Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.198.842ON53652025770.0
YML115C (VAN1)8.842ON53552023460.0
Suva_13.288.842ON53052023090.0
Skud_13.268.842ON53952021970.0
KNAG0G034208.842ON51141617970.0
KAFR0A028308.842ON50739017600.0
NDAI0E002908.842ON52252617560.0
ZYRO0G14234g8.842ON50939317500.0
NCAS0B003008.842ON52339317500.0
TDEL0B005608.842ON50939017220.0
SAKL0D01430g8.842ON44741416960.0
Kpol_541.158.842ON49839016830.0
TBLA0B032708.842ON52038916540.0
KLTH0C03828g8.842ON40439116270.0
CAGL0B02321g8.842ON51239015940.0
KLLA0D01529g8.842ON50139015600.0
Ecym_46138.842ON52447415400.0
TPHA0C047808.842ON52539815310.0
ABL124W8.842ON48539315110.0
Kwal_27.102468.842ON33932514060.0
Ecym_35731.479ON44734910201e-133
SAKL0D11792g1.479ON48334910031e-130
KLTH0C03432g1.479ON4893509991e-130
KNAG0I003001.479ON4573519951e-130
NDAI0G003401.479ON5043499981e-129
KAFR0I027701.479ON4553499931e-129
NCAS0G041101.479ON4943499951e-129
Kwal_27.101571.479ON4763499901e-129
TBLA0B021701.479ON5723499991e-129
CAGL0L01331g1.479ON4473499861e-128
YEL036C (ANP1)1.479ON5003509901e-128
Smik_5.571.479ON4913499841e-127
AFR357W1.479ON4343509781e-127
Skud_5.541.479ON4913499831e-127
Suva_5.331.479ON4953499821e-127
NDAI0B012501.479ON4463509751e-127
Kpol_370.51.479ON6453499921e-127
KLLA0E22155g1.479ON4503499671e-126
TPHA0O004301.479ON5483509751e-125
TDEL0C026001.479ON4623509511e-123
ZYRO0F05170g1.479ON6083519531e-121
KLLA0E12849g8.500ON3923525214e-60
TPHA0L013708.500ON3923495144e-59
KLTH0E11616g8.500ON3943474944e-56
YPL050C (MNN9)8.500ON3953524911e-55
CAGL0L12804g8.500ON3933844864e-55
ZYRO0F08492g8.500ON3963524865e-55
Skud_16.2328.500ON3953494849e-55
KNAG0A021508.500ON3963524841e-54
Suva_16.2658.500ON3953494822e-54
Smik_16.1868.500ON3953494803e-54
NCAS0C023308.500ON3933994795e-54
TBLA0H033408.500ON3933524761e-53
TDEL0B013708.500ON3963494762e-53
SAKL0H11110g8.500ON3933494742e-53
NDAI0E030208.500ON3963464691e-52
KAFR0H013908.500ON3983464631e-51
Kpol_1031.788.500ON3923494621e-51
Ecym_25508.500ON3903484462e-49
AGL259C8.500ON3893484463e-49
Kwal_27.118648.500ON4533464451e-48
NCAS0B024408.500ON4003434113e-44
NDAI0C052508.500ON4023483965e-42
KNAG0A039908.500ON3571752412e-21
SAKL0H20438gsingletonON5652101705e-12
ZYRO0G12540g3.295ON95063780.72
YCR019W (MAK32)1.440ON363136741.7
AGL343C5.8ON307161731.8
KLTH0G10626g2.296ON30359731.9
Kpol_1003.452.296ON28059713.3
Kwal_55.206524.26ON69467714.4
Ecym_26753.295ON98688706.5
TPHA0C034702.296ON26457688.4
TBLA0B054602.503ON27485679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.19
         (536 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   997   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   908   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   894   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   850   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   696   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   682   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   681   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   678   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   678   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   667   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   657   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   652   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   641   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   631   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   618   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   605   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   597   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   594   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   586   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   546   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   397   e-133
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   390   e-130
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   389   e-130
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   387   e-130
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   389   e-129
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   387   e-129
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    387   e-129
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   385   e-129
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   389   e-129
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   384   e-128
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   385   e-128
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   383   e-127
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   381   e-127
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   383   e-127
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   382   e-127
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   380   e-127
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   386   e-127
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   377   e-126
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   380   e-125
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   370   e-123
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   371   e-121
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   205   4e-60
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   202   4e-59
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   194   4e-56
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   193   1e-55
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   191   4e-55
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   191   5e-55
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   191   9e-55
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   191   1e-54
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   190   2e-54
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   189   3e-54
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   189   5e-54
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   187   1e-53
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   187   2e-53
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   187   2e-53
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   185   1e-52
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   182   1e-51
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   182   1e-51
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   176   2e-49
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   176   3e-49
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   176   1e-48
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   162   3e-44
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   157   5e-42
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    97   2e-21
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    70   5e-12
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    35   0.72 
YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Prote...    33   1.7  
AGL343C Chr7 complement(72374..73297) [924 bp, 307 aa] {ON} Synt...    33   1.8  
KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar...    33   1.9  
Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON} (10663...    32   3.3  
Kwal_55.20652 s55 complement(505826..507910) [2085 bp, 694 aa] {...    32   4.4  
Ecym_2675 Chr2 complement(1304086..1307046) [2961 bp, 986 aa] {O...    32   6.5  
TPHA0C03470 Chr3 (759402..760196) [795 bp, 264 aa] {ON} Anc_2.29...    31   8.4  
TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {...    30   9.7  

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  997 bits (2577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/520 (93%), Positives = 486/520 (93%)

Query: 1   MGLFLNLRSNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSKSSKF 60
           MGLFLNLRSNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSKSSKF
Sbjct: 1   MGLFLNLRSNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSKSSKF 60

Query: 61  QMTVNAXXXXXXXXXXXXXXXXFLTGMSIGVPIQNGRPLLGSSKSSDNYKTIXXXXXXXX 120
           QMTVNA                FLTGMSIGVPIQNGRPLLGSSKSSDNYKTI        
Sbjct: 61  QMTVNAISLIIITILSLYLSISFLTGMSIGVPIQNGRPLLGSSKSSDNYKTIDLEDEEYY 120

Query: 121 XXXXXXXXXXVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRF 180
                     VVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRF
Sbjct: 121 DYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRF 180

Query: 181 EGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLD 240
           EGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLD
Sbjct: 181 EGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLD 240

Query: 241 ALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENY 300
           ALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENY
Sbjct: 241 ALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENY 300

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 361 DADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLD 420
           DADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLD
Sbjct: 361 DADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLD 420

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFT 480

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/520 (83%), Positives = 460/520 (88%)

Query: 1   MGLFLNLRSNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSKSSKF 60
           MG+F NLRSN K+K++DNGLSLPISRNGSSN+IKDKR+ HNS S K KY YQPRS  SKF
Sbjct: 1   MGMFFNLRSNIKKKAMDNGLSLPISRNGSSNNIKDKRSEHNSNSLKGKYRYQPRSTPSKF 60

Query: 61  QMTVNAXXXXXXXXXXXXXXXXFLTGMSIGVPIQNGRPLLGSSKSSDNYKTIXXXXXXXX 120
           Q+TV+                 FL+GM IGV  QNGR LLGSSKSS+NYKTI        
Sbjct: 61  QLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTIDLEDEEYY 120

Query: 121 XXXXXXXXXXVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRF 180
                     V+SKFD+GV+HYLISQFGS+VLTPKDDEKYQ EL+ML DSTVE+YDLS F
Sbjct: 121 DYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNF 180

Query: 181 EGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLD 240
           EGA NG+ETRDHILLC+PLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSE DTTLD
Sbjct: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240

Query: 241 ALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENY 300
           ALIAYSR LQNGTLSQIFQEIDAVIDSQTKGTDKLYL+YMD+ YINRV QAFSPPFHENY
Sbjct: 241 ALIAYSRHLQNGTLSQIFQEIDAVIDSQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENY 300

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 361 DADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLD 420
           DADVELCPGS+IQDLMSKNYDVIVPNVWRPLPTFL +EQPYDLNSWMES+E L LAKTLD
Sbjct: 361 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLD 420

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNE +DLDGVGGVSILAKAK+FRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFT 480

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/520 (82%), Positives = 459/520 (88%), Gaps = 4/520 (0%)

Query: 1   MGLFLNLRSNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSKSSKF 60
           MGLFLNLRSN K+K++DNGLSLPISRNGSSN+ KDKR+ H SKS K KY+YQPRS SSKF
Sbjct: 1   MGLFLNLRSNIKEKAMDNGLSLPISRNGSSNNSKDKRSHHESKSLKGKYMYQPRSSSSKF 60

Query: 61  QMTVNAXXXXXXXXXXXXXXXXFLTGMSIGVPIQNGRPLLGSSKSSDNYKTIXXXXXXXX 120
           Q+ VN                 FL+ M +G+ IQNG PLLGS    +NYKTI        
Sbjct: 61  QLAVNVISLVIIIVLSLYLMILFLSEMKLGISIQNGNPLLGS----ENYKTIDLEDEEYY 116

Query: 121 XXXXXXXXXXVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRF 180
                     VVSKFD+GV+HYLI+QFGS+VLTP D+EKYQ E+SMLLDSTVEKYDL+ F
Sbjct: 117 NYDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNF 176

Query: 181 EGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLD 240
           EGA NG+ETRDHILLC+PLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSE DTTLD
Sbjct: 177 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 236

Query: 241 ALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENY 300
           ALIAYSRQLQNGTLS+IFQEIDAVIDSQTKGTDKLYL+YMD++YINRV QAFSPPFH+NY
Sbjct: 237 ALIAYSRQLQNGTLSEIFQEIDAVIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 296

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQ+FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 297 DKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 356

Query: 361 DADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLD 420
           DADVELCPGS+IQDLMSKNYDVIVPNVWRPLPTFL SEQPYDLNSWMES E L+LAKTLD
Sbjct: 357 DADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLD 416

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDA GDPNEV+DLDGVGGVSILAKAK+FRNGVQFPAFT
Sbjct: 417 EDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 476

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL
Sbjct: 477 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 516

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/520 (79%), Positives = 456/520 (87%)

Query: 1   MGLFLNLRSNRKQKSVDNGLSLPISRNGSSNDIKDKRTLHNSKSFKDKYVYQPRSKSSKF 60
           MGLFLNLRS+ K+K++DNGL LPISRNGSSN+IK+KR+ H+ KS K KY YQ RS  SK 
Sbjct: 1   MGLFLNLRSSIKEKAMDNGLGLPISRNGSSNNIKNKRSQHDFKSLKGKYRYQSRSTLSKL 60

Query: 61  QMTVNAXXXXXXXXXXXXXXXXFLTGMSIGVPIQNGRPLLGSSKSSDNYKTIXXXXXXXX 120
           Q++V+                  L G+++ V +++G+ LL  S+SS+NYKTI        
Sbjct: 61  QLSVSFISIIIITVLSLYLLISRLAGLNVNVSLRDGKSLLSPSESSENYKTIDLEDEEYY 120

Query: 121 XXXXXXXXXXVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRF 180
                     V+SKFD G +HYLISQFGS+VL P+++E+YQ EL+MLLDSTVEKYDLS F
Sbjct: 121 NYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDF 180

Query: 181 EGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLD 240
           EGA NG+ETRDHILLC+PLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSE DTTLD
Sbjct: 181 EGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLD 240

