Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.188.843ON54554527260.0
YML116W (ATR1)8.843ON54254123750.0
Suva_13.278.843ON55353522420.0
Skud_13.258.843ON53753622280.0
NDAI0E002808.843ON54953417390.0
CAGL0B02343g8.843ON53753316720.0
NCAS0B002908.843ON54253416450.0
KNAG0G034308.843ON54250916240.0
SAKL0D01386g8.843ON52152316080.0
KNAG0J002608.843ON55051915680.0
Suva_13.4678.843ON54352815630.0
NCAS0A02540singletonON53954415510.0
Kpol_541.168.843ON52851015380.0
NCAS0C004008.843ON51748615230.0
CAGL0M03003g8.843ON55853115240.0
Smik_13.4928.843ON54353315190.0
YMR279C8.843ON54051315150.0
Skud_13.4518.843ON53950615140.0
KAFR0B03930singletonON55553115130.0
Kwal_27.102458.843ON51551815020.0
NDAI0K004008.843ON55353714990.0
TDEL0B005508.843ON53751614890.0
KLTH0C03806g8.843ON52550714720.0
KAFR0B039408.843ON54753714540.0
TBLA0D032708.843ON55052114180.0
TPHA0C047908.843ON55648614160.0
TBLA0D03280singletonON58054514090.0
KAFR0A028408.843ON52049313920.0
TBLA0C01160singletonON60050911401e-149
Smik_15.560na 1ON5164998221e-103
Suva_8.435na 1ON5155167991e-99
YOR378Wna 1ON5154937903e-98
Skud_15.545na 1ON5164997886e-98
KLTH0C10560gna 1ON5155327842e-97
Kwal_23.6547na 1ON5115097791e-96
TDEL0G04950singletonON5125047372e-90
KLLA0B00352gna 1ON4984567162e-87
KNAG0D00130na 1ON5655385581e-63
SAKL0C06116gsingletonON1851904547e-53
CAGL0L02519gna 1ON5294644238e-45
KAFR0C04860na 1ON5344664142e-43
NCAS0A05720na 1ON5635393755e-38
NDAI0K02730singletonON6045363474e-34
KLTH0H16214gsingletonON5511451261e-06
KLLA0C18931gna 2ON5531501252e-06
SAKL0F00440gsingletonON5441171252e-06
Suva_13.2652.473ON5611451242e-06
Skud_13.2442.473ON5621171197e-06
Smik_13.2722.473ON5611291189e-06
Kwal_34.15746na 2ON5181391181e-05
YMR088C (VBA1)2.473ON5621171134e-05
SAKL0E02992g2.473ON5701441117e-05
NCAS0A078102.473ON5681981118e-05
NDAI0D010202.242ON5922241109e-05
Skud_6.16na 3ON5495501082e-04
Smik_6.24na 3ON5442411063e-04
NDAI0H022002.473ON5712051054e-04
TDEL0D06610singletonON497921029e-04
NCAS0G029902.242ON5811751010.001
KLLA0F13684g2.473ON5711371000.001
TDEL0A024902.473ON55479990.002
NCAS0C03460na 4ON630245990.002
KLLA0E24113g8.570ON575259990.002
Ecym_73992.473ON563131990.002
Suva_10.11singletonON540109970.004
CAGL0J01375g2.473ON56484960.005
SAKL0H09328g8.570ON596234940.008
ZYRO0C01430g8.272ON590122940.009
SAKL0E08756g2.242ON565145930.010
ABL040W2.473ON567147930.012
KLTH0D16962gsingletonON571143920.014
KLTH0C10142gsingletonON573132920.016
SAKL0A08228gsingletonON569146910.017
KLTH0C10120gsingletonON651135910.017
Kwal_23.48242.242ON553110910.019
AGR076C8.272ON68669910.022
Kpol_467.242.473ON370125890.024
KLLA0F03311g2.242ON542110880.043
KAFR0J009302.242ON566202870.049
YNL065W (AQR1)2.242ON586218870.061
Smik_17.11singletonON544127860.066
TDEL0F039908.272ON631106860.067
YKR105C (VBA5)singletonON582145860.070
YPR198W (SGE1)singletonON543165860.074
Skud_16.503singletonON543165840.12
SAKL0A00726gsingletonON598207840.13
ZYRO0G03234g2.473ON56279840.13
KLTH0G13464g8.272ON59369840.14
SAKL0H16808g8.272ON65768840.15
SAKL0C05588gsingletonON677149830.16
KLLA0A04631g8.272ON57969830.17
Skud_14.2672.242ON562137830.17
Smik_14.2622.242ON561137820.20
KNAG0E025602.473ON57883820.21
Kpol_543.448.272ON64348820.22
TDEL0G03260singletonON612167820.23
TBLA0F030408.272ON90669810.29
TBLA0G025502.242ON613109810.30
TBLA0E038002.242ON608263800.35
ACL172C3.245ON631290800.37
Kwal_56.237548.272ON58987800.44
Suva_13.174na 5ON541131790.47
YGR224W (AZR1)na 4ON613207790.48
TDEL0C045902.242ON529108780.73
TDEL0C045802.241ON557229780.74
Skud_13.163na 5ON547131770.88
KLTH0G09372g2.242ON551110770.97
TPHA0I017608.570ON653146761.0
Ecym_42988.272ON67866761.2
TPHA0G031502.473ON60049761.3
Suva_4.2753.245ON683165761.4
YMR011W (HXT2)na 5ON541133751.5
NDAI0B037702.242ON571270751.6
CAGL0B02079gna 4ON624145751.8
TPHA0A017508.272ON63687742.0
Smik_13.171na 5ON541133742.0
ZYRO0E10230gsingletonON558227742.1
Ecym_20855.113ON2010157742.1
KLTH0D05434g2.473ON57684732.6
ZYRO0A00330gsingletonON576127732.6
Kpol_1003.112.241ON581205732.7
Kwal_14.854na 6ON570112723.3
KAFR0J016202.242ON570157723.5
TBLA0B00840singletonON637116723.6
Smik_16.81na 4ON625127723.7
CAGL0G08624g2.242ON583260723.8
ADL258W2.242ON534205723.9
Skud_7.560na 4ON642145724.1
Skud_2.1553.245ON688163714.4
KLLA0F17776gna 7ON553162715.0
ZYRO0G21648g6.155ON488133705.6
Smik_2.1613.245ON689163706.5
TBLA0D029003.503ON691101706.5
YIL120W (QDR1)2.242ON563259706.7
Skud_6.61na 8ON546112706.7
Kpol_1004.245.530ON563151706.8
Smik_11.368singletonON580145697.7
KLTH0B00594gsingletonON618127698.4
YBR043C (QDR3)3.245ON689163699.3
TDEL0D038003.245ON640179689.6
CAGL0D02640gsingletonON564112689.8
CAGL0D02662gsingletonON564112689.8
KLLA0F10043gna 9ON528115689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.18
         (545 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...  1054   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   919   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   868   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   862   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      674   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   648   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      638   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   630   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   624   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   608   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   606   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   602   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   597   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      591   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   591   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   589   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   588   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   587   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   587   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   583   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               582   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   578   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   571   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   564   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   550   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   550   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   547   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   540   0.0  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   443   e-149
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   321   e-103
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   312   1e-99
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   308   3e-98
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   308   6e-98
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   306   2e-97
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   304   1e-96
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   288   2e-90
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   280   2e-87
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   219   1e-63
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   179   7e-53
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   167   8e-45
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     164   2e-43
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            149   5e-38
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   138   4e-34
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    53   1e-06
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    53   2e-06
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    53   2e-06
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    52   2e-06
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    50   7e-06
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    50   9e-06
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    50   1e-05
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    48   4e-05
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    47   7e-05
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    47   8e-05
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    47   9e-05
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    46   2e-04
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    45   3e-04
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    45   4e-04
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    44   9e-04
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    44   0.001
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    43   0.001
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    43   0.002
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    43   0.002
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    43   0.002
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    43   0.002
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    42   0.004
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    42   0.005
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    41   0.008
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    41   0.009
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    40   0.010
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    40   0.012
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    40   0.014
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    40   0.016
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    40   0.017
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    40   0.017
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    40   0.019
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    40   0.022
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    39   0.024
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    39   0.043
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    38   0.049
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    38   0.061
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    38   0.066
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    38   0.067
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    38   0.070
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    38   0.074
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    37   0.12 
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    37   0.13 
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    37   0.13 
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    37   0.14 
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    37   0.15 
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    37   0.16 
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    37   0.17 
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    37   0.17 
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    36   0.20 
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    36   0.21 
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    36   0.22 
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               36   0.23 
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    36   0.29 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    36   0.30 
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    35   0.35 
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    35   0.37 
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    35   0.44 
Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011...    35   0.47 
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    35   0.48 
TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.2...    35   0.73 
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    35   0.74 
Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094...    34   0.88 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    34   0.97 
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    34   1.0  
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    34   1.2  
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    34   1.3  
Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON...    34   1.4  
YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}  HXT2High-...    33   1.5  
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    33   1.6  
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    33   1.8  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    33   2.0  
Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345...    33   2.0  
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    33   2.1  
Ecym_2085 Chr2 complement(147345..153377) [6033 bp, 2010 aa] {ON...    33   2.1  
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    33   2.6  
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    33   2.6  
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    33   2.7  
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    32   3.3  
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    32   3.5  
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    32   3.6  
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    32   3.7  
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    32   3.8  
ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic ho...    32   3.9  
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    32   4.1  
Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON...    32   4.4  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    32   5.0  
ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]...    32   5.6  
Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON...    32   6.5  
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    32   6.5  
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    32   6.7  
Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W (...    32   6.7  
Kpol_1004.24 s1004 (52837..54528) [1692 bp, 563 aa] {ON} (52837....    32   6.8  
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    31   7.7  
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    31   8.4  
YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}  ...    31   9.3  
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...    31   9.6  
CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly...    31   9.8  
CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {...    31   9.8  
KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {...    31   9.9  

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/545 (95%), Positives = 518/545 (95%)

Query: 1   MSVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQ 60
           MSVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQ
Sbjct: 1   MSVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQ 60

Query: 61  NPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV 120
           NPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV
Sbjct: 61  NPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV 120

Query: 121 SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAF 180
           SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAF
Sbjct: 121 SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAF 180

Query: 181 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAF 240
           VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAF
Sbjct: 181 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAF 240

Query: 241 SIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYX 300
           SIASLINFGLSIYAIPNNIPTNIHHFSMDWIGS          NFVWNQAPISGWSQAY 
Sbjct: 241 SIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYI 300

Query: 301 XXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQ 360
                           YEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQ
Sbjct: 301 IVILIISVIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQ 360

Query: 361 FQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASV 420
           FQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASV
Sbjct: 361 FQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASV 420

Query: 421 TPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 480
           TPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC
Sbjct: 421 TPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 480

Query: 481 LGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATEN 540
           LGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATEN
Sbjct: 481 LGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATEN 540

Query: 541 DCATT 545
           DCATT
Sbjct: 541 DCATT 545

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/541 (84%), Positives = 475/541 (87%), Gaps = 6/541 (1%)

Query: 2   SVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQN 61
           S+ VL ES+       E ENE   P KKSSRDN   E+L  TAFT  EDEMV+ NQKWQN
Sbjct: 5   SLVVLTESKG------EYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQN 58

Query: 62  PKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVS 121
           P YFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVS
Sbjct: 59  PNYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVS 118

Query: 122 GSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFV 181
           GSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT YSGSDTFFII RAFQGLGIAFV
Sbjct: 119 GSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFV 178

Query: 182 LPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFS 241
           LPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTE+P QWPWAFYA+S
Sbjct: 179 LPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYS 238

Query: 242 IASLINFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXX 301
           IA+ INF LSIYAIP+ IPTNIHHFSMDWIGS          NFVWNQAPISGW+QAY  
Sbjct: 239 IAAFINFVLSIYAIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYII 298

Query: 302 XXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQF 361
                          YE+ FAK+PLLP AVIKD HMIQIMLALFFGWGSFGIFTFYYFQF
Sbjct: 299 VILIISVIFLVVFIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQF 358

Query: 362 QLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVT 421
           QLNIR YTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSV+LFFSMVAFNVGSIMASVT
Sbjct: 359 QLNIRQYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVT 418

Query: 422 PVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCL 481
           PVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCL
Sbjct: 419 PVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCL 478

Query: 482 GMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATEND 541
           GMGATVETQ++ DGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFI   +A+AA E D
Sbjct: 479 GMGATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYD 538

Query: 542 C 542
           C
Sbjct: 539 C 539

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/535 (77%), Positives = 458/535 (85%)

Query: 7   VESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFK 66
           V++  K +D +E+ENE     + SS  N  E  L     TN EDE+++  QKWQNP YFK
Sbjct: 15  VKTAGKEEDYLEIENEVALEAEDSSPRNNKEGALTTIVLTNSEDEVMKTKQKWQNPNYFK 74

Query: 67  YAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFIL 126
           Y WQEYLFIFTCMISQLLNQ+GTTQTLSIMNIL+DSFGS+ NS+SWLMASFPLVSGSFIL
Sbjct: 75  YPWQEYLFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFIL 134

Query: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVL 186
           ISGR+GDI+GLK MLL+GYV++IIWSLICG+T YSGSDTFFI+ RAFQGLGIAFVLPNVL
Sbjct: 135 ISGRMGDIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVL 194

Query: 187 GIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLI 246
           GIIGN+YVGGTFRKNIVISF+GAMAPIGATLGC FAGLIGT NPNQWPWAFYA++I ++I
Sbjct: 195 GIIGNVYVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVI 254

