  A+
Sbjct: 1   MPAIESSVVRGGVQENRDVDIKEINSSNRMDYQMGELLKRAVGVQLQTIDKDVTVTRMAM 60

Query: 62  DELVNLVAVQMDGMFRNLHNLTLLQRRSEASQADLKLLFREFNVDAASLYQQFQVSEFIK 121
           D+LV     Q++ +   LH ++LLQRR   + +DL++  R +N+  + LY   + S+FI+
Sbjct: 61  DQLVLFAEDQLNALVDGLHRISLLQRRQSIAVSDLEIWMRGYNLLPSDLYMTAEESKFIR 120

Query: 122 SNH 124
            N+
Sbjct: 121 ENY 123

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 59/110 (53%), Gaps = 12/110 (10%)

Query: 268 TSLNESNIEQYAKYRVELARERVAKFELNQLKRTKNPFLKLSETLYFSEGPHQSHKTIQS 327
           + L + ++E YA+ R+E+AR +V  FE  QL    NP L+L++  Y+           Q 
Sbjct: 393 SKLKDFDVEAYARQRIEIARRKVVDFEYEQLYLKYNPLLRLAKMKYYDAEESDFETEYQK 452

Query: 328 AIDLQFRKSMTLFMHNLPKVQKLKKERIRMAKEERAKSLRRRQEELISER 377
            I    +++M  F  N+P +    KE+ +M ++E  K    R++ELI++R
Sbjct: 453 CI----KRTMDRFKRNIPII----KEKRKMVRKESIK----RKDELIAKR 490

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 17/19 (89%)

Query: 176 PSWLPNFPPDHTYKFTPEF 194
           P WLP+FPPDHTYK+TP +
Sbjct: 198 PGWLPDFPPDHTYKYTPSY 216

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,687,481
Number of extensions: 1903986
Number of successful extensions: 11503
Number of sequences better than 10.0: 162
Number of HSP's gapped: 11710
Number of HSP's successfully gapped: 179
Length of query: 510
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 396
Effective length of database: 40,409,475
Effective search space: 16002152100
Effective search space used: 16002152100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)