Query: 241 ALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENY 300
           ALIAYSRQLQNGTLSQIFQ+IDA+IDSQTKGTDKLYL+YMD++YINRV QAFSPPFH+NY
Sbjct: 241 ALIAYSRQLQNGTLSQIFQDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNY 300

Query: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360
           DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR
Sbjct: 301 DKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWR 360

Query: 361 DADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLD 420
           DADVELCPGS+I+DLMSKNYDV+VPNVWRPLPTFL SEQ YDLNSWMES+E LELAKTLD
Sbjct: 361 DADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLD 420

Query: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFT 480
           EDDVIVEGYAEYPTWRVHLAYIRDAEG+PNEV+DLDGVGGVSILAKAK+FRNGVQFPAFT
Sbjct: 421 EDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFT 480

Query: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL
Sbjct: 481 FENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/416 (76%), Positives = 367/416 (88%), Gaps = 3/416 (0%)

Query: 108 NYKTIXXXXXXXXXXXXXXXXXXVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSML 167
           NYKT+                  V+ KFD GV+HYLIS+FG+DVLTPKD E+Y++E+  L
Sbjct: 83  NYKTVNLQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQL 142

Query: 168 LDSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAF 227
            DSTV++YDL+ F G+ +G   RDH+L+CVPLR+A +VLPLMFKHLMNLTYPHELID+AF
Sbjct: 143 FDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAF 202

Query: 228 LVSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVID---SQTKGTDKLYLQYMDQNY 284
           LVSDCS+DD TL+ALIAYSRQLQNGTLSQIF E+DAV D   ++ +  +KLYL+YM Q Y
Sbjct: 203 LVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEY 262

Query: 285 INRVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNW 344
           +N+V +AF+PP+HENYDKPFRSVQIF+K+FGQ+IGQGFSDRHAVKVQGIRRKLMGR+RNW
Sbjct: 263 LNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNW 322

Query: 345 LTANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLN 404
           LTANALKPYHSWVYWRDAD+ELCPGS+IQD+M+K+YDV+VPNVWRPLP FL  EQPYDLN
Sbjct: 323 LTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLN 382

Query: 405 SWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSIL 464
           SWMES E LELA+TLDEDDVIVEGYAEYPTWRVHLAYIRD EGDP+EV+DLDGVGGVSIL
Sbjct: 383 SWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSIL 442

Query: 465 AKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           A+AKLFRNGVQFPAFTFENHAETEAFGKMA+K+G+RVGGLPHYT+WHIYEPSDDDL
Sbjct: 443 ARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDL 498

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/390 (78%), Positives = 350/390 (89%)

Query: 131 VVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETR 190
           V+ KFD G +HYLISQFG+DVLTP+D E Y+ E++ML DST+E YDL  F G  NG E R
Sbjct: 106 VIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENR 165

Query: 191 DHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQ 250
           DH+LLC+PLR+A+ VLPLMF+HLMNLTYPHELIDLAFLVSDCSE+D TLDALI +S+ LQ
Sbjct: 166 DHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQ 225

Query: 251 NGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQIF 310
           NGTLSQ+  EIDA    +T     L+L+YMD  Y+ RV++AFSPPFHE+YDKPFRSVQIF
Sbjct: 226 NGTLSQVLNEIDAFTKEETSTKSNLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRSVQIF 285

Query: 311 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 370
           +K+FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDAD+ELCPGS
Sbjct: 286 EKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIELCPGS 345

Query: 371 IIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGYA 430
           +I+DLM+K+YDVIVPNVWRPLP FL  EQPYDLNSW ES E L+LA+TLDEDDVIVEGYA
Sbjct: 346 VIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIVEGYA 405

Query: 431 EYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAF 490
           EYPTWRVHLAYIRD +G+P+EV+D+DGVGGVSILAKAKLFR+GVQFPAFTFENHAETEAF
Sbjct: 406 EYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAKLFRSGVQFPAFTFENHAETEAF 465

Query: 491 GKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           GKMAKKMGY+VGGLPHYT+WHIYEPSDDDL
Sbjct: 466 GKMAKKMGYKVGGLPHYTLWHIYEPSDDDL 495

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/526 (63%), Positives = 395/526 (75%), Gaps = 40/526 (7%)

Query: 8   RSNRKQKSVDNGLSLPISRNGS--SNDIKDKRTLHNSKSFKDKYVYQPRSKSSKFQMTVN 65
           R++RK    D  L LPISRN S  ++++K +R +             P+ KS+   + + 
Sbjct: 10  RNSRK----DAKLELPISRNNSNVADELKKQRFI-------------PKKKSTAKNVAIG 52

Query: 66  AXXXXXXXXXXXXXXXXFLTGMSIGVPIQNGRPLLG--------SSKSSDNYKTIXXXXX 117
           +                F           N  P LG        ++K S +YKT      
Sbjct: 53  SVVSFIICALIYCGYSYFF----------NTSPRLGKINLYANKNNKVSTSYKTTELSDK 102

Query: 118 XXXXXXXXXXXXXVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDL 177
                        V+ KF+NGV+HYLIS+FG+DVLTPKD E+Y+ EL+MLLD++VEKYDL
Sbjct: 103 EYYNYDFENIEADVLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDL 162

Query: 178 SRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDT 237
            +F+G+ NG E RDH+LLCVPLR+A  VLPLMFKHLMN+TYPHELIDLAFLVSDCS+ D 
Sbjct: 163 KKFDGSRNGAENRDHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDN 222

Query: 238 TLDALIAYSRQLQNGTLSQIFQEIDAVI---DSQTKGTDKLYLQYMDQNYINRVRQAFSP 294
           TL+AL+ YSR LQNGTLSQ+FQ++D         T+GT  L+L+YM+Q Y+  V  AF+ 
Sbjct: 223 TLEALLQYSRHLQNGTLSQVFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNT 282

Query: 295 PFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYH 354
           P HENYDKPFRSVQIF+KDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH
Sbjct: 283 PPHENYDKPFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYH 342

Query: 355 SWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLE 414
           SWVYWRDAD+ELCPG+I++D+M+ +YDV+VPNVWRPLP FL+SEQPYDLNSW+ES E L+
Sbjct: 343 SWVYWRDADIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALK 402

Query: 415 LAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGV 474
           LAKTL EDDVIVEGYAEYPTWRVHLAYIR+A+GDP  V+DLDGVGGVSILAKAKLFR+GV
Sbjct: 403 LAKTLPEDDVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLFRSGV 462

Query: 475 QFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
            FPAFTFENHAETE FGKMAK+MGYRVGGLPHYTIWHIYEPSDDDL
Sbjct: 463 HFPAFTFENHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDL 508

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/393 (79%), Positives = 351/393 (89%), Gaps = 3/393 (0%)

Query: 131 VVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETR 190
           V+ KFD GV+HYLI+QFG+DVLTP+D E ++ E  MLL STVE YDLS F G++NG    
Sbjct: 104 VIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANG 163

Query: 191 DHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQ 250
           +H+LLCVPLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDC+EDD TLDALIAYSRQLQ
Sbjct: 164 EHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQ 223

Query: 251 NGTLSQIFQEIDAVIDSQ---TKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSV 307
           +GTLSQ+F ++D         +KGT+KLYL+YM+ +Y+  V+++FSPPFHENYDKPFRSV
Sbjct: 224 SGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSV 283

Query: 308 QIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 367
           Q+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC
Sbjct: 284 QVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 343

Query: 368 PGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVE 427
           PGS+I+DLMSK+YDV VPNVWRPLP FL+ EQPYDLNSWMES E L LAKTLDEDDVIVE
Sbjct: 344 PGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVE 403

Query: 428 GYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAET 487
           GYAEYPT+RVHLAYIRD   DPNE++DLDGVGGVSILAKA+LFR G+QFPAFTFENHAET
Sbjct: 404 GYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAET 463

Query: 488 EAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           E FGKMAKKMGYRVGGLPHYT+WHIYEPSDDDL
Sbjct: 464 EGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDL 496

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/393 (79%), Positives = 350/393 (89%), Gaps = 3/393 (0%)

Query: 131 VVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETR 190
           VV KFDNGV+HYLISQ+G+DVLTP D+E Y  EL M+LD++VEKYDLS F G+SNG   R
Sbjct: 118 VVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNR 177

Query: 191 DHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQ 250
           DH+LLCVPLR+A  VLPLMFKHLMNLTYPHELIDLAFLVSDCSE D TLDAL+AYS+ LQ
Sbjct: 178 DHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQ 237

Query: 251 NGTLSQIFQEIDAV---IDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSV 307
           NGTLSQ+F E+D        ++KGT  L+L+YM+ +Y+  V  +F    H NYDKPFRS+
Sbjct: 238 NGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSI 297

Query: 308 QIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 367
           Q+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH+WVYWRDAD+ELC
Sbjct: 298 QVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELC 357

Query: 368 PGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVE 427
           PGS+I+DLMSK+YDVIVPNVWRPLP FL+ EQPYDLNSW+ES E L+LAKTLDEDDVIVE
Sbjct: 358 PGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVE 417

Query: 428 GYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAET 487
           GYAEYPTWRVHLAYIRDA GDPNEV+DLDGVGGVSILAKAK+FR+GVQFPAFTFENHAET
Sbjct: 418 GYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAET 477

Query: 488 EAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           EAFGKMA+KMG+RVGGLPHYTIWHIYEPSDDDL
Sbjct: 478 EAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDL 510

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/390 (78%), Positives = 350/390 (89%)

Query: 131 VVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETR 190
           V+ KFDNGV +Y I+QFG + +T ++  K++ E+SMLLDSTVEKYD+ +F G +N  E +
Sbjct: 107 VIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQ 166

Query: 191 DHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQ 250
           +H+LLCVPLR+A +VLPLMFKHLMN+TYPHELIDLAFLVSDCSE D TLDALIAYSRQLQ
Sbjct: 167 EHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQ 226

Query: 251 NGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQIF 310
           NGTLSQ+F E++     + KG + LYLQYMDQ+Y+ RV+ +FSPPFHENYDK FRSVQIF
Sbjct: 227 NGTLSQVFAEVEMSEKERKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQIF 286

Query: 311 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 370
           QKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRDADVELCPGS
Sbjct: 287 QKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCPGS 346

Query: 371 IIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGYA 430
           +IQDLM+K+YDV+VPNVWRPLP FL+ +QPYDLNSW+ES+E L+LAKTLDEDDVIVEGYA
Sbjct: 347 VIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEGYA 406

Query: 431 EYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAF 490
           EYPTWR HLAY RDA GDPNEV++LDGVGGVSILA+A+LFR G+ FPAFTFENHAETEAF
Sbjct: 407 EYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETEAF 466

Query: 491 GKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           GKMAKKMG+RVGGLPHYT+WHIYEPSDDDL
Sbjct: 467 GKMAKKMGFRVGGLPHYTLWHIYEPSDDDL 496

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/414 (73%), Positives = 349/414 (84%), Gaps = 1/414 (0%)

Query: 108 NYKTIXXXXXXXXXXXXXXXXXXVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSML 167
           NYKT                   ++ K+D G EH+LISQ G++VLTP+D+E+Y+ E+ ML
Sbjct: 21  NYKTFSLKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEML 80

Query: 168 LDSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAF 227
           L +TV+ YDLS++EG+ NG E RDH+LLCVPLRNA +VLPLMFKHLMNLTYPHELIDLAF
Sbjct: 81  LGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAF 140