Query: 247 NFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXX 306
           N  LSIYAIPNNIPTN+H FSMDWIGS          N VWNQAPISGW+QAY       
Sbjct: 255 NLILSIYAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLII 314

Query: 307 XXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIR 366
                     YE+ FAKSPLLP AV+KD HMIQIML+LFFGWGSFGIFTFYYFQFQLNIR
Sbjct: 315 SVLFLVLFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIR 374

Query: 367 HYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHET 426
           HYT LWAGG+YFMFLIWGIIAALLVGF+IK VSPSV+LFF+MVAFNVGSIMASVTPVHET
Sbjct: 375 HYTPLWAGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHET 434

Query: 427 YFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT 486
           YFR Q+GTMIILSFGMDLSFPASSIIFSD LPMEYQGMAGSLVNTVVNYSMSLCLGMGAT
Sbjct: 435 YFRMQMGTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT 494

Query: 487 VETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATEND 541
           VE QLDPDGKH+LKGYRGAQYLGIGLASLAC+ISGLYMVE +I DH+AKA  E+ 
Sbjct: 495 VEMQLDPDGKHILKGYRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAVAEDK 549

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/536 (78%), Positives = 456/536 (85%), Gaps = 2/536 (0%)

Query: 1   MSVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQ 60
           M+   LV+S E   D  E ENE+V   KKSSR +G+EET+  T  T+  +EM    Q+WQ
Sbjct: 1   MNEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETV--TISTDHGEEMTVDKQRWQ 58

Query: 61  NPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV 120
           NP YFK +W EYLFIFTCMISQLLNQAGTTQTLSIMNI+++SFGS  NS++WLMASFPLV
Sbjct: 59  NPNYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLV 118

Query: 121 SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAF 180
           SGSFILISGRLGDIYGLKKML +GYV++IIWSLICG+T YSGSDTFFII RAFQGLGIAF
Sbjct: 119 SGSFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAF 178

Query: 181 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAF 240
           VLPNVLGIIGNIYV GTFRKNIVIS VGAMAP+GATLGCLFAGLIGT+NP QWPWAFYA+
Sbjct: 179 VLPNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAY 238

Query: 241 SIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYX 300
           +I S+IN  LS+Y+IPNNIPTNI HFSMDWIGS          NFVWNQAPISGW QAY 
Sbjct: 239 TITSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYI 298

Query: 301 XXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQ 360
                           YE  FAKSPLLP AV+KD HMIQIMLALFFGWGSFGIFTFYYFQ
Sbjct: 299 IVLLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQ 358

Query: 361 FQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASV 420
           FQLNIRHY+A+WAGGTYFMFLIWGIIAALLVG  IK VSPSV+LF SM+AFN+GSIMASV
Sbjct: 359 FQLNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASV 418

Query: 421 TPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 480
           TPVHETYFRTQLGTMIILSFGMD SFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC
Sbjct: 419 TPVHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 478

Query: 481 LGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKA 536
           LGMGATVET +DPDGKH+LKGYRGAQYLGIGLASLAC+ISGLYMVE  I DHKAKA
Sbjct: 479 LGMGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVERIIKDHKAKA 534

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/534 (62%), Positives = 393/534 (73%), Gaps = 3/534 (0%)

Query: 8   ESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKY 67
           E +E       +  E      K   +  SE+ L  +     ED  +  + KWQNP YF+ 
Sbjct: 15  EEKEITQSTSSIIEEECSSITKEENNEVSEDELPSS---EQEDNTIGDHSKWQNPDYFQN 71

Query: 68  AWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILI 127
            WQEYLFIF+CM+SQLLNQA T QTLSIMNI++DSF SEG  ++WL+ASFPLVSGSFILI
Sbjct: 72  KWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILI 131

Query: 128 SGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLG 187
           SGR+GDIYGLKK L+ GY+  IIWSLI G T+YS +D FFII RAFQGLGIAF+LPNV+G
Sbjct: 132 SGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMG 191

Query: 188 IIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLIN 247
           I+GNIY   T RKNIVIS +GA APIGA +G LFAGLIGTENP QWPWAFYAF+IAS IN
Sbjct: 192 IVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAIN 251

Query: 248 FGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXX 307
             +SIY+IPNNIPTNIH F+MDWIGS          NFVWNQ PI GW +AY        
Sbjct: 252 LAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIIS 311

Query: 308 XXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRH 367
                    YE+ +AKSP+LP  V K+ H+I I+ ALF GWGSFGIF+FYYF F LN+RH
Sbjct: 312 IIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRH 371

Query: 368 YTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETY 427
           Y+ALWAG TYFMF IWG +AA++VG  IK +S SV LFFSM+AFN+G IM SVTPV +TY
Sbjct: 372 YSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTY 431

Query: 428 FRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 487
           FR  LGTMIILSFGMD+SFPA++II SD L M+YQGMAGSL NT+VNYSMSLCLGMG TV
Sbjct: 432 FRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTV 491

Query: 488 ETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATEND 541
           E Q++  GK +LKGYR A+YLG+GLA L  +ISG+YM E      K + ++  D
Sbjct: 492 ERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKERLSSNRD 545

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/533 (59%), Positives = 389/533 (72%), Gaps = 19/533 (3%)

Query: 28  KKSSRDNGSEETLRGTAF--------------TNLEDEMVECNQKWQNPKYFKYAWQEYL 73
           +KS  D+  +ETL  ++                  + + ++ NQKWQNP+YF    +EYL
Sbjct: 5   RKSGTDSVQQETLSSSSSGSSFKQDNNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYL 64

Query: 74  FIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGD 133
           F+ +C +SQLLNQAG  QT  IMNI++DS  S+   ++WLMA+FPL+SGSFILISGR+GD
Sbjct: 65  FLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILISGRIGD 124

Query: 134 IYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIY 193
           IYGLKK LLVGY+ +I+WSLICG+T Y+ SD+FFI+ RAFQGLGI+ +LPN+LGI+G+IY
Sbjct: 125 IYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIY 184

Query: 194 VGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIY 253
           + G+ RKN+VIS +G MAPIGATLG +F+GLIGTE+ NQWPWAFY+++I + INF LSI+
Sbjct: 185 IAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIW 244

Query: 254 AIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXX 313
            IPN IPTN+H   MDWIGS          NFVWNQAPI GW  AY              
Sbjct: 245 LIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIA 304

Query: 314 XXXYEMWFAK-SPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALW 372
              YE+ F   +PLLP  V+K    I ++ ALFFGWGSFGIF+FYYF FQLN+RHYT LW
Sbjct: 305 FFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLW 364

Query: 373 AGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQL 432
           AGGTYFMFLIWGI+AAL+VGFTIK V PS+ LF SMVAFN GSI+ SVTP+H+TYFR  L
Sbjct: 365 AGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHL 424

Query: 433 GTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLD 492
           G MIILSFGMDLSFPASSI+ SD LP++YQGMAGSLVNT+VNYSMS CLG+   VE  ++
Sbjct: 425 GMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVN 484

Query: 493 PDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATENDCATT 545
             GK +LKGYRGA YLGIGLAS+AC+ISG  M+   I   K     E D A  
Sbjct: 485 NHGKDVLKGYRGAFYLGIGLASMACIISGALMLSEIIQGRK----NEKDSAVV 533

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/534 (59%), Positives = 389/534 (72%), Gaps = 2/534 (0%)

Query: 4   HVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPK 63
            +      ++++ ME    ++   + S   +G  E +     +  E   +E + KWQNP 
Sbjct: 3   RIFNRKSHRSEEIMESAASSI-TEETSIIKHGDIEEIEKDVISQTETPQLE-HSKWQNPD 60

Query: 64  YFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGS 123
           YF+  WQEYLFIF+CM+SQLLNQA T QTLSIMNI++DSF SEG  ++WL+ASFPLVSGS
Sbjct: 61  YFQNQWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGS 120

Query: 124 FILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLP 183
           FILISGR+GDIYGLKK L+ GY+  IIWS+I G+T YS SDTFFI+ RAFQGL IAF+LP
Sbjct: 121 FILISGRIGDIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILP 180

Query: 184 NVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIA 243
           NV+GI+GNIY   + RKNIVIS +GA APIGA  G LFAGLIGTE+P+QWPWAFYAF+IA
Sbjct: 181 NVMGIVGNIYKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIA 240

Query: 244 SLINFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXX 303
           S  N  +SIY+IPN++PTN+H F+MDWIGS          NFVWNQ PI GW  AY    
Sbjct: 241 SAFNLAISIYSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIAL 300

Query: 304 XXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQL 363
                        YE+ +A+SPLLP  V K+ H+I I+ ALF GWGSFGIF+FYYF F L
Sbjct: 301 LVVSVFFLALFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLL 360

Query: 364 NIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPV 423
           N+RHY+ALWAG TYFMF IWG +AA++VG  IK +S +  LF SMVAFN+G IM SVTPV
Sbjct: 361 NLRHYSALWAGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPV 420

Query: 424 HETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGM 483
            +TYFR  LGTMIILSFGMD+SFPA++II SD L M+YQGMAGSL NT+VNYSMSLCLGM
Sbjct: 421 DQTYFRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGM 480

Query: 484 GATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAA 537
           G TVE Q++  G  LLKGYRGA+YLGIGLA L  +I+ +Y+ E      K   A
Sbjct: 481 GTTVERQINKSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILWGKRKQHLA 534

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/509 (58%), Positives = 383/509 (75%)

Query: 33  DNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQT 92
           +N   + L     T+      + N KWQ+  YF+  WQEY+F+ TCM+SQLLNQA   QT
Sbjct: 30  ENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQT 89

Query: 93  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 152
           LS+MNIL+ SF S   +++WLMASFPLVSGSFILISGR+GDIYGLK  L+ G +  IIW+
Sbjct: 90  LSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIWA 149

Query: 153 LICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAP 212
           LI G TNY+ SDTFFI+ R+FQGLG+AF+LPNV+G +GNIY   TFRKNIVIS +GA AP
Sbjct: 150 LISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACAP 209

Query: 213 IGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIG 272
           +GA +G  FAGLIGT+NP+ WPW+FYA +IAS +    ++Y+IPN+IPTN+H FSMDWIG
Sbjct: 210 VGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWIG 269

Query: 273 SXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVI 332
           S          NFVWNQ PI GW +AY                 YE+ +A SPLLP  + 
Sbjct: 270 SGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVIT 329

Query: 333 KDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVG 392
           ++ HM+ I++ALF GWGSFGIF+FYYF F LN+RHY+ +WAGGTYFMF IWG++A+++VG
Sbjct: 330 QNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVVG 389

Query: 393 FTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSII 452
            +I+ +S S+ LFFSM+AF+VG IM SVTPV +TYFR  LGTMIILSFGMD+SFPA++II
Sbjct: 390 LSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAII 449

Query: 453 FSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGL 512
            SD+LP +YQGMAGSL NT+VNYSMSLCLGMG+TVE+Q++ +GK LLKGYR A+YLGIG+
Sbjct: 450 LSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIGI 509

Query: 513 ASLACMISGLYMVESFINDHKAKAATEND 541
           ASLA ++S +YM E    D K +  + ++
Sbjct: 510 ASLAVILSLIYMCERLWIDRKERMESTSE 538

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/523 (59%), Positives = 385/523 (73%), Gaps = 11/523 (2%)

Query: 20  ENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKW---QNPKYFKYAWQEYLFIF 76
            NE+V      S++ G++     TAFT   D  V+ ++KW   Q+P YF   W+EYLFIF
Sbjct: 6   SNESV---SSQSKELGTQS---ATAFTEHSDVQVD-DKKWPSIQDPTYFSAPWKEYLFIF 58

Query: 77  TCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYG 136
             M+SQLLNQAGTTQTLS++NILS +F S  + ++WLMASFPLVSGSFIL+SG++GDIYG
Sbjct: 59  ASMMSQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYG 118

Query: 137 LKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGG 196
           LKK LLVGYV+ IIWSLICG+T+Y+ S  FFII RAFQGLGIAF+LPN++GI+GNIYV G
Sbjct: 119 LKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAG 178

Query: 197 TFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIP 256
           T RKN+VIS +GA APIGAT+G LF+GLIGT +  +W W FYA++I + IN GLSI+ IP
Sbjct: 179 TTRKNMVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIP 237

Query: 257 NNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXX 316
           N IPTN+   SMDWIGS          NFVWNQ PI GW  AY                 
Sbjct: 238 NTIPTNVRGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFL 297

Query: 317 YEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGT 376
           YE  +A  PL+P   + ++ ++  +LA+FFGWGSFGI+TFYYF F LN+R YT LWAGG+
Sbjct: 298 YETKYANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGS 357

Query: 377 YFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMI 436
           YFMFLIWGIIAA+ VG+TIK + PS+ LF SM+AF+ G IM SVTPV +TYFR  LG MI
Sbjct: 358 YFMFLIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMI 417

Query: 437 ILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGK 496
           ILSFGMDLSFPASSII SD LPME QGMAGSLV+T++NYSMS+CLG+  TVE Q++ +G 
Sbjct: 418 ILSFGMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGD 477

Query: 497 HLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATE 539
            LLKGYR A YLGIGLASL   IS L+M+E+++   +     E
Sbjct: 478 DLLKGYRAALYLGIGLASLGVFISALFMLENYLRMRRRNVKEE 520

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/519 (57%), Positives = 368/519 (70%), Gaps = 13/519 (2%)