Query: 228 LVSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVI-DSQTKGTDKLYLQYMDQNYIN 286
           LVSDCSEDD TLDALIAYS++LQNGTLS++F E D +   +  KG+  LYL+YM+Q+Y+N
Sbjct: 141 LVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLN 200

Query: 287 RVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT 346
            V  AF PPFH++YDKPFRSVQ+FQKDFGQVIGQGFSDRHAV VQGIRRKLMGRARNWLT
Sbjct: 201 MVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLT 260

Query: 347 ANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSW 406
           ANALKPYHSWVYWRD D+ELCPGS+I+DLMS N DV VPNVWRPLP FL  EQ YDLNSW
Sbjct: 261 ANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSW 320

Query: 407 MESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAK 466
           +ES E L+LA TLDEDDVIVEGYAEYPTWRVHL YIR+ + +P E++DLDGVGGVSILAK
Sbjct: 321 VESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAK 380

Query: 467 AKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           AKLFR GV FPAFTFENHAETEAFGKMAKKM YRVGGLPHYT+WHIYEPSDDDL
Sbjct: 381 AKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDL 434

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/390 (74%), Positives = 348/390 (89%), Gaps = 2/390 (0%)

Query: 131 VVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETR 190
           +V KFD+G +HYLIS++GS+VLTP+D  +Y+ EL  LL +TV+ YDLS++ G  NG++ R
Sbjct: 98  LVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNR 157

Query: 191 DHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQ 250
           +H+LLCVPLR+A DVLPLMFK++MNLTYPHELIDLAFLVSDC+E D TL++LIAYSR LQ
Sbjct: 158 EHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQ 217

Query: 251 NGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQIF 310
           +GTL+ +FQE+D   D   K ++KLYL+YM+++Y+  V  A+SPPFH +Y+KPFRSVQIF
Sbjct: 218 DGTLAGLFQEMDK--DDSKKDSEKLYLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIF 275

Query: 311 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 370
           QKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWL  NALKPYH+WVYWRDADVELCPG+
Sbjct: 276 QKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGT 335

Query: 371 IIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGYA 430
           +I+DLMSKN+DV+VPNVWRPLP FL SEQPYDLNSWMES E L+LAK LDEDDVIVEGYA
Sbjct: 336 VIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYA 395

Query: 431 EYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAF 490
           EYPTWRVHLAYIR+  G+PN+V+DLDGVGGVSIL KAKLFR+G+ FPAFTFENHAETEAF
Sbjct: 396 EYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAF 455

Query: 491 GKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           GKMAKKMG+RVGGLPHYT+WHIYEPSDDDL
Sbjct: 456 GKMAKKMGFRVGGLPHYTLWHIYEPSDDDL 485

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/389 (76%), Positives = 335/389 (86%), Gaps = 3/389 (0%)

Query: 135 FDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETRDHIL 194
           FD G +HYLI+Q+G DV+T KD E+Y  E+  LL S+V+KYDLS+FEG +NG E R+H+L
Sbjct: 118 FDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLL 177

Query: 195 LCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQNGTL 254
              PLR+A  VLP+MFKHLMNLTYPHELID+AFLVSDCSE D TLD LI ++R LQ+GTL
Sbjct: 178 YLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTL 237

Query: 255 SQIFQEIDAVI---DSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQIFQ 311
             IF+++DA I   + + +  +K YL++MDQNYI     +F+ P H  Y+KPFRSVQIFQ
Sbjct: 238 VDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQ 297

Query: 312 KDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSI 371
           KDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS+
Sbjct: 298 KDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSV 357

Query: 372 IQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGYAE 431
           IQDLMSKNYDVIVPNVWRPLP FL  EQPYDLNSWMES E LELAKTLDEDDVIVEGYAE
Sbjct: 358 IQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAE 417

Query: 432 YPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAFG 491
           YPTWRVHLAY+RD  GDPN+ +D+DGVGGVSILAKAKLFR+GV FPAFTFENHAETEAFG
Sbjct: 418 YPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFG 477

Query: 492 KMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           KMAKKMGY VGGLP+Y +WHIYEPSDDDL
Sbjct: 478 KMAKKMGYSVGGLPNYMLWHIYEPSDDDL 506

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/391 (74%), Positives = 337/391 (86%), Gaps = 1/391 (0%)

Query: 131 VVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETR 190
           ++ KFDNG EHYLIS+ G ++L   D E+Y+ E+  LLDSTVE YDL  FEG++ G   R
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 191 DHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQ 250
           +H+LL VPLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSEDD TL+AL+ Y ++LQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 251 NGTLSQIFQEIDAVID-SQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQI 309
           +GTLS +F    +  +  + KGT  L+L+YM  +Y+  V+ A+SPPFH+ YDKPFRSVQI
Sbjct: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180

Query: 310 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 369
           FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG
Sbjct: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240

Query: 370 SIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGY 429
           S+IQDLMS ++DV VPNVWRPLP FL+ EQPYDLNSW+ES   L+LA+TLDEDDVIVEGY
Sbjct: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300

Query: 430 AEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEA 489
           AEYPTWRVHLAY+RD + +P ++I+LDGVGGVSILAKAKLFRNGV FPAFTFENHAETEA
Sbjct: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360

Query: 490 FGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           FGKMAKKMGYRV GLPHYT+WHIYEPSDDDL
Sbjct: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDL 391

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/390 (73%), Positives = 336/390 (86%), Gaps = 2/390 (0%)

Query: 131 VVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETR 190
           +VSKFD G+ +YLIS++G++  +  D  +Y   L MLLDSTVEKYDL  F+G+++G E +
Sbjct: 115 IVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQ 174

Query: 191 DHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQ 250
           +HIL+CVPLR+A +VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D TL+AL  YS+ LQ
Sbjct: 175 EHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQ 234

Query: 251 NGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQIF 310
            G L  I  ++D    ++ K  + ++L+YM+ +Y+ RV+ A+ PPFH NY KPFRSVQIF
Sbjct: 235 EGILPDILADMDNY--NKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQIF 292

Query: 311 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 370
           QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL +NALKPYHSWVYWRDADVELCPGS
Sbjct: 293 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPGS 352

Query: 371 IIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGYA 430
           +I+DLM ++YDVIVPNVWRPLP FL S QPYDLNSWMES E L+LAKTLDEDDVIVEGYA
Sbjct: 353 VIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGYA 412

Query: 431 EYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAF 490
           EYPT+RVHLAYIR+ +GDP +V+DLDGVGGVSILA+A++FR GV F AFTFENHAETEAF
Sbjct: 413 EYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEAF 472

Query: 491 GKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           GKMAKK+G+RVGGLPHYT+WHIYEPSDDDL
Sbjct: 473 GKMAKKVGFRVGGLPHYTLWHIYEPSDDDL 502

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/390 (69%), Positives = 334/390 (85%), Gaps = 1/390 (0%)

Query: 131 VVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETR 190
            + K+D GV HY+IS+ G + L+ +D E ++ E  MLL ST + YDLS++ GASNG   R
Sbjct: 98  TIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANR 157

Query: 191 DHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQ 250
           DH+LLCVPLR+AA +LP++FK+LMNLTYPHELID+AFLVSDC+++  T+ +L+ +S++LQ
Sbjct: 158 DHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQ 217

Query: 251 NGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQIF 310
           NGTLS+  Q+ +A  D +    ++LYL+YM ++Y+  V+ AF+PPFH++YDKPFRS+QIF
Sbjct: 218 NGTLSKTLQDFEADKD-KGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIF 276

Query: 311 QKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 370
           +KDFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG+
Sbjct: 277 EKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGT 336

Query: 371 IIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGYA 430
           +I+DLM  +YDVIVPNVWRPLPTFL   Q YDLNSW+ES E ++LAKTLDEDDVIVEGYA
Sbjct: 337 VIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYA 396

Query: 431 EYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAF 490
           EYPTWRVHL Y+R   G+P++++DLDGVGGVSILA+A+LFR G+ FPAFTFENHAETEAF
Sbjct: 397 EYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQLFRKGIHFPAFTFENHAETEAF 456

Query: 491 GKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           GKMAKKMG++VGGL HYT+WHIYEPSDDDL
Sbjct: 457 GKMAKKMGFKVGGLMHYTLWHIYEPSDDDL 486

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/474 (61%), Positives = 346/474 (72%), Gaps = 7/474 (1%)

Query: 51  YQPRSKSSKFQMTVNAXXXXXXXXXXXXXXXXFLTGMSIGVPIQNGRPLLGSSKSSDNYK 110
           Y P+ K  KF   ++                 FL   ++       R   G    SD+Y 
Sbjct: 41  YHPKVKG-KFNFRLSYKLKNVIVSLLTIACIFFLIKQTMDRNGSTPRSYAGLLSISDSYD 99

Query: 111 TIXXXXXXXXXXXXXXXXXXVVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDS 170
           T                    V ++D+G +H LI Q G+  L    +E ++  L MLL +
Sbjct: 100 TAVLEESEYYNFEYRPLDLDTVRRYDDGFKHILIDQDGT--LNSNQEEGFEEHLDMLLST 157

Query: 171 TVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
           TVE YDLS++ G +NG E R+H+L+CVPLRNA +VLPLMF+HLMNLTYPHELIDLAFLVS
Sbjct: 158 TVETYDLSKYAGTANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVS 217

Query: 231 DCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAV-IDSQTKGTDK---LYLQYMDQNYIN 286
           DCS+DD T+D+LI+Y+ +LQ GTLS+  +  DA  +  ++K  +K   L+L+YM+++Y+N
Sbjct: 218 DCSKDDHTMDSLISYAEELQKGTLSKSLKLQDAYKMHKKSKSKNKEGDLHLKYMNKDYLN 277

Query: 287 RVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLT 346
            V  A   PFH+NYDKPFRSVQIFQKDFGQ+IGQGFSDRH VKVQG RRKLMG+ARNWLT
Sbjct: 278 MVENALKEPFHKNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLT 337

Query: 347 ANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSW 406
           ANALKPYHSWVYWRDADVELCPGS+I+DLMS  YDVIVPNVWRPLP FL SEQ YDLNSW
Sbjct: 338 ANALKPYHSWVYWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSW 397

Query: 407 MESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAK 466
           +ES   L LAKTLDEDDVIVEGYAEY TWR HLA  RD +G+  +V+DLDGVGGVSILAK
Sbjct: 398 IESDNALNLAKTLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAK 457

Query: 467 AKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           AKLFRNGV F AF FENHAETEAFGKMAKKMGYRVGGL HYT+WHIYEPS+DDL
Sbjct: 458 AKLFRNGVHFAAFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDL 511

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/398 (70%), Positives = 337/398 (84%), Gaps = 8/398 (2%)

Query: 131 VVSKFDNGVEHYLISQFGSD---VLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGV 187
            +SK+D GV  YL+  + +D    L+ +  E Y +EL  LL S+V+ YD+  F G S+GV
Sbjct: 116 TISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGV 175

Query: 188 ETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSR 247
            +R+H+LLC+PLR+A DVLPLMFK+LMNLTYPHELID+AFLVSDCSE+D TL++L+ Y+R
Sbjct: 176 SSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTR 235

Query: 248 QLQNGTLSQIFQE---IDAVIDSQTKGTD--KLYLQYMDQNYINRVRQAFSPPFHENYDK 302
            LQNGTL  +F+E   +D + D   +  D  KLYL+YM + Y+ RV++AF  PFHENYDK
Sbjct: 236 FLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYDK 295

Query: 303 PFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDA 362
           PFRS+QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NALKPYHSWVYWRDA
Sbjct: 296 PFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDA 355

Query: 363 DVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDED 422
           DVELCPG++I+DLMSK++DVIVPNVWRPLP F+ SEQPYDLNSWMES+E ++LAK L ED
Sbjct: 356 DVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHED 415

Query: 423 DVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFE 482
           +VIVEGYAEYPTWRVHLAY+R+ +GDPN+V+D+DGVGGVSILA+A+LFR GV FPAFTFE
Sbjct: 416 EVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFE 475

Query: 483 NHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           NHAETEAFGKMAKKMG+RVGGLPHYT+WHIYEPSDDDL
Sbjct: 476 NHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDL 513

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/393 (68%), Positives = 318/393 (80%), Gaps = 7/393 (1%)

Query: 132 VSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETRD 191
           ++K+D G EHY +++ G      +DD +++ ++  L+ +TVE+YDL  +EG  NG E R+
Sbjct: 83  LAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVEQYDLRNYEGTPNGAENRE 139

Query: 192 HILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQN 251
           H+L+C+PLRNA  VLP+MFKHLMNLTYPHELID+AFLVSDCSE+D TL +L+ Y+  LQ 
Sbjct: 140 HVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKTLQSLMEYATYLQK 199

Query: 252 GTLSQIFQ----EIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSV 307
           GTL+ +      EI  +      G   LYL+YMDQ Y+  VR AFSPP+HENY+KPFRSV
Sbjct: 200 GTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSV 259

Query: 308 QIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 367
           Q+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANALKPYHSWVYWRD DVELC
Sbjct: 260 QVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELC 319

Query: 368 PGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVE 427
           PGS+I+DLMS  YDVIVPNVWRPLP FL  +Q YDLNSW+ES + L LAK L+EDDVIVE
Sbjct: 320 PGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVE 379

Query: 428 GYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAET 487
           GYAEY TWR HL   R+A+G+P EVIDLDGVGGVSILAKAKLFR G  F AF FENHAET
Sbjct: 380 GYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAET 439

Query: 488 EAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           EAFGKMAKKMGY+VGGLPHYT+WHIYEPSDDD+
Sbjct: 440 EAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDI 472

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/325 (77%), Positives = 284/325 (87%), Gaps = 1/325 (0%)

Query: 197 VPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQNGTLSQ 256
           VPLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSEDD T +AL+ Y+++LQ+GTLSQ
Sbjct: 2   VPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLSQ 61

Query: 257 IFQEIDAVIDS-QTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQIFQKDFG 315
           +F   ++  +  + +G+  L+L+YM  +Y+  V+ AF+PPFH+NYDKPFRSVQIFQK+FG
Sbjct: 62  VFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNFG 121

Query: 316 QVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSIIQDL 375
           QVIGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS+I+DL
Sbjct: 122 QVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDL 181

Query: 376 MSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGYAEYPTW 435
           M+  YDV VPNVWRPLP FL  EQ YDLNSW+ES   L+LAK LDEDDVIVEGYAEYPTW
Sbjct: 182 MATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPTW 241

Query: 436 RVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAFGKMAK 495
           RVHL YIR+ +GDP   IDLDGVGGVSILAKA+LFRNGV FPAFTFENHAETEAFGKMAK
Sbjct: 242 RVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMAK 301

Query: 496 KMGYRVGGLPHYTIWHIYEPSDDDL 520
           KMGY V GLPHYT+WHIYEPSDDDL
Sbjct: 302 KMGYSVAGLPHYTLWHIYEPSDDDL 326

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  397 bits (1020), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 194/349 (55%), Positives = 237/349 (67%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           V+ YDLS ++G  +G +  D +L CVPLR+AA+ LP+ FKHL ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            ++D  T+  L+     LQ                SQ  GT                   
Sbjct: 110 STDD--TMGVLLNSLHDLQ----------------SQADGT------------------- 132

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F  ++IFQKDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 133 ----------KRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAIK 182

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE  P +I++DLM  + D+IVPNVWRPLP +L   QPYDLNSW+ES+ 
Sbjct: 183 PYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESEG 242

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA +L EDDVIVEGY EY TWRVHLAY+RD  GDP   ++LDG+GGVSIL+KAK+FR
Sbjct: 243 GLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVFR 302

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
            G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWH+YEPS DDL
Sbjct: 303 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDL 351

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  390 bits (1003), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 188/349 (53%), Positives = 239/349 (68%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL+ ++G ++G +  D +L CVPLR+AA+ LP+ FKH+  ++YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S+D  T+  L++  ++ Q+                                        
Sbjct: 142 SSDD--TMGVLLSSLKKAQS---------------------------------------- 159

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                +++  + F +++IF+KDFGQVIGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 160 -----NQDKSQRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 214

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE  P +I++DLM  N DVIVPNVWRPLP +L + QPYDLNSW ES+ 
Sbjct: 215 PYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 274

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA +L+ED VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KAK+FR
Sbjct: 275 GLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAKVFR 334

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
            G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWH+YEPS DDL
Sbjct: 335 TGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDL 383

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  389 bits (999), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 189/350 (54%), Positives = 239/350 (68%), Gaps = 47/350 (13%)

Query: 171 TVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
            V+ YDL  ++G ++G +  DH+L  VPLR+AA+ LP+ F H+  ++YPH LIDL+FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 231 DCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQ 290
           D S+D  T+  L+ Y ++ Q                S+   T +                
Sbjct: 112 DSSDD--TMGVLLEYLQKAQ----------------SKPDRTQR---------------- 137

Query: 291 AFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                        F +++I++KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + AL
Sbjct: 138 -------------FGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVAL 184

Query: 351 KPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESK 410
           KPYHSWVYWRD DVE  P +I++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+
Sbjct: 185 KPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 244

Query: 411 EGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLF 470
            GL+LA++LDED VIVEGY EY TWR HLAY+RD  GDP + ++LDG+GGVSIL+KAK+F
Sbjct: 245 GGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKVF 304

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           R G  FPAF+FE HAETEAFGK+++++GY V GLPHY IWHIYEPS DDL
Sbjct: 305 RAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDL 354

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  387 bits (995), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 189/351 (53%), Positives = 234/351 (66%), Gaps = 47/351 (13%)

Query: 170 STVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLV 229
           +  E YDL  + G SNG +T D IL CVPLR+AA+ LP+ FKHL  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 230 SDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVR 289
           SD  +D  T+  L++  +  Q+                                      
Sbjct: 125 SDSKDD--TMGVLLSNLQTAQS-------------------------------------- 144

Query: 290 QAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 349
                   ++  K F +++ F+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A
Sbjct: 145 -------QKDRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVA 197

Query: 350 LKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMES 409
           +KPYHSWVYWRD DVE  P +I++DLM    DVIVPNVWRPLP +L + QPYDLNSW ES
Sbjct: 198 IKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQES 257

Query: 410 KEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKL 469
             GLELA +LD+D VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KA++
Sbjct: 258 DAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKARV 317

Query: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           FR+G  FPAF+FE HAETEAFGK++++MGY V GLPHY IWHIYEPS +DL
Sbjct: 318 FRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDL 368

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  389 bits (998), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 195/349 (55%), Positives = 236/349 (67%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL+ ++G  +G +  D IL CVPLR+AA+ LP+ F HL  ++YPH  IDL+FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S+D  T+  L++    LQN    Q                DK                 
Sbjct: 147 SSDD--TMGVLLS---NLQNAQSQQ----------------DK----------------- 168

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F +++IF+KDFGQVIGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 169 ---------SKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 219

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE  P +I++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+ 
Sbjct: 220 PYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 279

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA TL EDDVIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 280 GLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 339

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
            G  FPAF+FE HAETEAFGK+++KM Y V GLPHY IWHIYEPS +DL
Sbjct: 340 TGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDL 388

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  387 bits (993), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 190/349 (54%), Positives = 239/349 (68%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL  ++G S+G +  D IL CVPLR+AA+ LP+ F+HL  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S+D  T+  L+++ +  Q+                            MD++        
Sbjct: 122 SSDD--TMGVLLSHLQSAQSQ---------------------------MDKS-------- 144

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 145 ----------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE  P +I++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+ 
Sbjct: 195 PYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 254

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA+ L+ED VIVEGY EY TWR HLAY+RD  GDP E ++LDG+GGVSIL+KAK+FR
Sbjct: 255 GLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS +DL
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDL 363

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  387 bits (995), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 190/349 (54%), Positives = 236/349 (67%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL  ++G  +G +  D IL CVPLR+AA+ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S  D T+  L++    LQN    Q                                   
Sbjct: 142 SS--DNTMGVLLS---NLQNAQSQQ----------------------------------- 161

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                  +  K F +++IF+KDFGQ+IGQ FSDRH  K QG RRKLM RARNWL + A+K
Sbjct: 162 -------DRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAIK 214

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE  P +I++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+ 
Sbjct: 215 PYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 274

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA +LDED VIVEGY EY TWR HLAY+RD  G+P + ++L+G+GGVSIL+KAK+FR
Sbjct: 275 GLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVFR 334

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           +G  FPAF+FE HAETEAFGK++++M + V GLPHY IWHIYEPS +DL
Sbjct: 335 SGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDL 383

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  385 bits (990), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 187/349 (53%), Positives = 237/349 (67%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL  ++G  +G +  D +L  VPLR+AA+ LP+ F H+  ++YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S+D  T+  L+ + ++ Q+ T                                      
Sbjct: 113 SSDD--TMGVLLDHLKKAQSKT-------------------------------------- 132

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                  +  K F +++IF+KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + ALK
Sbjct: 133 -------DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVALK 185

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE  P +I++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+ 
Sbjct: 186 PYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 245

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           G++LA++LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSIL+KAK+FR
Sbjct: 246 GMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVFR 305

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
            G  FPAF+FE HAETEAFGK+++++GY V GLPHY IWHIYEPS DDL
Sbjct: 306 AGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDL 354

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  389 bits (999), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 191/349 (54%), Positives = 235/349 (67%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           V  YDL+ + G S+G +  D IL CVPLR+AA  LP  F HL  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
             +D  T+  L+++ +  Q+                              QN + R    
Sbjct: 132 SKDD--TMGVLLSHLQTAQS-----------------------------QQNKLKR---- 156

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                       F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 157 ------------FGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 204

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE CP +I++DLM    DVIVPNVWRPLP +L + QPYDLNSW ES+ 
Sbjct: 205 PYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESEG 264

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA +LDED VIVEGY EY TWR HLAY+RD  GDP E ++LDG+GGVSIL+KAK+FR
Sbjct: 265 GLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVFR 324

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           +G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DL
Sbjct: 325 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDL 373

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  384 bits (986), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 191/349 (54%), Positives = 236/349 (67%), Gaps = 49/349 (14%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL+ + G  +G +  D IL CVPLR+AA+ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S  D T+  L+ + +Q Q                              D+N        
Sbjct: 114 SS--DNTMGVLMHHLQQAQK-----------------------------DKN-------- 134

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F +++IF+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 135 ----------KRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 184

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE+ P SI++DLM  + DVIVPNVWRPLP +L + QPYDLNSW+ES+ 
Sbjct: 185 PYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEG 244

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA TL ED VIVEGY EY TWR HLAY+RD  G+P + + LDG+GGVSIL+KA++FR
Sbjct: 245 GLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVFR 304