Query: 8   ESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKY 67
           E+E   +D   VE +     K  S ++ +E           E E  + +  WQNP YF  
Sbjct: 24  EAEYTKNDQTNVEEK-----KNCSTESEAEWCS--------ESEFTDNDTPWQNPTYFAN 70

Query: 68  AWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILI 127
            WQEY FI TCM++QLLNQAG  Q  + MNIL+D+F S    ++WLMASFPLVSGSFIL+
Sbjct: 71  RWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILV 130

Query: 128 SGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLG 187
           SGR+GDIYGLKK L+ GY++V+IWSLICG  NY+ +D FFI+CRAFQGLGIAF+LPNV+G
Sbjct: 131 SGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMG 190

Query: 188 IIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLIN 247
           +IGNIY   T RKN VISFVG  APIGA LG +++GLI  ENP QWPW FYA++I   IN
Sbjct: 191 LIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAIN 250

Query: 248 FGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXX 307
             ++IY+IP+ +PTNIH F MDW GS          NFVWNQ PI GW++ Y        
Sbjct: 251 MVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVS 310

Query: 308 XXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRH 367
                    YE+ FAKSPLLP  VIK+ H+  I+LA+F GWGSFGI+TFYY+ FQLN+RH
Sbjct: 311 VFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRH 370

Query: 368 YTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETY 427
           Y+A+WAGGT+FMF+IWG IAA LV  TIK V PSV L FSM  F VG IM SVTPVH++Y
Sbjct: 371 YSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSY 430

Query: 428 FRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 487
           ++  LG  IILSFGMDLSFPASSII SD LP +YQGMAGSLVNT+VNYS SLCLG+G+T 
Sbjct: 431 WKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTA 490

Query: 488 ETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVE 526
           E Q++ +G   LKGYR A Y+GIGL +   +++  Y+ E
Sbjct: 491 EAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFE 529

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/528 (57%), Positives = 383/528 (72%), Gaps = 9/528 (1%)

Query: 8   ESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKY 67
           +S   +   M+ E++ V     SS D    E +   A +N +   V  +  WQ+P YF  
Sbjct: 15  DSPVIDKISMKAEDKVVV----SSED----EDVTTVASSN-KSTQVSNDSPWQDPTYFSS 65

Query: 68  AWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILI 127
             +E +FI TCM++QLLNQAG T  L+IMN+LS SF SE + ++WLMASFPLV+GSFILI
Sbjct: 66  FGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILI 125

Query: 128 SGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLG 187
           SGRLGDIYGLKKML++GYV +I+WSLICG++ YS +D FFI CRAFQGLGIAF+LPNV+G
Sbjct: 126 SGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMG 185

Query: 188 IIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLIN 247
           ++G++Y  G+ RKN+VISF+GA AP G   G LF GLI  E+  QWPW FYAF+IA  +N
Sbjct: 186 LVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLN 245

Query: 248 FGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXX 307
             L+ Y+IPNNIPTN+H FSMDW GS          NFVWNQAP +GW  AY        
Sbjct: 246 MILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIIS 305

Query: 308 XXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRH 367
                    YE+ +AK PLLPHAV K+ HMI I+LA+F GWGSFGI+TFYY  FQLN+RH
Sbjct: 306 VFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRH 365

Query: 368 YTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETY 427
           Y+ +W GGTYF+F+I+G IAA +V  +IK V P+  L F++VAF+VGSIM SV PV +++
Sbjct: 366 YSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSF 425

Query: 428 FRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 487
           ++   G   IL FGMDLSFPASSII SD LPMEYQGMAGSLVNTV+NYS SLCLGMGATV
Sbjct: 426 WKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATV 485

Query: 488 ETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAK 535
           E Q++ +GK LLKGYRGA YLG+GLASL  +IS  YM+E+F N+ + +
Sbjct: 486 EHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFWNNRRDR 533

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/544 (52%), Positives = 382/544 (70%), Gaps = 9/544 (1%)

Query: 1   MSVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQ 60
           MS+  +++++  N     V     FP +  +  +  +E      ++N  D +++ +  WQ
Sbjct: 1   MSLPSILQTDSDNFSSSTVS----FPNEDKNISHNEKE-----VYSNSTDSVLDDDSPWQ 51

Query: 61  NPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV 120
           NP YF   ++EY FIFTCM++ LLNQAG TQ LS MN++S+SF S+   ++WLMASFPLV
Sbjct: 52  NPNYFSSKYKEYFFIFTCMVANLLNQAGQTQVLSTMNVISESFHSDSGKQTWLMASFPLV 111

Query: 121 SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAF 180
           SGSFILISGR+GDIYGLKK ++ GY+ +IIWSL+CG  +++ +DTFFI+CRAFQGLGI+F
Sbjct: 112 SGSFILISGRIGDIYGLKKTMIGGYIFMIIWSLLCGFADFTHNDTFFIVCRAFQGLGISF 171

Query: 181 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAF 240
           +LPNV+G+IGNIY  GT RKNIVIS +G  AP GA +G L+ GLI TEN  QWPW FYA+
Sbjct: 172 ILPNVMGLIGNIYKVGTLRKNIVISMIGLTAPTGACMGALWGGLIVTENAKQWPWIFYAY 231

Query: 241 SIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYX 300
           ++  L+N  +++Y++PN IPTN+H+F+MDWIGS          NFVWNQ P++GW +AY 
Sbjct: 232 ALTGLVNLIMALYSVPNCIPTNVHNFAMDWIGSIIGVVGLILFNFVWNQGPVAGWDKAYI 291

Query: 301 XXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQ 360
                           YE+ +  SPLLP  V K+  ++ I+  LF GWG+FGI+TFYYF 
Sbjct: 292 IVLLIISVLFLVAFVVYELKYPISPLLPVEVTKNGQILTILSILFLGWGAFGIWTFYYFA 351

Query: 361 FQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASV 420
           FQLN+R Y+ +W GGTYFMF+IWG IAAL+V FTIK V P++ LFFS + F +GS+M SV
Sbjct: 352 FQLNLRDYSPVWVGGTYFMFIIWGTIAALIVAFTIKKVGPAILLFFSALGFTMGSLMLSV 411

Query: 421 TPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 480
           TP+H+ Y+R  LG  IIL FGMDLSFPASSII SD+LPM+YQGMAGSLVNTV+NY+ SLC
Sbjct: 412 TPIHQMYWRMNLGMQIILCFGMDLSFPASSIILSDHLPMQYQGMAGSLVNTVINYATSLC 471

Query: 481 LGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATEN 540
           LGMG TVE Q++  G+ LLKGYR A YL +GL  L   I+ + +  +     + + A   
Sbjct: 472 LGMGTTVERQINKSGEDLLKGYRSALYLAVGLGGLGSCIAFINLCYTLWMKRRDRLADLK 531

Query: 541 DCAT 544
             +T
Sbjct: 532 SVST 535

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/510 (58%), Positives = 373/510 (73%), Gaps = 6/510 (1%)

Query: 36  SEETLRGTAFTNLEDE---MVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQT 92
           +EET+R    ++  DE   M   N   +NP YF    QEY FIF+CM+SQLLN AGTTQT
Sbjct: 17  AEETIRSDC-SDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAGTTQT 75

Query: 93  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 152
           LSIMN+L+    S  + K WL+ASFPLVSGSFIL+SGRLGDIYGLKKML++GYV+++IWS
Sbjct: 76  LSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVILVIWS 135

Query: 153 LICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAP 212
           LI G++ YS S  FFII RAFQGLGI+ VLPNVLG+IG IY  GT +KN+VIS VGAM+P
Sbjct: 136 LITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVGAMSP 195

Query: 213 IGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIG 272
           IGATLG LF+GL+ TE+   WPWAFYA+++A+ IN  +S Y+IPNNIPTN++  SMDWIG
Sbjct: 196 IGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSMDWIG 255

Query: 273 SXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVI 332
           S          NFVWNQAP  GW+ AY                 YE+ +A++PLLP  +I
Sbjct: 256 SFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLPSEII 315

Query: 333 KDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVG 392
           ++  +I I+ A+ FGWGSFGI+TFYYF F LN+R+Y+ LWAGG+YF+F+I G I A+  G
Sbjct: 316 RNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITAISCG 375

Query: 393 FTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSII 452
           F +K + P+V L FSMV FN+G I+ SVTPVH+TYFR  LGTMIIL  GMDLSFPASSII
Sbjct: 376 FLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPASSII 435

Query: 453 FSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGL 512
            SDNLP ++QGMAGSLVNTV+NYS SL LG+  TVE   + +G  LL+GYRGA Y GI  
Sbjct: 436 LSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYFGIAC 495

Query: 513 ASLACMISGLYMVESFINDHKAKAATENDC 542
           + +A +I+GLYMVE+  + +K +   E DC
Sbjct: 496 SGVAVLIAGLYMVETIFDSYKDRK--EKDC 523

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/486 (56%), Positives = 362/486 (74%)

Query: 50  DEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNS 109
           D ++E +  WQN +YF+   +EY FIFTCM + LLNQAG TQ LS MN++S+SF S+  +
Sbjct: 19  DSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDVGT 78

Query: 110 KSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFII 169
           ++WLMASFPLVSGSFILISGR+GDIYGLKK ++ GY+ +IIW+L+CG  +Y+ SDTFFI+
Sbjct: 79  QTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFFIV 138

Query: 170 CRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEN 229
           CRAFQGLGI+F+LPN++G++GNIY  GT RKNIVIS +G  AP GA +G L+ GLI TE+
Sbjct: 139 CRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIATES 198

Query: 230 PNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQ 289
             QWPW FYA+++A+ +N  ++IY++P N+PTN+H+F+MDW+G+          NFVWNQ
Sbjct: 199 SRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVWNQ 258

Query: 290 APISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWG 349
            P++GW++ Y                 YE+ F  SPLLP  V K+  ++ I+  LF GWG
Sbjct: 259 GPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILFLGWG 318

Query: 350 SFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMV 409
           SFGI+TFYY+ FQLN+R+Y+ LWAG T+FMF+IWG IAA +VGFTI  V P+V LFFS +
Sbjct: 319 SFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFSAL 378

Query: 410 AFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLV 469
            F +GS+M SVTP+H+TY+R  +G  IILSFGMDLSFPASSII SD+LPM+YQGMAGSLV
Sbjct: 379 GFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGSLV 438

Query: 470 NTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFI 529
           NT++NYS SLCLGMG TVE Q++  G+ LL+GYR A YL +GL  L   ++ L +     
Sbjct: 439 NTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNLCYDLW 498

Query: 530 NDHKAK 535
              K++
Sbjct: 499 RKRKSR 504

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/531 (56%), Positives = 378/531 (71%), Gaps = 7/531 (1%)

Query: 14  DDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYL 73
           D C E  +          + N  + ++         D+  E +  +QNP+YF+  ++E +
Sbjct: 34  DGCEECSSS------DECQSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVM 87

Query: 74  FIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGD 133
           FI +CM++QLLNQAG TQ+LS MN+L+D F S  + + WLMASFPLVSGSFILISGRLGD
Sbjct: 88  FIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGD 147

Query: 134 IYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIY 193
           IYGLKK L VGY+++ +WS+ICG+  Y+ SD FFI+CR+FQGLGIAF+LPN++G++GNIY
Sbjct: 148 IYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIY 207

Query: 194 VGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIY 253
             GT RKNIVIS +G MAP GA LG LF GLI TE+  QWPW FYAF IAS +N  L++Y
Sbjct: 208 KVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALY 267

Query: 254 AIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXX 313
           +IPNN+PTN+++ +MDWIGS          N VWNQAPI GW +AY              
Sbjct: 268 SIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLI 327

Query: 314 XXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWA 373
              YE+ +A SPLLP +V+++  ++ I+ ALFFGWGSFGI+T+YY+ FQLN+R YT LWA
Sbjct: 328 FVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWA 387

Query: 374 GGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLG 433
           GGT+FMF+IWG +AA +V  TIK V P+V L FSMVAF+ GSIM SVTPVH+TY+R  +G
Sbjct: 388 GGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVG 447

Query: 434 TMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDP 493
             IILSFGMDLSFPASSII SD LPM+YQGMAGSLVNTVVNYS SLCLGMG TVE Q + 
Sbjct: 448 MQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNA 507

Query: 494 DGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATENDCAT 544
            G  LLKGYR A YL IGLAS    +S +++V   I     K   E++C +
Sbjct: 508 HGADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRK-RIESECES 557

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/533 (55%), Positives = 381/533 (71%), Gaps = 9/533 (1%)

Query: 13  NDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEY 72
           +   M+V+++ V           +E+    T  ++ E   V  +  WQ+P YF    +E 
Sbjct: 20  DKTIMKVDDKVVI---------STEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKEL 70

Query: 73  LFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLG 132
           +FI TCM++QLLNQAG T  L IMN+LS SF SE N+++WLMASFPL +GSFILISGRLG
Sbjct: 71  MFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLG 130

Query: 133 DIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNI 192
           DIYGLKKMLL+GYV++IIWS+I G++ YS SD FFI CRAFQGLGIAF+LPN++G++G++
Sbjct: 131 DIYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHV 190

Query: 193 YVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSI 252
           Y  G+ RKN+VIS +GA AP G   G +F GLI TE+P QWPW FYAFSIA+ I+  ++ 
Sbjct: 191 YKVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAW 250

Query: 253 YAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXX 312
           Y+IPNN+PTN+H  SMDW GS          NFVWNQAPI+GW +AY             
Sbjct: 251 YSIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLI 310