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
            G  FPAF+F+ HAETEAFGK++++MG+ V GLPHY IWHIYEPS DDL
Sbjct: 305 AGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDL 353

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  385 bits (990), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 188/350 (53%), Positives = 235/350 (67%), Gaps = 47/350 (13%)

Query: 171 TVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
           +VE YDL  ++G  +G +  D IL CVPLR+A++ LP+ F HL  +TYPH LIDL+FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 231 DCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQ 290
           D S  D T+  L++  +  Q+                                       
Sbjct: 121 DSS--DNTMGVLLSNLQMAQS--------------------------------------- 139

Query: 291 AFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                  ++  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 140 ------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 351 KPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESK 410
           KPYHSWVYWRD DVE  P +I++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+
Sbjct: 194 KPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 411 EGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLF 470
            GL+LA +LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+F
Sbjct: 254 GGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           R G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDL
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDL 363

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  383 bits (984), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/349 (53%), Positives = 233/349 (66%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL  ++G  +G +  D IL CVPLR+A++ LP+ F HL  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S  D T+  L++   + Q+                                        
Sbjct: 122 SS--DNTMGVLLSNLHKAQS---------------------------------------- 139

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                 ++  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 140 -----QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE  P +I++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+ 
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA  L+ED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDL
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDL 363

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 192/350 (54%), Positives = 232/350 (66%), Gaps = 48/350 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE +DLS   G ++G    D +L CVPLR+AA+ LP+ FKHL  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
               D T+  L  + R+LQ+                                  +  RQ 
Sbjct: 102 SK--DETMSVLRQHVRELQSQP--------------------------------DNARQ- 126

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                       F +++IFQKDFGQ IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 127 ------------FGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVALK 174

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE  P +II+DLM  + DVIVPNVWRPLP +L   QPYDLNSW+ES+ 
Sbjct: 175 PYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESEG 234

Query: 412 GLELAK-TLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLF 470
           GL+LA  T DED VIVEGY EY TWRVHLAY+RD  GDP   ++LDG+GGVSIL++A++F
Sbjct: 235 GLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRARVF 294

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           R+G  FPAF+F+ HAETE FGK+++ MGY V GLPHY IWHIYEPS DDL
Sbjct: 295 RSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDL 344

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  383 bits (983), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 233/349 (66%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL  ++G  +G +  D IL CVPLR+A++ LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S  D T+  L++  +  Q+                                        
Sbjct: 122 SS--DNTMGVLLSSLQTAQS---------------------------------------- 139

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                 ++  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 140 -----QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DV+  P +I++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+ 
Sbjct: 195 PYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA  LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDL
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDL 363

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  382 bits (982), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 189/349 (54%), Positives = 233/349 (66%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL  ++G  +G +  D IL CVPLR+A++ LP+ F HL  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S  D T+  L++                             KL +    Q+   R    
Sbjct: 122 SS--DNTMGVLLS-----------------------------KLQMAQSQQDKTKR---- 146

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                       F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + ALK
Sbjct: 147 ------------FGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVALK 194

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE  P +I++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+ 
Sbjct: 195 PYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESEG 254

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA  LDED VIVEGY EY TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+FR
Sbjct: 255 GLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVFR 314

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
            G  FPAF+FE HAETEAFG+++++M Y V GLPHY IWHIYEPS DDL
Sbjct: 315 TGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDL 363

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  380 bits (975), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 188/350 (53%), Positives = 236/350 (67%), Gaps = 47/350 (13%)

Query: 171 TVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
           +VE YD+S ++G  +G    + IL+CVPL++A++ LPL FK L  +TYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 231 DCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQ 290
           D S  D T+  L+   ++LQ              ID  T G                   
Sbjct: 114 DSS--DNTMYNLLNMLKRLQ--------------IDGGTSGK------------------ 139

Query: 291 AFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                        F +++I++KDFGQVIGQGFSDRH    QG RRKLMG+ARNWL   A+
Sbjct: 140 -------------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNTVAI 186

Query: 351 KPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESK 410
           KPYHSWVYWRD DVE+ P +I++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+
Sbjct: 187 KPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 246

Query: 411 EGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLF 470
            GL L+ +L ED VIVEGY EY TWR HLAY+RD  GDP   ++LDGVGGVSIL+KA +F
Sbjct: 247 AGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKANVF 306

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           R+G  FPAF+F+ HAETEAFGK++K M + V GLP+Y +WHIYEPS +DL
Sbjct: 307 RSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDL 356

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  386 bits (992), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 182/349 (52%), Positives = 237/349 (67%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDLS ++G  +G +  D IL C+PLR+AA  LP+ F H+  +TYPH L+DL+FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S+D  T+  L+++ + +Q+                                        
Sbjct: 126 SSDD--TMGVLLSHLQTVQS---------------------------------------- 143

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                 ++  K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM +ARNWL + ALK
Sbjct: 144 -----QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVALK 198

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD D+E  P +I++DLM  + D+IVPNVWRPLP +L + QPYDLNSW ES+ 
Sbjct: 199 PYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESEG 258

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA  LDE+ VIVEGY EY TWR HLAY+RD  GDP + ++LDG+GGVSIL+KAK+FR
Sbjct: 259 GLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVFR 318

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           +G  FPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DL
Sbjct: 319 SGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDL 367

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  377 bits (967), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/349 (53%), Positives = 234/349 (67%), Gaps = 47/349 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL  ++G +NG +T D ++ CVPLR+AA  L + F  L  LTYPH LIDL+FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S+D  T+  L+++ R+ Q+                                        
Sbjct: 117 SSDD--TMKTLLSHLRRAQS---------------------------------------- 134

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                +++  + F +++IF+KDFGQ +GQ FSDRH    QG RRK M RARNWL + ALK
Sbjct: 135 -----NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAALK 189

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHS+VYWRD DV+  P +I++DLM  + DVIVPNVWRPLP +L + QPYDLNSW+ES+ 
Sbjct: 190 PYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESEG 249

Query: 412 GLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFR 471
           GL+LA +LDED  IVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KAK+FR
Sbjct: 250 GLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKVFR 309

Query: 472 NGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
            G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWHIYEPS DDL
Sbjct: 310 TGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDL 358

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  380 bits (975), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 184/350 (52%), Positives = 231/350 (66%), Gaps = 47/350 (13%)

Query: 171 TVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
            VE YDL  ++G  +G +  D I+ CVPLR+AA  LP  F HL  ++YPH LIDL+FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 231 DCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQ 290
           D S+D  T+  L++  +  Q+                                       
Sbjct: 124 DSSDD--TMGVLLSNLQTAQS--------------------------------------- 142

Query: 291 AFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                   +  K F +++I++KDFGQVIGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 143 ------QRDKSKRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVAL 196

Query: 351 KPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESK 410
           KPYHSWVYWRD D+E  P +I++DLM  + D+IVPNVWRPLP +L + QPYDLNSW ES+
Sbjct: 197 KPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESE 256

Query: 411 EGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLF 470
            GL+LA  L+ED VIVEGY EY TWR HLAY+RD  GDP   ++LDG+GGVSIL+KA +F
Sbjct: 257 GGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKANVF 316

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           R+G  FPAF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +DL
Sbjct: 317 RSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDL 366

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  370 bits (951), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 187/350 (53%), Positives = 232/350 (66%), Gaps = 48/350 (13%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           VE YDL  ++G  +G +  + IL  VPLR+AA  LP  F H+  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            S+D                 T+ ++   +  +  SQ            D+N        
Sbjct: 117 SSDD-----------------TMGELLHHL-QIAQSQK-----------DRN-------- 139

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                     K F +++IF+KDFGQ IGQ FSDRH    QG RRKLM RARNWL +  LK
Sbjct: 140 ----------KRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTLK 189

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE 411
           PYHSWVYWRD DVE+ P SI++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+ 
Sbjct: 190 PYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEA 249

Query: 412 GLELAKTL-DEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLF 470
           G++LA TL DED VIVEGY E+ TWR HLAY+RD  G+P + ++LDG+GGVSILAKAK+F
Sbjct: 250 GIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 309

Query: 471 RNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           R G  FPAF+FE HAETEAFGK++++M Y V GLPHY IWHIYEPS +DL
Sbjct: 310 RTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDL 359

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  371 bits (953), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 234/351 (66%), Gaps = 48/351 (13%)

Query: 171 TVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVS 230
            VE YDL  ++G  +G +  + IL  VPLR+AA+ LP  F H+  +TYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 231 DCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQ 290
           D S+D  T+ AL+++  + Q+                                  ++ R+
Sbjct: 122 DSSDD--TMGALLSHLEKAQSNK--------------------------------DKTRR 147

Query: 291 AFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                        F +++I++KDFGQ IGQ FSDRH    QG RRKLM RARNWL   AL
Sbjct: 148 -------------FGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVAL 194

Query: 351 KPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESK 410
           K YHSWVYWRD DVELCP SI++DLM  + DVIVPNVWRPLP +L + QPYDLNSW ES+
Sbjct: 195 KAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 254

Query: 411 EGLELAKTLDEDD-VIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKL 469
            G++LA +L +DD VIVEGY +Y TWR HLAY+RD  G+P + ++LDG+GGVSIL+K K+
Sbjct: 255 VGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGKV 314

Query: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDL 520
           FR G  FPAF+FE HAETEAFGK++++MGY V GLPHY IWHIYEPS +DL
Sbjct: 315 FRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDL 365

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  205 bits (521), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 186/352 (52%), Gaps = 52/352 (14%)

Query: 166 MLLDSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDL 225
           ++ +  +  YDL++ +  SN +  ++ +L+  P++         + +L++LTYP  LI+L
Sbjct: 90  LIPEGHIAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIEL 146

Query: 226 AFLVSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYI 285
            F++   +  D  L  L +  R++Q G   + F +I  ++   ++  D+L          
Sbjct: 147 GFIIPRTASGDAALQKLESAVREVQTGKQDKRFAKI-TILRQASQSFDRL---------- 195

Query: 286 NRVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWL 345
                                              G  DRHA++VQ  RR  M  ARN L
Sbjct: 196 -----------------------------------GEKDRHALEVQKERRAAMALARNEL 220

Query: 346 TANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPL---PTFLESEQPYD 402
             + + P+ SW+ W DAD+   P ++IQDL S N  V+  NV++         ES +PYD
Sbjct: 221 LFSTIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQKFYDKDQKKESIRPYD 280

Query: 403 LNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVS 462
            N+W ES+ GL+LA+ L ++++IVEGY+E  T+R  +A+  DA G  N +++LDGVGG  
Sbjct: 281 FNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVGGGC 340

Query: 463 ILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
            L KA++ R+G  F  F F +  ETEAF KMAK++GY V GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  202 bits (514), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 112/349 (32%), Positives = 181/349 (51%), Gaps = 58/349 (16%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++     + ++ ++H+L+  P++   D     + +L+ ++YP  L++L F++  
Sbjct: 96  IAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLELGFIIPR 152

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
               D TL  L A  + +Q G +   F +I  ++   ++  DKL                
Sbjct: 153 TPTGDETLKKLEAAVKNVQTGKVEDRFAKI-TILRQDSQSFDKL---------------- 195

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                        G  +RH++ VQ  RR  M  ARN L  +++ 
Sbjct: 196 -----------------------------GEKERHSLAVQKERRSAMALARNELLFSSIG 226

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQ------PYDLNS 405
           P  SWV W DAD+   P ++IQD+ + N  V+  NV++    F + E+      PYD N+
Sbjct: 227 PSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQ---RFFDKEKNENSIRPYDFNN 283

Query: 406 WMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILA 465
           W ES++GLE+AK ++ED++IVEGYAE  T+R  +A+  D  G  + ++ LDGVGG   L 
Sbjct: 284 WAESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGGCTLV 343

Query: 466 KAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           KA++ R+G  FP F F +  ETE F KMAK++ Y + GLP+Y ++HI E
Sbjct: 344 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  194 bits (494), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 114/347 (32%), Positives = 179/347 (51%), Gaps = 54/347 (15%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++          ++ +L+  P++   D     + +L+ LTYP +LI+L F++  
Sbjct: 96  ISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---WDNLLQLTYPRDLIELGFIIPR 152

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAV-IDSQTKGTDKLYLQYMDQNYINRVRQ 290
            +  DT L  L A  ++ Q G   Q F +I  +  DSQ+                     
Sbjct: 153 TATGDTALRKLEAAVKRTQLGKKDQRFSKITILRQDSQS--------------------- 191

Query: 291 AFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 350
                        F S+Q               +RHA+KVQ  RR  M  ARN L  + +
Sbjct: 192 -------------FDSLQE-------------KERHALKVQKERRAAMALARNELLFSTI 225

Query: 351 KPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPL---PTFLESEQPYDLNSWM 407
            P+ SW+ W DAD+   P S+IQD+ + N  V+  NV++      T   +E+PYD N+W 
Sbjct: 226 GPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQKYMNEETKKIAERPYDFNNWA 285

Query: 408 ESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKA 467
           +S++ L++A  + +D+V+ EGYAE PT+R  +A++ DA G     + LDGVGG   L KA
Sbjct: 286 DSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSLDGVGGGCTLVKA 345

Query: 468 KLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           ++ R+G  FP+F F +  ETE F KMA+++ Y + GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEE 392

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  193 bits (491), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 176/352 (50%), Gaps = 58/352 (16%)

Query: 169 DSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 228
           +  +  YDL++    S     ++HIL+  P++         + +L+ L YP ELI+L F+
Sbjct: 93  EGHIAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFI 149

Query: 229 VSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRV 288
               +  D  L  L    +++Q    +Q F +I  ++   ++  DKL    M++      
Sbjct: 150 TPRTATGDLALKKLENAIKKVQTDKKTQRFSKI-TILRQNSQSFDKL----MEK------ 198

Query: 289 RQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 348
                                              +RHA+ VQ  RR  M  ARN L  +
Sbjct: 199 -----------------------------------ERHALDVQKERRAAMALARNELLFS 223

Query: 349 ALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQ------PYD 402
            + P+ SWV W DAD+   P S+IQD+   N  ++  N+++    F + E+      PYD
Sbjct: 224 TIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQ---RFYDEEKKQPSIRPYD 280

Query: 403 LNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVS 462
            N+W ES  GLE+A  + +D++IVEGYAE  T+R  +A+  DA G P E + LDGVGG  
Sbjct: 281 FNNWQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGC 340

Query: 463 ILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
            L KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 341 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  191 bits (486), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 121/384 (31%), Positives = 188/384 (48%), Gaps = 64/384 (16%)

Query: 147 FGSDVLTPKDDEKYQSELSMLLDST--------VEKYDLSRFEGASNGVETRDHILLCVP 198
           + S    PK   K +S   M  D+         V KYDL++    S+    ++ +L+  P
Sbjct: 61  YSSKFKMPKYSYKVKSRNWMFRDNKDDRIPNGHVAKYDLNKLHSTSDAAVNKEQVLILTP 120

Query: 199 LRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQNGTLSQIF 258
           ++         + +L+ LTYP +L++L F++   +  D  L  L A  ++ Q    +  F
Sbjct: 121 MQTFHQA---YWDNLLQLTYPRDLLELGFIIPKSASGDAALKQLEAAVKRAQTDKKNNRF 177

Query: 259 QEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQIFQKDFGQVI 318
            ++  ++   +KG DKL  +                                        
Sbjct: 178 GKV-TILRQDSKGFDKLQEK---------------------------------------- 196

Query: 319 GQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSIIQDLMSK 378
                +RHA+ VQ  RR  M  ARN L  + + P+ SWV W DAD+     S+IQD+ + 
Sbjct: 197 -----ERHALAVQKERRSAMALARNELLFSTIGPHTSWVLWLDADIIETKPSLIQDMTAL 251

Query: 379 NYDVIVPNVWRPLPTFLESE-----QPYDLNSWMESKEGLELAKTLDEDDVIVEGYAEYP 433
           N  V+  NV++    F E+E     +PYD N+W +S+   EL   + +D++IVEGYAE  
Sbjct: 252 NKPVLAANVYQRY--FDEAENKPSIRPYDFNNWADSQIAQELGDKMGDDEIIVEGYAEIA 309

Query: 434 TWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAFGKM 493
           T+R  +A+    +G PNE++ LDGVGG   L KA++ R+G  FP F F +  ETE F KM
Sbjct: 310 TYRPLMAHFYTPDGPPNELMSLDGVGGGCTLVKAEVHRDGAMFPTFPFYHLIETEGFAKM 369

Query: 494 AKKMGYRVGGLPHYTIWHIYEPSD 517
           AK++ Y V GLP+Y ++HI E +D
Sbjct: 370 AKRLNYEVFGLPNYLVFHIEERND 393

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  191 bits (486), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 178/352 (50%), Gaps = 58/352 (16%)

Query: 169 DSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 228
           ++ +  YDL++    +     ++H+L+  P++         + +L+ LTYP E  +L F+
Sbjct: 94  ENHIAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQEY---WDNLLQLTYPREFTELGFI 150

Query: 229 VSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRV 288
           +   S  D  L  L A  +++Q    +Q F +I  ++   + G DKL    M++      
Sbjct: 151 LPRTSSGDIALSKLEAAVKKVQTDKKNQRFSKI-TILRQNSAGFDKL----MEK------ 199

Query: 289 RQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 348
                                              +RHA++VQ  RR  M  ARN L  +
Sbjct: 200 -----------------------------------ERHALEVQKERRSAMASARNELLFS 224

Query: 349 ALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESE------QPYD 402
           +L P  SWV W DAD+   P ++IQD+ S N  V+  NV++    + + +      +PYD
Sbjct: 225 SLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQ---KYYDDQAKKVQIRPYD 281

Query: 403 LNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVS 462
            N+W ES   LELAK + +D+++VEGY +  T+R  +AY  DA G  N  ++LDGVGG  
Sbjct: 282 FNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLDGVGGGC 341

Query: 463 ILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
            L KA + R+G  FP F F +  ETE F KMA+++ Y + GLP+Y ++HI E
Sbjct: 342 TLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  191 bits (484), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 114/349 (32%), Positives = 178/349 (51%), Gaps = 58/349 (16%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++    S+    ++H+L+  P++         + +L+ L+YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIELGFITPR 152

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            +  D  L  L    +++Q    +Q F +I  ++   ++  DKL    M++         
Sbjct: 153 TATGDLALKNLENAIKKVQTDKKTQRFSKI-TILRQNSQSFDKL----MEK--------- 198

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                           +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 199 --------------------------------ERHALDVQKERRAAMALARNELLFSTIG 226

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQ------PYDLNS 405
           P+ SW+ W DAD+   P S+IQD+   +  V+  N+++    F + E+      PYD N+
Sbjct: 227 PHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQ---RFYDQEKKQPSIRPYDFNN 283

Query: 406 WMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILA 465
           W ES  GLE+A  + +D++IVEGYAE  T+R  +A+  +A+G PNE + LDGVGG   L 
Sbjct: 284 WQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGVGGGCTLV 343

Query: 466 KAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           KA + R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 344 KADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  191 bits (484), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 114/352 (32%), Positives = 177/352 (50%), Gaps = 58/352 (16%)

Query: 169 DSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 228
           ++ +  YDL++          ++ +L+  P++   +     + +++++TYP ELI+L F+
Sbjct: 94  ENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIELGFI 150

Query: 229 VSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRV 288
                  D  L  L A  +++Q+G  ++ F +I  ++  +++  D L             
Sbjct: 151 APRTPTGDAALKKLEAAIKKIQSGKKNERFAKI-IILRQESQSFDML------------- 196

Query: 289 RQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 348
                                              DRHA+ VQ  RR  M  ARN L  +
Sbjct: 197 --------------------------------AEKDRHALAVQKQRRSAMALARNELLFS 224

Query: 349 ALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESE------QPYD 402
            L P+ SWV W DAD+   P ++IQDL + +  V+  NV++    F   E      +PYD
Sbjct: 225 TLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADIRPYD 281

Query: 403 LNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVS 462
            N+W ES+ GLELA +L  D++IVEGYAE  T+R  +A+  D     +E + LDGVGG  
Sbjct: 282 FNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGVGGGC 341

Query: 463 ILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
            L KA++ R+G  FP F F +  ETE F KMAK++GY V GLP+Y ++HI E
Sbjct: 342 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  190 bits (482), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 114/349 (32%), Positives = 177/349 (50%), Gaps = 58/349 (16%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++     +    ++HIL+  P++         + +L+ L YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPR 152

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            +  D+ L  L +  +++Q    +Q F +I  ++   ++  DKL    M++         
Sbjct: 153 TATGDSALKKLESAIKKVQTDKKTQRFSKI-TILRQNSQSFDKL----MEK--------- 198

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                           +RHA++VQ  RR  M  ARN L  + + 
Sbjct: 199 --------------------------------ERHALEVQKERRAAMALARNELLFSTIG 226

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQ------PYDLNS 405
           P+ SWV W DAD+   P S+IQD+   N  V+  N+++    F + E+      PYD N+
Sbjct: 227 PHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQ---RFYDQEKKQASIRPYDFNN 283

Query: 406 WMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILA 465
           W ES  GL++A  + +D++IVEGYAE  T+R  +A+  DA    NE + LDGVGG   L 
Sbjct: 284 WQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGVGGGCTLV 343

Query: 466 KAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 344 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  189 bits (480), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 176/349 (50%), Gaps = 58/349 (16%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++     +    ++H+L+  P++         + +L+ LTYP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTYPRELIELGFITPR 152

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            +  D  L  L    +++Q    +Q F +I  ++   ++  DKL    M++         
Sbjct: 153 TATGDLALKKLENAVKKVQADKKAQRFSKI-TIMRQNSQSFDKL----MEK--------- 198

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                           +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 199 --------------------------------ERHALDVQKERRAAMALARNELLFSTIG 226

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQ------PYDLNS 405
           P+ SWV W DAD+   P ++IQD+   N  V+  N+++    F + E+      PYD N+
Sbjct: 227 PHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQ---RFYDQEKKQSSIRPYDFNN 283

Query: 406 WMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILA 465
           W ES  GLE+A  +D+D++IVEGYAE  T+R  +A+   A   P++ + LDGVGG   L 
Sbjct: 284 WQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVGGGCTLV 343

Query: 466 KAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 344 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  189 bits (479), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 127/399 (31%), Positives = 195/399 (48%), Gaps = 69/399 (17%)

Query: 131 VVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEK---------YDLSRFE 181
           V  K+ N  EH     F S    P+    Y++E + + D  V++         YDL++  
Sbjct: 46  VNGKWVNENEHTDYLPFTSKFKLPRFS--YKNEHNWMFDDHVDEIIPEGHIAHYDLNKLH 103