Query: 313 XXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALW 372
               YE+ +A+ PLLPHAV K+ HMI I+LA+F GWGSFGI+TFYY  FQLN+RHY+ +W
Sbjct: 311 AFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVW 370

Query: 373 AGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQL 432
            GGTYF+F+I+G IAA  V F+IK + P++ L F+++AF+ GSIM SV PV ++Y++   
Sbjct: 371 TGGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNF 430

Query: 433 GTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLD 492
               IL FGMDLSFPASSII SD LPM+YQGMAGSLVNTV+NYS SLCLGMG TVE Q++
Sbjct: 431 AMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQIN 490

Query: 493 PDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATENDCATT 545
             G++LLKGYR A YLGIGLASL  +IS  YM+E+F N HK       +  T+
Sbjct: 491 KSGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKKRLEAETS 543

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/513 (56%), Positives = 368/513 (71%)

Query: 21  NEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMI 80
           +E +    K      +E+    T  ++ +   V  +  WQ+P YF    +E +FI TCM+
Sbjct: 19  DEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDPTYFSSFGKELMFIATCML 78

Query: 81  SQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKM 140
           +QLLNQAG T  L IMN+LS SF SE N+++WLMASFPL +GSFILISGRLGDIYGLKKM
Sbjct: 79  AQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYGLKKM 138

Query: 141 LLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRK 200
           L+VGYV+VI+WS+I G++ YS SD FFI  RAFQG+GIAF+LPN++G++G++Y  G+FRK
Sbjct: 139 LIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVGSFRK 198

Query: 201 NIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIP 260
           NIVISF+GA AP G   G LF GLI TE+PNQWPW FYAF IA+ ++  ++ Y+IPNN+P
Sbjct: 199 NIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIPNNVP 258

Query: 261 TNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMW 320
           TNIH  SMDW GS          NFVWNQAPI GW + Y                 YE  
Sbjct: 259 TNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFVYESK 318

Query: 321 FAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMF 380
           +A+ PLLP A+ K+ HMI I+LA+F GWGSFGI+TFYY  FQLN+RHY+ +W GGTYF+F
Sbjct: 319 YAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVF 378

Query: 381 LIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSF 440
           +I+G +AA  V F+IK + P++ L FS++AF+ GSIM SV PV ++Y++       IL F
Sbjct: 379 VIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCF 438

Query: 441 GMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLK 500
           GMDLSFPASSII SD LPM+YQGMAGSLVNTV+NYS SLCLGMG TVE Q++  G  LLK
Sbjct: 439 GMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGNDLLK 498

Query: 501 GYRGAQYLGIGLASLACMISGLYMVESFINDHK 533
           GYR A YLG+GLASL  +IS  YM+E+  N H+
Sbjct: 499 GYRAAVYLGVGLASLGVVISVTYMLENLWNRHR 531

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/506 (56%), Positives = 373/506 (73%)

Query: 28  KKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQA 87
           K+  +   S +    T  ++ +   +  +  WQ+P YF    +E +FI TCM++QLLNQA
Sbjct: 25  KEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIGTCMLAQLLNQA 84

Query: 88  GTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVL 147
           G T  L IMN+LS SFGSE N+++WLMASFPL +GSFILISGRLGDIYGLKKML++GYV+
Sbjct: 85  GQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLMIGYVI 144

Query: 148 VIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFV 207
           +I+WS+I G++ YS +D+FFI CRAFQG+GIAF+LPN++G++G++Y  G+ RKN+VIS +
Sbjct: 145 IIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSLRKNLVISVI 204

Query: 208 GAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFS 267
           GA  P GA  G +F GLI TE+PNQWPW FYAF IA+ I+  ++ Y+IPNN+PTN+H  S
Sbjct: 205 GACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNNVPTNVHGLS 264

Query: 268 MDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLL 327
           MDW GS          NFVWN+API+GW +AY                 YE+ +A+ PLL
Sbjct: 265 MDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYEIKYAEVPLL 324

Query: 328 PHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIA 387
           PHAV K+ HMI I+LA+F GWGSFGI+TFYY  FQLN+RHY+ +W GGTYF+F I+G IA
Sbjct: 325 PHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFAIFGTIA 384

Query: 388 ALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFP 447
           A  V F+IK + P++ L F+++AF+ GSIM SV PV ++Y++       +L FGMDLSFP
Sbjct: 385 AFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVLCFGMDLSFP 444

Query: 448 ASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQY 507
           ASSII SD LPM+YQGMAGSLVNTV+NYS SLCLGMGATVE Q++  GK++L+GYR A Y
Sbjct: 445 ASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNVLEGYRAAVY 504

Query: 508 LGIGLASLACMISGLYMVESFINDHK 533
           LGIGLASL  +IS  YM+E+  N+ K
Sbjct: 505 LGIGLASLGVLISVTYMLETVWNERK 530

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/531 (55%), Positives = 368/531 (69%), Gaps = 3/531 (0%)

Query: 10  EEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLE---DEMVECNQKWQNPKYFK 66
           E+K +         +      S  + SE+T   + F       ++  + N  WQNP YF 
Sbjct: 17  EQKQEKVNVAVKATINTLNYDSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFS 76

Query: 67  YAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFIL 126
             W+EYLFI TCM+S LLNQAG TQ  S MN++  +F ++ +SK+WLMASFPLVSGSFIL
Sbjct: 77  SRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFIL 136

Query: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVL 186
           +SGR+GDIYGLK+ ++ G +++IIWSLICG  NYS S TFFIICRAFQGLGIAFVLPNV+
Sbjct: 137 VSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVM 196

Query: 187 GIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLI 246
           G++GNIY  G+ RKNIVIS +G  AP GA  G  +AGLI T+   QWPW FYA++ A ++
Sbjct: 197 GLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGIL 256

Query: 247 NFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXX 306
           N  L+IY+IP+ +P N+H FSMDW GS          NFVWN+API GW +AY       
Sbjct: 257 NLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIF 316

Query: 307 XXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIR 366
                     YE+ FAKSPLLP AV  ++++I I+ A+F GWGSFGI+TFYY+ F LN+R
Sbjct: 317 SLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLR 376

Query: 367 HYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHET 426
            YT L AG ++ MF++WG IAA  V FTIK V PSV LF SMVAF VGSIM S+TPVH+T
Sbjct: 377 GYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQT 436

Query: 427 YFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGAT 486
           Y++   G  IIL+FGMDLSFPASSII SD LPMEYQGMAGSLVNT+VNYS SLCLGMG T
Sbjct: 437 YWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTT 496

Query: 487 VETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAA 537
            E Q++ +G  LLKGYR A Y+GIGL  +  +I+ L++ ES        AA
Sbjct: 497 AEIQVNKNGTDLLKGYRAALYVGIGLGVVGVIIAALFLFESLRQKRGRTAA 547

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/518 (54%), Positives = 372/518 (71%), Gaps = 9/518 (1%)

Query: 18  EVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFT 77
           E ++E  +   +SS   G E         + + E +    + QNP YF   W+EY+F+ +
Sbjct: 5   ENDDEENWEKLQSSSAAGEER--------DGQTEAIGPKSRLQNPDYFDKPWKEYIFVLS 56

Query: 78  CMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGL 137
            M+SQLLNQA TTQT  + ++LS    ++ + + WLMASFPLVSGSFIL+SG++GDIYGL
Sbjct: 57  SMLSQLLNQAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGL 116

Query: 138 KKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGT 197
           KK LL GYV+V+IWSLICG+++Y+ +  FF++ R+FQGLGIAFVLPNV+GI+GNIY   T
Sbjct: 117 KKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNT 176

Query: 198 FRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPN 257
             KN+V S +GA APIGATLGC+F+GLIG    + W W FYA++I + +N  ++++ IPN
Sbjct: 177 EAKNLVFSLIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPN 235

Query: 258 NIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXY 317
           NIPTN++ + MDWIGS          NFVWNQAPI+GW  AY                 Y
Sbjct: 236 NIPTNVNEYKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITY 295

Query: 318 EMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTY 377
           E+ FAK PLLPH+V+ +  ++ I+ +LFFGWGSFGI+TFYY  F LN+RHY+ LWAGGTY
Sbjct: 296 EIRFAKQPLLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTY 355

Query: 378 FMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMII 437
           FMF IWGI+A+LLVG+TI    P+V LF SMVAF+ G IM +VTPVH+TYFR  LG MII
Sbjct: 356 FMFAIWGIVASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMII 415

Query: 438 LSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKH 497
           LSFGMDLSFPA+SII SD LP +YQGMAGSLV+T+++YSMSLCLG+  T E Q++ +G  
Sbjct: 416 LSFGMDLSFPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGID 475

Query: 498 LLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAK 535
           LLKGY+ A Y+GIGLASL  +ISG +M+E +    + +
Sbjct: 476 LLKGYQAALYVGIGLASLGVVISGAFMIEDWWTSRRKR 513

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/537 (54%), Positives = 370/537 (68%), Gaps = 15/537 (2%)

Query: 21  NEAVFPPKKSSRDNGSEETLRGTAFTNLEDE------------MVECNQKWQNPKYFKYA 68
           NEA     +S+ D  S E  R TA    +DE            + E N  WQNP YF  +
Sbjct: 15  NEANLLESQSTIDCTSSE--RKTAIKEQDDEIGSDSTTTSSSSLQENNSSWQNPDYFSSS 72

Query: 69  WQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILIS 128
           ++EY+F+ TCMI+ LLNQAG +Q LS MN++SDSF S    ++WLMASFPLVSGSFILIS
Sbjct: 73  FKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILIS 132

Query: 129 GRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGI 188
           GRLGDIYGLK+M++ G++ +IIWSLICG TNY+ SDTFFI+ RAFQGLGI+F+LPNV+G+
Sbjct: 133 GRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGL 192

Query: 189 IGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINF 248
           +GNIY  GT RKN+VIS +G MAP G+  G L+ GLI TENP QWPW FYA+++A+ +  
Sbjct: 193 VGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCL 252

Query: 249 GLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXX 308
            +  Y +P+NIPTN++ F+MDWIGS          NFVWNQ PI GW +AY         
Sbjct: 253 VMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSV 312

Query: 309 XXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHY 368
                   YE+ +AK PLLP AV ++ H++ I+  LF GWGSFGI+TFYYF FQLN+R Y
Sbjct: 313 IFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREY 372

Query: 369 TALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYF 428
           + +W+GGT+F+F+I+G +AA  V  TIK V P++ LFFS + F  GSI+ SVTPVH+TY+
Sbjct: 373 SPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYW 432

Query: 429 RTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVE 488
           R   G  IIL FGMDL FPASSII SD LPM+YQGMA SLVNT+VNYS SLCLGMG TVE
Sbjct: 433 RNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVE 492

Query: 489 TQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATE-NDCAT 544
            Q++  G  LLKGYR A Y G+G+A L   I+ L +     +   AK   +   C T
Sbjct: 493 RQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIWSKRNAKDPKDLQRCGT 549

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/516 (55%), Positives = 361/516 (69%), Gaps = 5/516 (0%)

Query: 29  KSSRDNGSEETL-RGTAFTNLEDE----MVECNQKWQNPKYFKYAWQEYLFIFTCMISQL 83
           KSS +N  E  L R       E E    + E    WQ+P YFK  W E LF+ +CM+ QL
Sbjct: 16  KSSHENEIERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQL 75

Query: 84  LNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLV 143
           LNQAG+T TLS M +L     S     SWLMASFPLVSGSFILISGRLGDIYGLKKMLL+
Sbjct: 76  LNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLL 135

Query: 144 GYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIV 203
           GY+ + IWSLICG++++S +DTFFI  RAFQGLGI+FVLPN+LGI+GNIY  GT RKNIV
Sbjct: 136 GYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIV 195

Query: 204 ISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNI 263
           IS +G  APIGAT G LFAG++     + WPWAFYA++IA+ +   +S + IPN+IP N+
Sbjct: 196 ISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNV 255

Query: 264 HHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAK 323
           + F+MDWIGS          NFVWNQ+ + GW+  Y                 +E+ +AK
Sbjct: 256 NKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAK 315

Query: 324 SPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIW 383
            PLLP  V +   +I I+ +L  GWGSFGI+ FYYFQF L +R+Y+ +WAGGT+FM  I 
Sbjct: 316 VPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIV 375

Query: 384 GIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMD 443
           G IAAL VGF+IK V P+V LFFSM+AF  GSI+ SVTPVHETYFR+ LG M+ILSFGMD
Sbjct: 376 GCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMD 435

Query: 444 LSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYR 503
           LSFPA+SII SD L M+YQGMAGSLVNTVVNYSMSL LG+G T+E Q++  G  LL+G+R
Sbjct: 436 LSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFR 495

Query: 504 GAQYLGIGLASLACMISGLYMVESFINDHKAKAATE 539
            A Y  IG+ SL  +ISG+++++  +   K++   E
Sbjct: 496 AALYFAIGVGSLGILISGVFVLQKELMRSKSRKENE 531

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/507 (54%), Positives = 357/507 (70%), Gaps = 1/507 (0%)

Query: 30  SSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGT 89
           S +  GS+ + +        D ++    + QNP YF   W+EYLF+ + M+SQLLNQA  
Sbjct: 9   SKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQLLNQAAA 68

Query: 90  TQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVI 149
            Q   + ++LS+   ++ + ++WLMASFPLVSGSFIL+SG++GDIYGLKK LL GY +V+
Sbjct: 69  LQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVV 128

Query: 150 IWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGA 209
           IWSLICG+++Y+ +  FFI+ R+FQGLGIAFVLPNV GI+GNIY   T  KN+V S +GA
Sbjct: 129 IWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGA 188

Query: 210 MAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMD 269
            APIGATLGCLF+GLIGTE+   W W FYA++I + +N  ++ Y IP+NIPTN+H F MD
Sbjct: 189 CAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMD 247

Query: 270 WIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPH 329
           W+GS          NFVWNQAP  GW  AY                 +E  FAK PLLP 
Sbjct: 248 WLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFAKEPLLPR 307

Query: 330 AVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAAL 389
           AV+ +  ++ I+ +LF GWGSFGI+T+YY  F LN+RHYT LWAGG+YFMF I+G IAA 
Sbjct: 308 AVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAF 367

Query: 390 LVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPAS 449
           LVG TI    P++ L  S++AF+VG IM SVTPV +TYFR  LGTM+ILSFGMDLSFPAS
Sbjct: 368 LVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPAS 427

Query: 450 SIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLG 509
           SII SD LP +YQGMAGSLVNT++NYSMSLCLG+  T E Q++ DG  LLKGYR A Y+G
Sbjct: 428 SIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVG 487

Query: 510 IGLASLACMISGLYMVESFINDHKAKA 536
           IGLAS+   +SG Y +E +    + ++
Sbjct: 488 IGLASVGIFVSGAYAIEDWWTRRRERS 514

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/537 (51%), Positives = 366/537 (68%), Gaps = 3/537 (0%)

Query: 6   LVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGT-AFTNLEDEMVECNQKWQNPKY 64
           L + EE+ +   + +   V    ++S D  S+   +   + T+ +   +  N KWQ+P Y
Sbjct: 9   LKQQEEEKNPIEDFQTTTV--TAQTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPTY 66

Query: 65  FKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSF 124
           FK +WQEY FI TCM++ LLNQAG TQTLS MN+L+DS  S+G +K+WLMASF L SGSF
Sbjct: 67  FKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSF 126

Query: 125 ILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPN 184
           IL+SGR+GDIYGLK   + G ++  IWS++CG++ Y+ + TFFIICRAFQGLG+AFVLPN
Sbjct: 127 ILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPN 186

Query: 185 VLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIAS 244
           V+G++GNIY  G+ RKNIVISF+G MAP+G T G ++ GLI   N +QWPW F+A +IA 
Sbjct: 187 VMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAV 246

Query: 245 LINFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXX 304
            IN  + IY+IPN++PTNI++  MDWIGS          NFVWNQAPISGWS+AY     
Sbjct: 247 FINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVIL 306

Query: 305 XXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLN 364
                       YE+  A+SPLLP  V K+ H++ I+++LF GWG+FGI+TFYY+ F LN
Sbjct: 307 IVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLN 366

Query: 365 IRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVH 424
           +RH++ LWAG T+F+F+I+G + A+ V FTI  V PSV    S + F  G+I+ SVT   
Sbjct: 367 LRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPD 426

Query: 425 ETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMG 484
           +TY+R  LG  IIL+ GMDLSFP SSII SD LPM+YQGM+GSLVNT+ NY+ SLCLGMG
Sbjct: 427 QTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMG 486

Query: 485 ATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATEND 541
            T E Q +  GK +LKGYR A Y+ IGL +L    S  YM E     ++ +   E  
Sbjct: 487 TTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKK 543

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/521 (52%), Positives = 355/521 (68%), Gaps = 5/521 (0%)

Query: 12  KNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQE 71
            N+DC   E +++      S  N S   +  T  T   DE    +  +QNP YFK  +QE
Sbjct: 20  NNEDCKNPEQQSLKNIDSRSSLNSSLTQVLSTD-TADNDE----SSSYQNPDYFKNKYQE 74

Query: 72  YLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRL 131
           + FIF+ MI QLL+QAG TQTLSIMN+L+    S  + ++WLM+SFPL  GSFIL+SGRL
Sbjct: 75  FGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRL 134

Query: 132 GDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGN 191
           GDIYGLKK+LL GY++  +WS+ICG+++Y+ +D FFI  RAFQGLG+AF LPN++G+IG 
Sbjct: 135 GDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGT 194

Query: 192 IYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLS 251
           IY  G FRKN++IS +GAM+P GATLG LFAGL    + + WPW+FYAF + S +N  +S
Sbjct: 195 IYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIIS 254

Query: 252 IYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXX 311
            Y IPN+IPTNIH   MDW+GS          NFV+NQAPI GW  AY            
Sbjct: 255 WYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCAL 314

Query: 312 XXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTAL 371
                YE+ +AK+PL+P A+  +  M+ I+ +LF GWGSFGI+TFYYF F+LN+RHY+ L
Sbjct: 315 VIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPL 374

Query: 372 WAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQ 431
           WAG +YF+F+I G   A++ G TIK + PSV    SM+ F  G+I+ + TPV++T+FR  
Sbjct: 375 WAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNM 434

Query: 432 LGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQL 491
           LG M +L  GMD SFPASSII SD+LPM+YQGMAGSLVNTV+NYS S+CLGM  TVE + 
Sbjct: 435 LGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKH 494

Query: 492 DPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDH 532
           +  GK LL GYR A Y  IGLA LA  +SG YM+E    D 
Sbjct: 495 NSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLWKDR 535

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/486 (52%), Positives = 345/486 (70%)

Query: 60  QNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPL 119
           Q P+YF     E+ FIFTC++ QLLNQAGTTQ++SIMNI+++ FGSE + ++WL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 120 VSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIA 179
           VSGSFIL+ GR GDIYGLKKMLL+GY ++ IWS+ICG+T+Y+ SD FFI+ +AFQGLG++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 180 FVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYA 239
           F+LPN++G++G IY  G+ +KNI ISF+GAMAP+GAT G LF+G++  ++   WPW FYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 240 FSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAY 299
           F+I S +      + +P+N+PTN ++  MDWIGS          +FVWNQAP+ GW +AY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 300 XXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYF 359
                            YE+ +A+ PLLP A+  + H+I I+LA+F GWG+FGI++FYYF
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 360 QFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMAS 419
            F LN+RH++ +W GG YF F++ G   A  VGF IK + PS+ L  S+  F +G+++ +
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 420 VTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSL 479
           VTP  +TY+R   G M++L  GMDLSFPASSII SD LP EYQGMAGSLVNT+VNYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 480 CLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAATE 539
           CLG+  TVE Q++  G  LLKGYR A Y G+G+ +L   I+ LYM E+F  D+K K    
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKTKLA 545

Query: 540 NDCATT 545
           ND  ++
Sbjct: 546 NDIESS 551

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/545 (50%), Positives = 368/545 (67%), Gaps = 10/545 (1%)

Query: 1   MSVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFT-----NLEDEMVEC 55
           + +    ES+E+ D     +N +     + S+ N S   + G+  +     ++  E ++ 
Sbjct: 28  LDIDATPESKERKDYFQLKKNYS-----QDSQTNTSMNEVIGSISSVSNDSDINSENLQS 82

Query: 56  NQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMA 115
             K  +PKYFK    EYLFI +CM+SQ ++QAG TQ LSIMNIL++   +E + ++WLMA
Sbjct: 83  ENKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMA 142

Query: 116 SFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQG 175
           SF L  GSFIL+SGRLGDIYGLKK+LL GY ++ IWSLICG ++YS +D FFI  RAFQG
Sbjct: 143 SFTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQG 202

Query: 176 LGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPW 235
           LG+AFVLPN LG+IG IY  G+ +KN++I  +GAM+PIGATLG LFAG+IGT++P QWPW
Sbjct: 203 LGLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPW 262

Query: 236 AFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPISGW 295
           +FY+F I S  N  LS Y+IPNNIPTNI++ SMDWIG+          NFV+NQAPI GW
Sbjct: 263 SFYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGW 322

Query: 296 SQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFT 355
             AY                 YE+ +AK+PL+P A+  +  M+ I+ ALF GWG+FG +T
Sbjct: 323 QSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWT 382

Query: 356 FYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGS 415
           FYYF F LN+R YTA WAGG+YF+F++ G   A L GF +K V PSV L+ SM+ F  G 
Sbjct: 383 FYYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGC 442

Query: 416 IMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNY 475
           +M +VTP+H++YF+  LG M +L  G+DLSFPA+SII SD LP++YQGMAGSLV T+ NY
Sbjct: 443 VMLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNY 502

Query: 476 SMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHKAK 535
           S S+CLGM  +VE   + +G+++LKGYR A      LA L  ++SG+YMV + I   +  
Sbjct: 503 STSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYMVINLITIRENS 562

Query: 536 AATEN 540
            +T  
Sbjct: 563 KSTNK 567

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/493 (55%), Positives = 357/493 (72%)

Query: 50  DEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNS 109
           + +V    KWQ+P YFK ++QEYLF+ +CM +QLLNQA T QTLSIMN+LSDSF S  ++
Sbjct: 28  EVIVREKSKWQDPGYFKNSFQEYLFVGSCMTTQLLNQATTPQTLSIMNVLSDSFNSSRSN 87

Query: 110 KSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFII 169
           ++WL+ASFPLV+GSFILISGR+GDIYGLKK L+ GY+ +IIWSLICG T YS SDTF II
Sbjct: 88  QTWLVASFPLVAGSFILISGRIGDIYGLKKTLIGGYIFLIIWSLICGFTYYSKSDTFLII 147

Query: 170 CRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEN 229
            RAFQGLGIAF LPNV+G IGNIY  G+ RKN+VIS + A AP+GA +G  FAGLI TE+
Sbjct: 148 ARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKNMVISLIAASAPVGAAIGGAFAGLIVTES 207

Query: 230 PNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQ 289
           P+QWPW+FYAF+IA   N  +SIY+IP+NIPTN++ F MDWIGS          NF WNQ
Sbjct: 208 PSQWPWSFYAFAIACSFNLLISIYSIPSNIPTNVNGFKMDWIGSALIVTGLILFNFAWNQ 267

Query: 290 APISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWG 349
            PI GW  AY                 YE+ FA SPL+   +    +MI  +  LF GWG
Sbjct: 268 GPIVGWDIAYIIVLLIISVIFILAFLTYEINFAPSPLIAREITHSRNMIITIFTLFLGWG 327

Query: 350 SFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMV 409
           S+GI++FYYF F LN+RHY+ +WAGG+YF+F I+G++A+  VG +IK ++  V L FSMV
Sbjct: 328 SYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFGIFGVLASAFVGISIKKITAPVILLFSMV 387

Query: 410 AFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLV 469
            F VG+ + SV PV ++YF+  L  M IL  G+D SFPA++II SD LPMEYQGMAGSL 
Sbjct: 388 LFCVGTTLLSVAPVDQSYFKLTLAGMAILGVGLDTSFPAATIILSDGLPMEYQGMAGSLA 447

Query: 470 NTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFI 529
            T+VNYSMSLCLGMG TVE Q++ DG+ +LKGYR A+YLGIGL+ L  +++ + +++  +
Sbjct: 448 LTMVNYSMSLCLGMGNTVERQINKDGQDVLKGYRSAEYLGIGLSGLGLLLACILVIDKLV 507

Query: 530 NDHKAKAATENDC 542
             ++ K + +N  
Sbjct: 508 AKYRNKNSIKNSA 520

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  443 bits (1140), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 222/509 (43%), Positives = 311/509 (61%), Gaps = 3/509 (0%)

Query: 37  EETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIM 96
           E +L  T   N     +  +Q  + P  FK  +QE+ F+   +I Q L+Q G TQ LS M
Sbjct: 90  ESSLSATPPDN--KPFITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTM 147

Query: 97  NILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICG 156
           NIL++   +    + WLMA+FPL  G  ILISGRLGDI+GLKK+LL+GY++  IW+LICG
Sbjct: 148 NILAEELHTTKMRQPWLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICG 207

Query: 157 ITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGAT 216
            ++Y+ SD  FI+ R FQGLG+A  LPN+  +IG IY    F+KN++   +GAM+PIGAT
Sbjct: 208 FSSYAHSDDLFIVSRTFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGAT 267

Query: 217 LGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIGSXXX 276
           LG +FAGL    N   WPW+FY+F+I + +N  ++ + IPN+I  N     MDWIGS   
Sbjct: 268 LGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALG 327

Query: 277 XXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYH 336
                  NFV+NQ PI GWS AY                 YE+  A  PL+P  +  +Y 
Sbjct: 328 LFGLVVLNFVFNQTPIDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYR 387

Query: 337 MIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIK 396
           +I I+L LF GWG F I+TFYYF FQLN+RHY+ LWA  + F+ +I G I  ++    ++
Sbjct: 388 LILILLTLFCGWGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQ 447

Query: 397 NVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDN 456
            + P + LFFSM+ F  G+I+ +VTP+H+T+FR   G+M +   GM  SFP++S++ ++ 
Sbjct: 448 RMKPPILLFFSMLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAET 507

Query: 457 LPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLA 516
           LP  Y+ MAGSLVN  +NY+ S+C+GM  +     +  G+ LL G+R A YL IGL+  +
Sbjct: 508 LPTHYKSMAGSLVNVAINYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFS 567

Query: 517 CMISGLYMVESFINDHKAKAATENDCATT 545
             +SGLYM+ S   D   K   EN    T
Sbjct: 568 VFLSGLYMIGSIWTDRNQKMK-ENKLINT 595

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  321 bits (822), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/499 (37%), Positives = 280/499 (56%), Gaps = 14/499 (2%)

Query: 49  EDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGN 108
           +DE++      Q  K     W E  F+     +QL+ QAG  Q+L+ ++I+ DSFG+   
Sbjct: 22  DDEVLSDEFDVQEEKPESLLW-ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANP 80