Query: 182 GASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDA 241
             S+    ++ IL+  P++         +++L+ LTYP ELI+L F+       D  L A
Sbjct: 104 STSDAAINKEKILILTPIQKFHQE---YWENLLQLTYPRELIELGFIAPRTPTGDQALAA 160

Query: 242 LIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYD 301
           L A   ++Q+   +Q F ++  ++   + G +KL  +                       
Sbjct: 161 LEAAVDKVQSDKKNQRFSKV-TILRQDSVGFNKLTEK----------------------- 196

Query: 302 KPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRD 361
                                 +RHA++VQ  RR  M  ARN L  + + P+ SWV W D
Sbjct: 197 ----------------------ERHALEVQKERRASMALARNELLFSTIGPHTSWVLWLD 234

Query: 362 ADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQ------PYDLNSWMESKEGLEL 415
           AD+   P S+IQD+ + +  V+  NV++    + + E+      PYD N+W ES  GLEL
Sbjct: 235 ADIIETPASLIQDMTAHDRAVLSANVFQ---RYYDEEKKQKAIRPYDFNNWQESDTGLEL 291

Query: 416 AKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQ 475
           A  + +D++IVEGYAE  T+R  +AY  D +    E + LDGVGG   L KA++ R+G  
Sbjct: 292 ASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLDGVGGGCTLVKAEVHRDGAM 351

Query: 476 FPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 352 FPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  187 bits (476), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 180/352 (51%), Gaps = 58/352 (16%)

Query: 169 DSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 228
           ++ +  YDL++    S+    ++ +L+  P++   D     +++L+ LTYP ELI+L F+
Sbjct: 91  ENHIAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIELGFI 147

Query: 229 VSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRV 288
           +      D  L AL A  +++Q    +Q F +I  ++   ++G                 
Sbjct: 148 LPRSDSGDAALKALEAAVKKVQTDKKNQRFSKI-TILRQDSQG----------------- 189

Query: 289 RQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 348
                                    FGQ++ +   +RHA+ VQ  RR  M  ARN L  +
Sbjct: 190 -------------------------FGQLMEK---ERHALHVQKERRAAMALARNELLFS 221

Query: 349 ALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQ------PYD 402
            + P+ SWV W DAD+   P ++IQD+ + +  V+  NV++    + + E+       YD
Sbjct: 222 TIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQ---RYFDEEKKEKSIRAYD 278

Query: 403 LNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVS 462
            N+W ES  GL++A  +++D++IVEGY+E  T+R  +A+  D     N  + LDGVGG  
Sbjct: 279 FNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVGGGC 338

Query: 463 ILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
            L KA + R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++H+ E
Sbjct: 339 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  187 bits (476), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 113/349 (32%), Positives = 174/349 (49%), Gaps = 52/349 (14%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++    +     ++ +L+  P++   +     + +L+ LTYP ELI+L F+V  
Sbjct: 97  IAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTYPRELIELGFIVPR 153

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
               D  L  L    +++Q    +Q F ++  ++   +K  DKL  +             
Sbjct: 154 TQSGDVALAKLEEAVKKVQTDKKNQRFVKV-TILRQDSKSFDKLQEK------------- 199

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                           +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 200 --------------------------------ERHALAVQKERRAAMALARNELLFSTIG 227

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESE---QPYDLNSWME 408
           P+ SWV W DAD+   P ++IQD+ + N  V+  NV++      + E   + YD N+W E
Sbjct: 228 PHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQRYYDEEKKESSIRAYDFNNWAE 287

Query: 409 SKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAK 468
           S+ GLELA  + ED++IVEGY+E  T+R  +AY  DA G P   + LDGVGG   L +A 
Sbjct: 288 SETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDGVGGGCTLVQAD 347

Query: 469 LFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSD 517
           + R+G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E +D
Sbjct: 348 VHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWND 396

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  187 bits (474), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/349 (32%), Positives = 176/349 (50%), Gaps = 58/349 (16%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++     N    ++ +L+  P++N        + +L+ LTYP ELI+L F+V  
Sbjct: 95  IAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQLTYPRELIELGFIVPR 151

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
               +  L+ L A  +++Q G     F +I  +                        RQA
Sbjct: 152 TGSGNVALEQLEAAVKKVQTGKKEDRFGKITIL------------------------RQA 187

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                 +++DK      + +K+           RHA++VQ  RR  M  ARN L  + + 
Sbjct: 188 -----SQSFDK------LLEKE-----------RHALEVQKERRAAMALARNELLFSTIG 225

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQ------PYDLNS 405
           PY SW+ W DAD+   P S+I+D+ + N  V+  NV++    + + EQ      PYD N+
Sbjct: 226 PYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ---RYYDQEQKKESIRPYDYNN 282

Query: 406 WMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILA 465
           W ES  GL+LA  +  D+++VEGY E  T+R  +A+  +        ++LDGVGG   L 
Sbjct: 283 WAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDGVGGGCTLV 342

Query: 466 KAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           KA + R+G  FP F F +  ETE F KMAK++GY V GLP+Y ++HI E
Sbjct: 343 KADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  185 bits (469), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 109/346 (31%), Positives = 174/346 (50%), Gaps = 52/346 (15%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           + ++DL++     +    ++ +L+  PL+         +++++ L+YP ELI+L F+V  
Sbjct: 97  IAEFDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIELGFIVPR 153

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
               D  L +L                    AV  +QT                      
Sbjct: 154 TQTGDLALQSLE------------------KAVEKTQT---------------------- 173

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                 +  ++ F  V I ++D          +RHA+ VQ  RR  M  ARN L  + + 
Sbjct: 174 ------DKKNQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALARNELLFSTIG 227

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPL---PTFLESEQPYDLNSWME 408
           P+ SWV W DAD+   P ++IQD+ + +  V+  NV++          + +PYD N+W E
Sbjct: 228 PHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASATRPYDFNNWQE 287

Query: 409 SKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAK 468
           S+ GLELA  +++D++IVEGY+E  T+R  +AY  D     +E + LDGVGG   L KA+
Sbjct: 288 SEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGCTLVKAE 347

Query: 469 LFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           + R+G  FP+F F +  ETE F KMAK++GY + GLP+Y ++HI E
Sbjct: 348 VHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  182 bits (463), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 108/346 (31%), Positives = 175/346 (50%), Gaps = 52/346 (15%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++    +     ++ +L+  P++         +++L+ LTYP ELI+L F++  
Sbjct: 99  IAHYDLNKLRSTAYAAVNKERVLILTPMQTFHKQ---YWENLLQLTYPRELIELGFIIPR 155

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
               +  L  L    +++Q+   +Q F +I  ++   ++  D+L                
Sbjct: 156 TKTGENALKELEIAIKKVQSDKKNQRFAKI-TILRQDSQSFDQL---------------- 198

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                           DRH++ VQ  RR  M  ARN L  + L 
Sbjct: 199 -----------------------------AEKDRHSILVQKERRAAMALARNELLFSTLG 229

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESE---QPYDLNSWME 408
           P+ +WV W DAD+   P ++IQD+ S +  V+  NV++      E +   +PYD N+W E
Sbjct: 230 PHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKYFDNDEKKMAIRPYDFNNWRE 289

Query: 409 SKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAK 468
           S  GLE+A  +DE+++IVEGY+E  T+R  +A+  +A+G   + ++LDGVGG   L KA 
Sbjct: 290 SDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVGGGCTLVKAD 349

Query: 469 LFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           + R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 350 VHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  182 bits (462), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 106/349 (30%), Positives = 177/349 (50%), Gaps = 58/349 (16%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++    S+ +  ++H+L+  P++   +     +++L+ L+YP ELI+L F++  
Sbjct: 96  IAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSYPRELIELGFIIPR 152

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
               D  L  L    + +Q+   +  F +I  ++  +++  DKL  +             
Sbjct: 153 SDAGDAALKKLETAVKNVQSDKKNNRFSKI-TILRQESQSFDKLEEK------------- 198

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                                           +RH++ VQ  RR  M  ARN L  + L 
Sbjct: 199 --------------------------------ERHSLAVQKERRAAMALARNELLFSTLG 226

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQ------PYDLNS 405
           P+ SWV W D+D+   P ++I+ +   +  V+  NV++    F ++++      PYD N+
Sbjct: 227 PHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQ---RFFDNDKQQDSIRPYDFNN 283

Query: 406 WMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILA 465
           W ES  GL+LA  + +D++IVEGYAE  T+R  +A+  +  GD  E + LDGVGG   L 
Sbjct: 284 WAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALDGVGGGCTLV 343

Query: 466 KAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP++ ++HI E
Sbjct: 344 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  176 bits (446), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 104/348 (29%), Positives = 175/348 (50%), Gaps = 51/348 (14%)

Query: 169 DSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 228
           +  + KYD++     S+ +  ++ +L+  P++   D     +++L++LTYP +L  L F+
Sbjct: 92  EGRIMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFI 148

Query: 229 VSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRV 288
           +      D  +  L    +++Q+G  +Q F +I  ++   ++  +KL     D+      
Sbjct: 149 IPRTPTGDVAMKRLEDAVKKVQSGKENQRFLKI-TILRQDSQSFNKL-----DEK----- 197

Query: 289 RQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 348
                                              +RHA  VQ  RR  M  ARN L  +
Sbjct: 198 -----------------------------------ERHAFNVQKERRAAMALARNELVFS 222

Query: 349 ALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPL--PTFLESEQPYDLNSW 406
            + P  SW+ W DAD+   P ++IQD+ + +  ++  NV++        E+ +PYD N+W
Sbjct: 223 TIGPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNW 282

Query: 407 MESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAK 466
            ES+ GLE+A ++ +D++IVE Y E  T+R  +A + D  G P+  + LDGVGG   L K
Sbjct: 283 QESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVK 342

Query: 467 AKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           A++ R+G  FP F F +  ETE F  MAK++ Y V GLP+Y ++H  E
Sbjct: 343 AQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  176 bits (446), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 170/348 (48%), Gaps = 57/348 (16%)

Query: 169 DSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFL 228
           D  + +YDL+  +  +      + +L+  P++         + +L+ LTYP + I L FL
Sbjct: 91  DDRLREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFL 147

Query: 229 VSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRV 288
           +   S  +T L  L    R++Q G                                    
Sbjct: 148 LPRTSSGNTALRKLEKAVRKVQTGP----------------------------------- 172

Query: 289 RQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 348
                       D+ F  + I ++DF        S RH   VQ  RR  M  ARN L  +
Sbjct: 173 -----------KDQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFS 221

Query: 349 ALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQP----YDLN 404
            + PY SWV W D+D+   P ++I+D+ S N  ++  NV++    ++E+ +P    YDLN
Sbjct: 222 TIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQ---RYVENGEPAIRAYDLN 278

Query: 405 SWMESKEGLELAKTLDEDDVIVEGYA-EYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSI 463
           +W ES+ GL++A  L ED +IVEGY  E+ T+R  +A++   +   +E++ LDGVGG   
Sbjct: 279 NWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCT 338

Query: 464 LAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWH 511
           L KA++ R+G  FP F F +  ETE F KMAK++ Y + GLP+Y ++H
Sbjct: 339 LVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  176 bits (445), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/346 (30%), Positives = 171/346 (49%), Gaps = 52/346 (15%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++    +N    ++ +L+  P++   +     + +L+ LTYP EL++L F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
            +  D  L  L A                  AV  +Q    D+ +L+             
Sbjct: 212 TTSGDNALRKLEA------------------AVKKTQLSKKDQRFLK------------- 240

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                          + I ++D          DRHA++VQ  RR  M  ARN L  + + 
Sbjct: 241 ---------------ITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALARNELLFSTIG 285

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWR---PLPTFLESEQPYDLNSWME 408
           PY SWV W DAD+   P ++IQD+ + +  V+  NV++      T  +++ PYD N+W +
Sbjct: 286 PYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNNWAD 345

Query: 409 SKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAK 468
           S   L++A ++ +D V+ EGY E  T+R  +A+       P+  + LDGVGG   L KA+
Sbjct: 346 SDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLVKAE 405

Query: 469 LFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
           + R+G  FP+F F +  ETE F KMA+++ Y + GLP+Y ++HI E
Sbjct: 406 VHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  162 bits (411), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/343 (28%), Positives = 169/343 (49%), Gaps = 51/343 (14%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++ + ++N  E ++H+L+  PL++        + +L+ L+YP + I+L F++  
Sbjct: 103 IAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPRDAIELGFIIPR 159

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
             + D +L  L +  +++Q       F +I  ++   +KG + +     ++  ++ +   
Sbjct: 160 TKKGDHSLKKLESAIKKVQTAKQGDKFSKI-TILRQNSKGFETV----PEKKEVSEI--- 211

Query: 292 FSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 351
                   Y+K  R+                               M  ARN L A+ L 
Sbjct: 212 -------EYEKQIRAE------------------------------MALARNELLASTLG 234

Query: 352 PYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESE---QPYDLNSWME 408
           P  +W+ W D+D+   P S+IQD+   +  V+  NV+         E   +PYD  +W+E
Sbjct: 235 PQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRPYDFRNWIE 294

Query: 409 SKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAK 468
           S E L+LA  + ED++IVEG A   T R  + +    +G P+  I LDGVG   +L K++
Sbjct: 295 STEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGASCLLVKSE 354

Query: 469 LFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWH 511
           + R+G  FP F F +  E+E F KMAK++ Y V GLP+Y ++H
Sbjct: 355 VHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  157 bits (396), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 102/348 (29%), Positives = 176/348 (50%), Gaps = 58/348 (16%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  YDL++   ++N +E ++H+L+  PL++  +     +++L+NL+YP +LI+L F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPN 158

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQA 291
             + D  L       +QL+N    +  Q ID  +     G++K                 
Sbjct: 159 TKKGDQIL-------KQLENAV--KNVQGIDKKL-----GSNK----------------- 187

Query: 292 FSPPFHENYDKPFRSVQIF-QKDFGQVIGQGFSDR------HAVKVQGIRRKLMGRARNW 344
                       F  + I  QKD G      F+DR      + ++++  +R  M  ARN 
Sbjct: 188 ------------FAKITILRQKDSG---FHKFNDRKDKKEMNDIELEKEKRAEMALARNE 232

Query: 345 LTANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESE--QPYD 402
           L ++ L    +W+ W D++V   P ++IQD+   +  V+  NV+       +    +PYD
Sbjct: 233 LLSSTLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYD 292

Query: 403 LNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVS 462
             +W+ES   L+LA  + ED++IVEG A   T R  +    +++G P E + LDG+G   
Sbjct: 293 FRNWIESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAAC 352

Query: 463 ILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIW 510
            L K+++ R+G  FP F F +  E+E F KMAK++ Y V GLP+Y ++
Sbjct: 353 TLVKSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 88/175 (50%), Gaps = 3/175 (1%)

Query: 335 RKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTF 394
           RK +   +N L  + L PY SWV W D+ +   P +++QDL +    ++  +++      
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIFNNSDGS 242

Query: 395 LESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVID 454
            +SE    LN+W+ S     LA  +    V++EG +   T R  +    DA       ++
Sbjct: 243 PDSET---LNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEME 299

Query: 455 LDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTI 509
           LD V     L KA++ R+G  FP F F +  ETE F +MA+ + ++  GLP+Y +
Sbjct: 300 LDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 172 VEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSD 231
           +  Y+L+    + +     +HIL+ +PL N        F++L  LTYP +LIDL  +V D
Sbjct: 79  ISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVIVPD 135

Query: 232 CSEDDTTLDAL 242
                  L AL
Sbjct: 136 SKNATGILQAL 146

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 90/210 (42%), Gaps = 35/210 (16%)

Query: 324 DRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVI 383
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  +++  +    ++I
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 384 VPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVH--LAY 441
           VP + R     + S++ YD N+W+  +       T  ED      Y  Y    V+    +
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGER-------TKPEDTSKQNNYESYVPRPVNGKTKF 474

Query: 442 IRDA----------EGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTF---------- 481
           ++D           E   + V++LD VGG  +    K+F  G+QFP F            
Sbjct: 475 LQDCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEG 534

Query: 482 ENHAETEAFGKMAKKMGYRVGGLPHYTIWH 511
            +  ETE     AK +GY+  G+P+    H
Sbjct: 535 YDGVETEGLCYQAKTLGYKCYGVPNVICRH 564

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 452 VIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWH 511
           VI+L+G G   I  KA LFR      A  ++N  ++  FG    + G+  GG+   T + 
Sbjct: 215 VINLEGTG---IGGKAVLFRTSDVSTAKIYQNAVKSNPFGNSLFQQGFYEGGVGSETDYR 271

Query: 512 IYE 514
           IYE
Sbjct: 272 IYE 274

>YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Protein
           necessary for structural stability of L-A
           double-stranded RNA-containing particles
          Length = 363

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 60/136 (44%), Gaps = 16/136 (11%)

Query: 366 LCPGS----IIQDLM----SKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKE-GLELA 416
           LC GS    II DL+    SK    IV  +W P P   + +   D+ S M+  +  + L+
Sbjct: 145 LCSGSRCLDIINDLLRVKSSKGTKPIV--IWEPFPDLCDFDHQNDIKSVMQRNDVTVILS 202

Query: 417 KTLDEDDVIVEGYAEYPTW---RVHLAYIRDAEGDPNE--VIDLDGVGGVSILAKAKLFR 471
              +E   +    ++ PT     + LA+  D   D N   ++    +G +S+  K K  R
Sbjct: 203 PNAEESSRLFGLSSKEPTSLEECLALAHRFDDFMDENNMCILRCGALGSISVSEKFKNGR 262

Query: 472 NGVQFPAFTFENHAET 487
               FPA+ F+  ++ 
Sbjct: 263 TYDHFPAYHFKTQSKV 278

>AGL343C Chr7 complement(72374..73297) [924 bp, 307 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR282C
           (BGL2) Newly annotated start codon according to
           experimentaly determined 5' end of mRNA using 5' RACE.
          Length = 307

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 63/161 (39%), Gaps = 14/161 (8%)

Query: 298 ENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWV 357
           E+  K    V+ F KD   + G  FS +    V      + GR+R  + A+ L   +++ 
Sbjct: 130 EDLAKRINEVRNFVKDIKDINGNSFSGKPVGTVDSWNVIVDGRSRPVIEASDLVMANAFS 189

Query: 358 YWRDADVELCPGSIIQDLMSKNYDV------------IVPNVWRPLPTFLESEQPYDLNS 405
           YW+   ++    S   D+M     V            +    W    +  E+ QP   N+
Sbjct: 190 YWQGQTMQNASYSFFDDIMQALQTVQTVKGSSDISFYVGETGWPTEGSSFETSQPSLENA 249

Query: 406 WMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAE 446
               KEG+   ++   + ++ E + E   W+   + I D E
Sbjct: 250 KQFWKEGICAMRSWGINTIVFEAFDE--DWKPDTSGISDVE 288

>KLTH0G10626g Chr7 (896733..897644) [912 bp, 303 aa] {ON} similar to
           uniprot|P53965 Saccharomyces cerevisiae YNL032W SIW14
           Tyrosine phosphatase that plays a role in actin filament
           organization and endocytosis localized to the cytoplasm
          Length = 303

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 29/59 (49%)

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQ 290
           C+        L+   R+LQN +L+ IF E       + +  D+ +++  D++ I R+ Q
Sbjct: 236 CNRGKHRTGCLVGCIRRLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYDEDKIKRIAQ 294

>Kpol_1003.45 s1003 (106636..107478) [843 bp, 280 aa] {ON}
           (106636..107478) [843 nt, 281 aa]
          Length = 280

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%)

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRVRQ 290
           C+        LI   R+LQN +L+ IF E       + +  D+ +++  D  YI +V +
Sbjct: 213 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIELYDDIYIKKVAE 271

>Kwal_55.20652 s55 complement(505826..507910) [2085 bp, 694 aa] {ON}
           YLL032C - Hypothetical ORF [contig 142] FULL
          Length = 694

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 8/67 (11%)

Query: 366 LCPGSIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVI 425
           +CP         +N ++I  N+W+PLP  L+  Q +D++   E KE + L      D+V+
Sbjct: 8   ICPLRTTIFFKPENSELISQNLWQPLP--LDQAQQFDIDG--EQKEAIGLVP----DNVV 59

Query: 426 VEGYAEY 432
           +  + ++
Sbjct: 60  IHSFEKF 66

>Ecym_2675 Chr2 complement(1304086..1307046) [2961 bp, 986 aa] {ON}
           similar to Ashbya gossypii AGL209W
          Length = 986

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 36/88 (40%), Gaps = 14/88 (15%)

Query: 427 EGYAEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAE 486
           E + E+P W   L Y+ + EG         G GG     KA LFR      A  + +   
Sbjct: 229 EAFFEHP-WSKELLYVVNLEGT--------GAGG-----KAVLFRTSDVSTASVYADAVR 274

Query: 487 TEAFGKMAKKMGYRVGGLPHYTIWHIYE 514
            + FG    + G+  G +   T + +YE
Sbjct: 275 QQPFGNSIYQQGFYTGNIGSETDFKVYE 302

>TPHA0C03470 Chr3 (759402..760196) [795 bp, 264 aa] {ON} Anc_2.296
           YNL032W
          Length = 264

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (45%)

Query: 232 CSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVIDSQTKGTDKLYLQYMDQNYINRV 288
           C+        LI   R+LQN +L+ IF E       + +  D+ +++  D  YI  V
Sbjct: 197 CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFSFPKARALDQQFIELYDDKYIKEV 253

>TBLA0B05460 Chr2 complement(1299725..1300549) [825 bp, 274 aa] {ON}
           Anc_2.503 YKL007W
          Length = 274

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 262 DAVIDSQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQG 321
           D  +++Q  G   L + Y +   +    +      + N  +  ++++ F+ DF + +   
Sbjct: 173 DPSLNNQLTGKIDLNVHYFEGGNVTFNSEKSFKEDNVNLSEILKTIKSFESDFEKQLDVS 232

Query: 322 FSDRHAVKVQGIRRKL-MGRAR-NW 344
           F+D +  K + +RR+L + RAR NW
Sbjct: 233 FNDLNEKKFKTLRRRLPVSRARVNW 257

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,424,547
Number of extensions: 2297293
Number of successful extensions: 6514
Number of sequences better than 10.0: 80
Number of HSP's gapped: 6571
Number of HSP's successfully gapped: 124
Length of query: 536
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 422
Effective length of database: 40,409,475
Effective search space: 17052798450
Effective search space used: 17052798450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)