Query: 109 SK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFF 167
            + SW  +++ L  G+FILI+GRLGDI+G KK  ++G+    +WSL+ G + YS +  FF
Sbjct: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NQIFF 139

Query: 168 IICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGT 227
             CRAFQG+G AF+LPN + I+G  Y  G  RKN+V S  GA AP G  LG +F+ ++G 
Sbjct: 140 DCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSMLG- 197

Query: 228 ENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTN--IHHFSM----DWIGSXXXXXXXX 281
                WPWA++   IA  +      Y IP+    N  +  F +    D+ GS        
Sbjct: 198 -QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLI 256

Query: 282 XXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIM 341
             NF WNQ P+ GW   Y                  E   A  PLLP A +       ++
Sbjct: 257 LFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIES-RAAFPLLPFAALSSDTAF-VL 314

Query: 342 LALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPS 401
             +  GW SFGI+ FY +QF  + R  T L +   +    I G  AAL+ GF + +  PS
Sbjct: 315 SCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPS 374

Query: 402 VYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEY 461
             +FF+M AF VG+I+ +  PVH+TY+     ++I++ +GMD+SFPA++I+ SD++P E+
Sbjct: 375 TVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEH 434

Query: 462 QGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISG 521
           QG+A SLVNTVVNYS+S+ LG+  T+E+ ++  G ++LKGYR + YLGIGL+     ++ 
Sbjct: 435 QGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAA 494

Query: 522 LYMVESFINDHKAKAATEN 540
            Y V +F+   K  +  ++
Sbjct: 495 TYAVSTFMKSKKRVSEKQH 513

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  312 bits (799), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 186/516 (36%), Positives = 288/516 (55%), Gaps = 15/516 (2%)

Query: 32  RDNGSEETLRGTAFTNLEDEMVECNQ-KWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTT 90
           R + +++ L  +A T   D+ V  NQ + Q+       W E  F+     +QL+ QAG  
Sbjct: 4   RPSVTQKNLETSAETTKTDDEVLLNQFELQDETPGSLVW-EAAFVGVLCSAQLMTQAGLG 62

Query: 91  QTLSIMNILSDSFGSEGNSK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVI 149
           Q+++ ++I+ DSFG+    + SW  +S+ L  G+FILI+GRLGDI+G +K  ++G+    
Sbjct: 63  QSIAPLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYA 122

Query: 150 IWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGA 209
           +WSL+ G + YS +  FF  CRAFQG+G AF+LPN + I+G  Y  G  RKN+V S  GA
Sbjct: 123 LWSLLAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMVFSLFGA 180

Query: 210 MAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPN-NIPT-NIHHFS 267
            AP G  LG +F+ ++G      WPWA++   IA  +      + IP+  +P+ +   F+
Sbjct: 181 SAPGGFVLGAVFSSMLG--QLAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFN 238

Query: 268 M----DWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAK 323
           M    D+ GS          NF WNQ P+ GW   Y                  E   A 
Sbjct: 239 MLERVDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIES-RAA 297

Query: 324 SPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIW 383
            PLLP A +       ++  +  GW SFGI+ FY +QF    R  + L +   +    I 
Sbjct: 298 YPLLPFAALSSDAAF-VLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAIS 356

Query: 384 GIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMD 443
           G  AA+  GF + +   S  + F+M AF VG I+ +  PVH+TY+     ++I++ +GMD
Sbjct: 357 GFCAAVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMD 416

Query: 444 LSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYR 503
           +SFPA++I+ S+++P E+QG+A SLVNTVVNYS+S+ LG+  T+E+Q++  G + LKGYR
Sbjct: 417 MSFPAATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYR 476

Query: 504 GAQYLGIGLASLACMISGLYMVESFINDHKAKAATE 539
            + Y+GIGL+ L   ++ +Y   +F+   K  +  +
Sbjct: 477 CSWYMGIGLSGLGIFVAAVYASSTFLKSKKKASEKQ 512

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  308 bits (790), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 182/493 (36%), Positives = 280/493 (56%), Gaps = 17/493 (3%)

Query: 49  EDEMV-ECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEG 107
           ED+++ E + + + PK   +   E  F+     +QL+ QAG  Q+L+ ++I+ +SFG+  
Sbjct: 22  EDKVLSEFDIQDERPKSLLW---ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGNSFGTTN 78

Query: 108 NSK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTF 166
             + SW  +++ L  G+FILI+GRLGDI+G KK  ++G+    +WSL+ G + YS +  F
Sbjct: 79  AGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NQIF 137

Query: 167 FIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIG 226
           F  CRAFQG+G AF+LPN + I+G  Y  G  RKN+V S  GA AP G  LG +F+ ++G
Sbjct: 138 FDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPGGFFLGAVFSSMLG 196

Query: 227 TENPNQWPWAFYAFSIASLINFGLSIYAIPNN-IPT-NIHHFSM----DWIGSXXXXXXX 280
                 WPWA++   IA  +      + IP+  +P+ +   F +    D+ GS       
Sbjct: 197 --QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGL 254

Query: 281 XXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQI 340
              NF WNQ P+ GW   Y                  E   A  PLLP A +       +
Sbjct: 255 ILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIES-RAAFPLLPFAALSSDTAF-V 312

Query: 341 MLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSP 400
           +  +  GW SFGI+ FY +QF  + R  T L +   +    I G  AA+  GF + +  P
Sbjct: 313 LSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPP 372

Query: 401 SVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPME 460
           S  + F+M AF VG+I+ +  PVH+TY+     ++I++ +GMD+SFPA++I+ SD++P E
Sbjct: 373 STVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHE 432

Query: 461 YQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMIS 520
           +QG+A SLVNTVVNYS+S+ LG+  T+E++++  G   LKGYR + Y+GIGL+ L   ++
Sbjct: 433 HQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVA 492

Query: 521 GLYMVESFINDHK 533
             Y   +F+   K
Sbjct: 493 ATYAWSTFMKSKK 505

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  308 bits (788), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 181/499 (36%), Positives = 272/499 (54%), Gaps = 14/499 (2%)

Query: 49  EDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGN 108
           +DE+V      Q+       W E  F+     +QL+ QAG  Q+L+ ++I+  SFG+   
Sbjct: 22  DDEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNP 80

Query: 109 SK-SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFF 167
            + SW  +++ L  G+FILI+GRLGDI+G KK  ++G+    +WSL+ G + YS +  FF
Sbjct: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NKIFF 139

Query: 168 IICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGT 227
             CRAFQG+G AF+LPN + I+G  Y  G  RKN+V S  GA AP G  LG +F+ L+G 
Sbjct: 140 DCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLG- 197

Query: 228 ENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFS------MDWIGSXXXXXXXX 281
                WPWA++   IA         + IP+    + H  S      +D+ GS        
Sbjct: 198 -QLAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLI 256

Query: 282 XXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIM 341
             NF WNQ P+ GW   Y                  E   A  PLLP A +       ++
Sbjct: 257 LFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIES-RAAFPLLPFAALSSDTAF-VL 314

Query: 342 LALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPS 401
             +  GW SFGI+ FY +QF  + R  T L +   +    + G  AAL  G+ +    PS
Sbjct: 315 SCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPS 374

Query: 402 VYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEY 461
             + F+M AF  G+I+ +  PVH+TY+     ++I++ +GMD+SFPA++I+ SD++P E+
Sbjct: 375 TVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEH 434

Query: 462 QGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISG 521
           QG+A SLVNTVVNYS+S+ LG+  T+E+ ++  G   LKGYR + Y+GIGL+ L   ++ 
Sbjct: 435 QGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAA 494

Query: 522 LYMVESFINDHKAKAATEN 540
           +Y   +F    K  +  ++
Sbjct: 495 IYAWSTFKKSKKRTSEKQH 513

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  306 bits (784), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 185/532 (34%), Positives = 281/532 (52%), Gaps = 37/532 (6%)

Query: 8   ESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKY 67
           E  +K DD +          ++S+ D G E +                +   Q P+    
Sbjct: 7   EENQKKDDGLT---------RESTHDQGQELSQ-------------PHHNGIQKPESLL- 43

Query: 68  AWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFPLVSGSFIL 126
              E  F+     +QL+ QAG  Q+++ ++I+ DSFG+    + SW  A++ L  G+FIL
Sbjct: 44  --GEAAFVGVICGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFIL 101

Query: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVL 186
           I+GRLGD+YG KK  ++G+    +WSL+ G + YS +  FF  CRAFQG+G A +LPN +
Sbjct: 102 IAGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGIGPALLLPNAI 160

Query: 187 GIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLI 246
            I+G  YV G  RK +++S  GA AP G  LG +F+ + G      WPWA++A  I    
Sbjct: 161 AILGRTYVPGR-RKAMILSLFGATAPAGFVLGAVFSSIFG--QLTWWPWAYWAMGIVCFF 217

Query: 247 NFGLSIYAIPN----NIPTNIHHFS-MDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXX 301
                I  IP      + T++  +  +D  GS          NF WNQ P+ GW   Y  
Sbjct: 218 LAVAGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTY 277

Query: 302 XXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQF 361
                           E   A  PLLP + +       ++  +  GW SFGI+ +Y++ F
Sbjct: 278 SLLIVSAVFLCVFAFIES-RAPHPLLPLSALSSDAAF-VLGCVGAGWSSFGIWIYYFWLF 335

Query: 362 QLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVT 421
              +R ++ L     +    I G+ AAL  GF I  V  S+ + F+M AF VG I+ +  
Sbjct: 336 LEELRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATA 395

Query: 422 PVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCL 481
           PV + Y+     ++I++ +GMD+SFPA++I+ SD++P E+QG+A SLVN VVNYS+S+ L
Sbjct: 396 PVKQVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGL 455

Query: 482 GMGATVETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFINDHK 533
           G+  TVE +++  G +LLKGYRGA Y+GIGL+    +I+ +Y   +F    K
Sbjct: 456 GLAGTVEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFMYEYHTFKKSKK 507

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  304 bits (779), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 181/509 (35%), Positives = 282/509 (55%), Gaps = 22/509 (4%)

Query: 45  FTNLEDEMVECNQKWQN----PKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILS 100
           F  L++E  E  Q  Q+    P+      +E LF+     +QL+ QAG  Q+++ + I+ 
Sbjct: 12  FVELKNEEGESLQLVQSHVEKPQSLM---REALFVGILSCAQLMTQAGLAQSIAPVRIIG 68

Query: 101 DSFG-SEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITN 159
           +SFG S     SW  A++ L  G+FILI+GRLGD++G KK+ +VG++   +WSL+ G + 
Sbjct: 69  NSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSV 128

Query: 160 YSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGC 219
           YS +  FF  CRA QG+G AF+LPN + I+G  Y  G  RK +V S  GA AP G  LG 
Sbjct: 129 YS-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAPGGFVLGS 186

Query: 220 LFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFS-----MDWIGSX 274
           +F+ +        WPWA++A   A L+     I  IP   P  I   +     +D  G+ 
Sbjct: 187 VFSSIF--SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGAT 244

Query: 275 XXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKD 334
                    NF WNQ P+ GW   Y                  E   A+ PLLP A +  
Sbjct: 245 TGILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIES-RARFPLLPFAALST 303

Query: 335 YHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFT 394
             +  ++  +  GW SFGI+ FY++QF  + R  + L     +    I G+ AAL  G+ 
Sbjct: 304 -DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYI 362

Query: 395 IKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFS 454
           + +V     +  +M+AF VG ++ +  P+++TY+     ++II+ +GMD+SFPA++I+ S
Sbjct: 363 LSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMIS 422

Query: 455 DNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIGLAS 514
           + +P E+QG+A SLVNTVVNYS+SL LG   T+ET+++  G + L+GYRGA Y+GIGL+ 
Sbjct: 423 NAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSG 482

Query: 515 LACMISGLY---MVESFINDHKAKAATEN 540
           L  +++ +Y    ++ F  +  ++ ++ N
Sbjct: 483 LGVLVAIVYAWSTLKKFKEEQLSEKSSNN 511

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  288 bits (737), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 167/504 (33%), Positives = 283/504 (56%), Gaps = 21/504 (4%)

Query: 45  FTNLEDEMVECNQKWQNPKYFKYAW----------QEYLFIFTCMISQLLNQAGTTQTLS 94
           F+   +  + CNQ+     Y + +W          +EY F+FT +++Q  NQAG T  L 
Sbjct: 14  FSECTERSISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMAQAFNQAGGTMILP 73

Query: 95  IMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLI 154
           ++N+LSDSF  +     +L+ S+P+V GSF+LI GRLG+++G K+ LL GY+++I+ SL+
Sbjct: 74  LVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETLLGGYIILILSSLL 128

Query: 155 CGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYV--GGTFRKNIVISFVGAMAP 212
            G++ YS S  F++ICRAFQG+G+A +LPN        Y       RK I+ + +G  A 
Sbjct: 129 GGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHRKTILSTIIGCGAS 188

Query: 213 IGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMDWIG 272
            GA LG   +G+  T + + W WA+Y ++IA+ +   LS Y++P+NI T  +   ++ +G
Sbjct: 189 TGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNI-TKKNKPCLNGLG 247

Query: 273 -SXXXXXXXXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAV 331
                       N   N A ++  + ++                 +E+ F++ P+    +
Sbjct: 248 WFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFELKFSEDPVFSKEL 307

Query: 332 IKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLV 391
             +  +  ++ ++FFGWG++GI++ Y+F+F LN+R+Y+ L AG TY   +I G +A + +
Sbjct: 308 FTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYLTLVIGGYVAEIGI 367

Query: 392 GFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSI 451
              +K   P ++L FS + F    I+ SVTP+H++YFR+ LG+MI L+ G+D SFP+S+I
Sbjct: 368 SMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFLALGLDFSFPSSAI 427

Query: 452 IFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLGIG 511
           I  + LP +Y  M   L N + NY++S   G+  +    L      L+K YR   Y  IG
Sbjct: 428 ILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSSI--ELIKYYRYVYYFAIG 485

Query: 512 LASLACMISGLYMVESFINDHKAK 535
           L+++    +G+ +  + I  ++ K
Sbjct: 486 LSAIGLFAAGIQLARASIMYYRGK 509

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  280 bits (716), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 165/456 (36%), Positives = 249/456 (54%), Gaps = 14/456 (3%)

Query: 60  QNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSK-SWLMASFP 118
           QN + +    +E   I     +QL+ QAG  Q++  + I+ DSFG +   + SW  ++F 
Sbjct: 18  QNSREWTSLLKEGFAIMVLCSAQLMTQAGLAQSIVPLQIIGDSFGIKNPGQLSWFASAFS 77

Query: 119 LVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGI 178
           L  G+FILI+GRLGD +G KK  ++G++   +WS++ G + YS +  FF  CRAFQG+G 
Sbjct: 78  LTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSILAGFSVYS-NQIFFDCCRAFQGIGP 136

Query: 179 AFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFY 238
           AF LPN + II   Y  G  ++N++ S  GA AP G  +G +F+ L+       WPWA++
Sbjct: 137 AFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPSGFVVGAVFSSLL--SEFAWWPWAYW 193

Query: 239 AFSIASLINFGLSIY-AIPNNIPTNIHHF-----SMDWIGSXXXXXXXXXXNFVWNQAPI 292
              I   +  G++ Y  IP++ P +          +D  GS          NF WNQ P+
Sbjct: 194 IMGITCFL-LGVAGYLVIPHHPPIHPDEKCSLVERIDVAGSVTGVVGLILFNFAWNQGPV 252

Query: 293 SGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFG 352
            GW  +Y                  E   AK PLLP   +     I +M  +  GW SFG
Sbjct: 253 VGWETSYTYALLIVGSAFLAAFGFIES-RAKHPLLPVRKLSS-DTIFVMGCIAAGWSSFG 310

Query: 353 IFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFN 412
           I+ +Y +Q   N+R    L +   +    I G+ AA+   F +   SPS  +  +M+AF 
Sbjct: 311 IWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAAMSTEFLLTRTSPSTVMIIAMIAFT 370

Query: 413 VGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTV 472
           VGSI+ +  PV +TY+     ++I++ +GMD+SFPA++II S  +P  +QG+A SLVNT+
Sbjct: 371 VGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPAATIILSTAMPASHQGLAASLVNTI 430

Query: 473 VNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYL 508
           +NYS+S+ LG   T+E+Q+      LLKGYRGA Y+
Sbjct: 431 INYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYM 466

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  219 bits (558), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 152/538 (28%), Positives = 258/538 (47%), Gaps = 33/538 (6%)

Query: 7   VESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFK 66
           + S+  +++   +EN+ V     S   NG +++ +     + +D + + N+    P+   
Sbjct: 4   INSDSNSENIFRLENKEVNGTYDSINFNGGDDSSKTR--RDSDDNVSDINKSAPAPEEHD 61

Query: 67  YA------------WQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKS-WL 113
                           E +F+     SQ+L  AG  Q +  M+++ + F     S S W 
Sbjct: 62  PPCTGEEATLNMSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHPSDSGWC 121

Query: 114 MASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAF 173
              +    GSF+LI+G++GD+ G K M L+GY  + +WSL+ G + Y  S  FF  CRA 
Sbjct: 122 NGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFFFFCRAA 181

Query: 174 QGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQW 233
           QG+G AF   + L I+G  Y     RKN + SF GA    G  LG +F+ L        W
Sbjct: 182 QGIGAAFTFTSALSILGKSYPPCK-RKNFIFSFFGACGSFGVVLGMVFSALF--TQLAHW 238

Query: 234 PWAFYAFSIASLINFGLSIYAIPNNI-----PTNIHHFSMDWIGSXXXXXXXXXXNFVWN 288
            WA+++ +IA ++   LSI+ IP ++      +N+ +F  D++G+          +  WN
Sbjct: 239 SWAYWSMAIACVVIIILSIFFIPGDVVEKHETSNVFYF--DYLGAFLFVTGLVLFSVAWN 296

Query: 289 QAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGW 348
           QAP  G+ + Y                  E      PLLP   I   + ++++LA+FF +
Sbjct: 297 QAPTYGFGRTYVYVLLIVSVVILALAMYVETK-VDDPLLPWTHISA-NTLKVLLAIFFAY 354

Query: 349 GSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIK-NVSPSVYLFFS 407
            SF ++  Y F+F L  +  T L A        + G+ AAL     +  +V   + +  S
Sbjct: 355 ASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQIRMLIS 414

Query: 408 MVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGS 467
           ++AF V  I+ +     +TY+     T I++SFG+D+SFP+++++ S+ +P +++G+  S
Sbjct: 415 LLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKFKGLGAS 474

Query: 468 LVNTVVNYSMSLCLGMGATVETQLDPD-----GKHLLKGYRGAQYLGIGLASLACMIS 520
           LV  V+NY+ +L     A+V     PD     G    K      Y+GIG A L  +++
Sbjct: 475 LVGAVLNYATALGPPTAASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGTAGLGTLVA 532

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  179 bits (454), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 122/190 (64%), Gaps = 34/190 (17%)

Query: 79  MISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLK 138
           M+SQLLNQ GTTQTL ++N+LS  F S    ++ L+AS PLVSGSFIL+SG++GDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 139 KMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTF 198
             LL GY  VI+WS ICG+T Y+GS  FF+I RAFQGLG+AFVLPNV+G + N+Y+ G+ 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 199 RKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNN 258
           RKN+V                                  YA+++A  +N  L ++A+P N
Sbjct: 121 RKNMV----------------------------------YAYTVAVSLNMALCVWALPWN 146

Query: 259 IPTNIHHFSM 268
           IPTN+   +M
Sbjct: 147 IPTNVRGQAM 156

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  167 bits (423), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 130/464 (28%), Positives = 225/464 (48%), Gaps = 21/464 (4%)

Query: 50  DEMVECNQKWQNPKYFKYAWQEYLFIFTCMIS-QLLNQAGTTQTLSIMNILSDSFGSE-- 106
           +++ E +   + PK     W   +F+   +IS QL+   G  Q + I   L + +  E  
Sbjct: 20  EKLTEVDTSIRLPK----TWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPA 75

Query: 107 -GNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYS-GSD 164
            G    W  AS+ L S   +LI+G+LGD+ G K+M++ G++ + IWSLI G + Y  G+ 
Sbjct: 76  KGGLVGWANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQ 135

Query: 165 TFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGL 224
            F+   RA QG+G  F++PN L I+G  Y     +K I+ S  G M   G  +G  F+ L
Sbjct: 136 AFYYTARALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSL 195

Query: 225 IGTENPNQWPWAFYAFS-IASLINFGLSIYAIPNNI---PTNIHHFS-MDWIGSXXXXXX 279
                  +W W ++A + +  L   G  ++  P+NI   P +   +   D++G+      
Sbjct: 196 FAQLT--KWAWNYWALACVCVLYTVGAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSG 253

Query: 280 XXXXNFVWNQAPISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQ 339
               +  + QA   GWS  +                  + W    PL+P   ++   ++ 
Sbjct: 254 LVLFDVAFTQASALGWSPPHTYITLIIGVILILIAMFVD-WRVDDPLVPLQHLRA-DVVV 311

Query: 340 IMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIK-NV 398
           I++ ++FG+ SF I+  +++QF   + + + L          I  I AA+     ++ N+
Sbjct: 312 ILICVYFGFLSFVIWANWFWQFYELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNI 371

Query: 399 SPSVYLFFSMVAFNVGSI-MASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNL 457
                +  SMV F V +I MA+VTP + TY+     + II  F +D++ P ++++FSD++
Sbjct: 372 KAPTMMVISMVCFLVPNILMATVTP-NTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSV 430

Query: 458 PMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKG 501
             E QG+A SL+ TV++Y++S+     A V   + P G     G
Sbjct: 431 RKESQGIAASLIITVISYAISIGPSYTAMVMWYVAPLGNDSTPG 474

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  164 bits (414), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 131/466 (28%), Positives = 227/466 (48%), Gaps = 20/466 (4%)

Query: 69  WQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSK---SWLMASFPLVSGSFI 125
           ++E + +      Q ++  G  Q +  M  ++ +F    +      W  A++   + +F+
Sbjct: 46  FKEIIIVLLISSGQFISLLGAVQGIPQMASIASTFSLRPDQNLELGWCNAAYATTATTFV 105

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSD-TFFIICRAFQGLGIAFVLPN 184
           +I+G+LGDI G K M + GY  + +WSL+ G + Y+ ++  FF  CR  QG+G AF+ P 
Sbjct: 106 IIAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLTPT 165

Query: 185 VLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIAS 244
            L ++G  Y     RKN V SF GA  P G   G +F+ L        W W +++ ++  
Sbjct: 166 GLALLGKHYPPCK-RKNYVFSFYGACGPFGIVAGSVFSALF--TQLTTWAWTYWSMAVTC 222

Query: 245 LINFGLSIYAIP-NNIPTNIHH--FSMDWIGSXXXXXXXXXXNFVWNQAPISGWSQAYXX 301
           LI   LS   IP +N P       +S D++G           + VWNQAP+S +   Y  
Sbjct: 223 LIITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYVY 282

Query: 302 XXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQF 361
                           +    K PL+P   +   ++I+ ++ +FFG+  F I+ FY ++F
Sbjct: 283 SLLIVSVVFMTMALIIDSR-VKDPLIPWKSMCS-NVIKALIVVFFGFLGFTIWLFYSWRF 340

Query: 362 QLNIRHYTALWAGGTYFMFLIWGIIAALL-VGFTIKNVSPSVYLFFSMVAFNVGSIMASV 420
            L  ++ + L A   +    I GI AA   V    K V   + L  ++ AF + +I+ S 
Sbjct: 341 YLVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILIST 400

Query: 421 TPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLC 480
             + ETY+       +I++ G+D++FP+++++ S+ +  E QG+A +L  T +NY  +L 
Sbjct: 401 MTLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTALG 460

Query: 481 LGMGATVET-QLD-----PDGKHLLKGYRGAQYLGIGLASLACMIS 520
            G+   + T Q D      DG+  +     A Y+ IG A +A +++
Sbjct: 461 PGVATLIITYQCDDCLARSDGR-FVHAVHIAGYVAIGTAGIAVVVA 505

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  149 bits (375), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 133/539 (24%), Positives = 238/539 (44%), Gaps = 40/539 (7%)

Query: 14  DDCMEVEN----EAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAW 69
           D  +++++    +   P   ++    S+ T      +NL+    +   +  NP       
Sbjct: 12  DRTLKIQDTGNTDHYLPSNSTASSLHSQRTKEQC--SNLQPAQAQDQLESMNPPPGPSRL 69

Query: 70  QEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSK---SWLMASFPLVSGSFIL 126
           +E +FI     SQ ++ A  +Q +  M+ ++  F    +      W  A+F +  G+FI+
Sbjct: 70  RECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFII 129

Query: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYS--GSDTFFIICRAFQGLGIAFVLPN 184
            +G+L D+ G K + + GY    +WSL+ GI+ Y+  G  TFF   R  QG+G A + P+
Sbjct: 130 PAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPS 189

Query: 185 VLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIAS 244
            L ++G  Y   + +KNIV S  G   P+G  +G +F+ +        W W +++ +I S
Sbjct: 190 SLALLGK-YYPPSCKKNIVFSLYGFCVPLGVVVGGVFSAIF--TQLAHWSWNYWSMAIVS 246

Query: 245 LINFGLSIYAIPNNIPTNI-------------HHFSMDWIGSXXXXXXXXXXNFVWNQAP 291
                +S + IP   P  I             H    D++G+             WNQA 
Sbjct: 247 AFFTLISCFYIP---PDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQAT 303

Query: 292 ISGWSQAYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSF 351
              +                      E ++   P++P   I     I+ +L +FF + SF
Sbjct: 304 GFKFKSVQVYVTLIVSLVCFVAMVIVE-FYVDDPIIPARKIHP-QTIKALLVVFFSYLSF 361

Query: 352 GIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSP-SVYLFFSMVA 410
            I+ FY +++   +R+ T L     +    I G IAAL     I    P  + L     +
Sbjct: 362 TIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACS 421

Query: 411 FNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVN 470
           F +  I+       E+Y+     T+II+S G+D+SFP+++++ S+ +P E +G++ +LV 
Sbjct: 422 FLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVG 481

Query: 471 TVVNYSMSLCLGMGATV------ETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLY 523
           T +NY   +   +  T+      +     D    +K    A  +GIG + +A ++ GLY
Sbjct: 482 TALNYGTGIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVV-GLY 539

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  138 bits (347), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 126/536 (23%), Positives = 236/536 (44%), Gaps = 78/536 (14%)

Query: 57  QKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSK---SWL 113
           QK Q+P        + +FIF    SQ +  A  +Q +  M+ LS  F     S     W+
Sbjct: 59  QKLQSPT--NSYLNDIIFIFLICSSQFITLASASQAILQMDSLSVWFKIPPTSTLQLGWV 116

Query: 114 MASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFI-ICRA 172
            ASF +  G+FI+++G+L DI   + + + GYV   +W+LI G  +Y   +  F+ ICR 
Sbjct: 117 NASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFLYICRG 176

Query: 173 FQGLGIAFVLPNVLGIIGNIYVGGTF---------------------------------- 198
            QG+G A + P+ L ++   Y                                       
Sbjct: 177 CQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDDDNDGD 236

Query: 199 ------------RKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIA--- 243
                        K+I  S  GA AP+G  +G +F+ +        WPW +++ SI    
Sbjct: 237 SSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIF--TQLATWPWNYWSMSIVTTL 294

Query: 244 -SLINFGLSIYAIP----NNIPTNIHHF-SMDWIGSXXXXXXXXXXNFVWNQAPISGWSQ 297
            S++++   +  IP    ++ P ++ ++ + D++G              W+QA +  +  
Sbjct: 295 LSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMYKFKT 354

Query: 298 AYXXXXXXXXXXXXXXXXXYEMWFAKSPLLPHAVIKDYH--MIQIMLALFFGWGSFGIFT 355
            +                 +E +F  +P++P   I+  H   I+ +L +FF + SF  + 
Sbjct: 355 IHVYLTLLFSLVSFIAMIIWEYYF-NNPIIP---IRQIHPGTIKALLVVFFSYISFTQWL 410

Query: 356 FYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAALL-VGFTIKNVSPSVYLFFSMVAFNVG 414
           FY ++    ++  + +     +    + GII+A   +   +K V   + L     +F + 
Sbjct: 411 FYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFLLS 470

Query: 415 SIMASVTPVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVN 474
            I+     +  +Y+  Q  ++I +S G+D+SFP+++++ ++ +P E QG+  +LV +V+N
Sbjct: 471 HILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSVLN 530

Query: 475 YSMSLCLGMGATV------ETQLDP-DGKHLLKGYRGAQYLGIGLASLACMISGLY 523
           Y  ++   +  T+          DP D K  LKG   A  +G+G + +A +I G+Y
Sbjct: 531 YGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVLI-GIY 585

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 67/145 (46%), Gaps = 10/145 (6%)

Query: 40  LRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNIL 99
           +  TA   L + +    ++ QN KY +      L    C    LLN AG    +S++  L
Sbjct: 4   MHTTAAPKLSEGIYNLRRRCQNSKY-QLIINMALIFLGCTF-DLLNVAGV---ISVIEDL 58

Query: 100 SDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICG-IT 158
            +++G E  + SW + S+ +     I   GRLGDI G   +  +      ++ L+C  +T
Sbjct: 59  GETYGLEYTTASWALTSYAITFAGLIAFMGRLGDIIGNSVLFTISGFFFSLFCLLCAVVT 118

Query: 159 NYSGSDTFFIICRAFQGLGIAFVLP 183
           N+      F + RA QG+  A ++P
Sbjct: 119 NFPA----FAVLRALQGIAAAGLVP 139

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 73/150 (48%), Gaps = 8/150 (5%)

Query: 76  FTC-MISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDI 134
           F C +I+  L+ A     + ++  +   F        W + S+ +    FI   GR+GDI
Sbjct: 25  FICILIACGLDLASVGAMIVLVTDIETRFNVSHTQSGWALTSYVITFAGFIAFFGRVGDI 84

Query: 135 YGLKKMLLVGYVLVIIWSLICGIT-NYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIY 193
            G   M+ V  V+  I+SL+C +  N+      F + RAFQG+  A ++P    ++  ++
Sbjct: 85  VGNGIMMCVFSVIFGIFSLLCAVVPNFIA----FTVFRAFQGMAGAGIVPCAYALVNKMF 140

Query: 194 VGGTFRK--NIVISFVGAMAPIGATLGCLF 221
            G   ++  +I+ S + AMA +G  +G  F
Sbjct: 141 QGPNLQRYFSILSSVISAMAGVGFIIGGAF 170

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 57/117 (48%), Gaps = 3/117 (2%)

Query: 68  AWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILI 127
           ++  Y+ +   M+S   +    T  LS    + +++  E  + SW + ++ +    FI  
Sbjct: 20  SFHRYINLVLIMVSCAFDLINVTAVLSATRDIENTYQIEFTTASWALTAYAITFAGFIAF 79

Query: 128 SGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPN 184
            GR+GDI G   + +    L  I SLIC + N  G+   F + RA QG+  A ++P+
Sbjct: 80  LGRVGDIIGNSVLFVSSCFLFSILSLICAVVNNFGT---FAVFRALQGIAAAGIVPS 133

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 41/218 (18%), Positives = 89/218 (40%), Gaps = 7/218 (3%)

Query: 326 LLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGI 385
           L+P  V+   + I I +A+F  +G      +   Q+   +   + L A       ++  +
Sbjct: 303 LIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLPLVVSML 362

Query: 386 IAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVH----ETYFRTQLGTMIILSFG 441
           I  +++      +SP   +        +GSI+  +  +H      Y++    +  +++FG
Sbjct: 363 IPNVVIAIKSDLISPRKAVVLGFFIMFIGSII--LIQLHLITDNLYWKIFFCSQSLIAFG 420

Query: 442 MDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDP-DGKHLLK 500
             + FP S  I     P EY+G+A  ++ T   + + +   +  ++   ++   GK    
Sbjct: 421 AAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINELSGKSGSA 480

Query: 501 GYRGAQYLGIGLASLACMISGLYMVESFINDHKAKAAT 538
           G    ++      +LA  + GL     F+ ++K    T
Sbjct: 481 GIYKTRFQNCTYFTLASSVVGLISTAFFVKENKPTDDT 518

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 72/145 (49%), Gaps = 14/145 (9%)

Query: 38  ETLRGTAFTNL-----EDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQT 92
           ETL  TA  NL     E E++   QK+     +  A  ++  +F+  +   L+   +T  
Sbjct: 2   ETLDETA--NLLPAPEEAEVLPLEQKYHE---YNLALPKFPILFSLWLGSFLSSLDSTIV 56

Query: 93  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 152
            +IMN +++ F SE + K W+  SF L + +F  + G+L DI G +  LL        + 
Sbjct: 57  ANIMNRVAEEF-SESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQ---FFFG 112

Query: 153 LICGITNYSGSDTFFIICRAFQGLG 177
           L C +T ++ + T F I RA  G+G
Sbjct: 113 LGCLMTCFARNVTEFSIARAVCGIG 137

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 62/117 (52%), Gaps = 6/117 (5%)

Query: 63  KYFKY--AWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV 120
           KY +Y  A  ++  +F+  +   L+   +T   +IMN +++ F SE + K W+  SF L 
Sbjct: 25  KYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDF-SESSRKQWIATSFLLT 83

Query: 121 SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLG 177
           + +F  + G+L DI G K  LL+       + L C +T ++ + T F I RA  G+G
Sbjct: 84  NTAFQPLYGKLSDITGRKSALLIAQ---FFFGLGCLLTCFARNVTEFSIARAICGIG 137

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 64/129 (49%), Gaps = 7/129 (5%)

Query: 49  EDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGN 108
           E E +   QK+     +  A  ++  +F+  +   L+    T   +IMN +++ F SE +
Sbjct: 16  EVETLPLEQKFHE---YNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEF-SESS 71

Query: 109 SKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFI 168
            K W+  SF L + +F  + G+L DI G K  LL  +     + + C +T ++ + T F 
Sbjct: 72  RKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAH---FFFGIGCLLTCFARNVTEFS 128

Query: 169 ICRAFQGLG 177
           I RA  G+G
Sbjct: 129 IARAICGIG 137

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 8/139 (5%)

Query: 45  FTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFG 104
           F  L + +     K QN +Y +      L  F C    LLN AG    +S++  L +++ 
Sbjct: 5   FGKLRNGLKCLRLKCQNSRY-QLGINITLIFFGCTF-DLLNVAGV---ISVIEDLGETYK 59

Query: 105 SEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSD 164
                 SW + S+ +    FI   GRLGDI G   +  +   L  ++SL+C +     + 
Sbjct: 60  LGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAVVRDFPT- 118

Query: 165 TFFIICRAFQGLGIAFVLP 183
             F + RA QG+  A ++P
Sbjct: 119 --FAVFRALQGISAAGIVP 135

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 63  KYFKY--AWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLV 120
           K+ +Y  A  ++  +F+  +   L+   +T   +IMN +++ F SE + K W+  SF L 
Sbjct: 25  KFHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEF-SESSKKQWIATSFLLT 83

Query: 121 SGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLG 177
           + +F  + G+L DI G K  LL        + L C +T ++ + T F I RA  G+G
Sbjct: 84  NTAFQPLYGKLSDITGRKSALLTAQ---FFFGLGCLLTCFARNVTEFSIARAICGIG 137

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 69/144 (47%), Gaps = 8/144 (5%)

Query: 32  RDNGSEETLRGTAFT-NLEDEMVECNQKWQNPKYFKYAWQ--EYLFIFTCMISQLLNQAG 88
           R N   +TL   + + NLEDE    N   +  +Y K+     +   +F+  +   L    
Sbjct: 9   RTNLLPDTLDPQSLSLNLEDEFNRKNSSLEE-EYHKHNLDLPKLPIVFSLWMGSFLGALD 67

Query: 89  TTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLV 148
            T   +IMN +++ F  E + K W+  SF L + +F  + G+L DI G K  LLV +   
Sbjct: 68  GTIVANIMNRVAEEF-QESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTF- 125

Query: 149 IIWSLICGITNYSGSDTFFIICRA 172
             + L C +T ++ + T F I RA
Sbjct: 126 --FCLGCLLTCFARNVTEFSIARA 147

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 87/198 (43%), Gaps = 23/198 (11%)

Query: 27  PKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQ 86
           P +SS ++G E+         LE++  E N     PK+          + +  +   L+ 
Sbjct: 12  PIRSSIEDGEEDN-------GLEEQYHEYNLSL--PKF--------PILLSLWLGSFLSS 54

Query: 87  AGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYV 146
             +T   +IMN +++ F  E + K W+  SF L + +F  + G+L DI G K  +L  + 
Sbjct: 55  LDSTIVANIMNKVAEEF-EESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSH- 112

Query: 147 LVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISF 206
               + L C +T ++ + T F I RA  G+G   V  N +  I    +  T  + I   +
Sbjct: 113 --FFFGLGCFLTCFAQNITQFSIARAICGIGAGGV--NAMSSITVSDICSTRERGIYQGY 168

Query: 207 VGAMAPIGATLGCLFAGL 224
              +  +G  LG    GL
Sbjct: 169 ANIVFGLGQLLGAPLGGL 186

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 100/224 (44%), Gaps = 15/224 (6%)

Query: 49  EDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGN 108
           ++E +E   +   P       Q++  +F  ++    +  G+      +  L   F  + N
Sbjct: 78  DEEKLEQTSESTAPYTLLSYKQKWGMVFLLVMCGFWSSLGSPIYYPALRQLEKEFNMDEN 137

Query: 109 SKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFI 168
             +  +  + L  G    +SG L D++G + ++L G V+ ++ S+       + + ++ +
Sbjct: 138 KVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASI-----GLACAPSYGV 192

Query: 169 IC--RAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIG 226
           IC  R  Q +GI+  +    G++G+  +     K+   +FVGA + +   LG  F  LIG
Sbjct: 193 ICFLRCIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATSGL-VLLGQCFGSLIG 246

Query: 227 TENPNQWPWA--FYAFSIASLINFGLSIYAIPNNIPTNIHHFSM 268
                +W W   F+  +I S +   ++ + +P    T + + S+
Sbjct: 247 AVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIVGNLSI 290

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 110/550 (20%), Positives = 204/550 (37%), Gaps = 74/550 (13%)

Query: 47  NLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSE 106
            L + + E   K Q  +Y +      L    C    LLN A     +S+++ L+ ++   
Sbjct: 8   KLSNALEEIRNKCQKSRY-QLNVNVGLIFLGCTF-DLLNVA---SMISLIDDLAKTYNIS 62

Query: 107 GNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT-NYSGSDT 165
             + SW + S+ +    FI   GRLGDI G   +  +      + SL+C +  N+     
Sbjct: 63  YTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLCAVMPNFPA--- 119

Query: 166 FFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLI 225
            F + RA QG+  A ++P    +I  +      +K   I   G  + IG  LG +  G  
Sbjct: 120 -FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGAF 176

Query: 226 GTENPNQWPWAFYAFSIASLIN-------FGL-SIYAIPNNIPTNIHHFSMDWIGSXXXX 277
            T         +  F++ +LI+       +G+  +   P     +    S+D+IGS    
Sbjct: 177 ATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTSVKSLDFIGSLIFV 236

Query: 278 XXXXXXNF-------VWNQAPIS---------------GWSQAYXXXXXXXXXXXXXXXX 315
                           WN+ P++                W+  Y                
Sbjct: 237 AGSILIVVGLTEGGESWNR-PVTYVTLVIGIILFFGFFVWNCTYTKIVRGFKYCGIDTSK 295

Query: 316 XYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYF--QFQLNIRHYTALWA 373
            +E       L+P  V+   + I I+LA  F   +  +F+  Y   Q+       + L A
Sbjct: 296 YFE---KVQLLIPIDVLFMKNFIPIVLA--FALNNACLFSCLYIIDQYSQYAERNSPLLA 350

Query: 374 GGTYFMFLIWGIIAALLVGFTIKNVSPSVYL---FFSMVAFNVGSIMASVTPVHETYF-R 429
           G      +I  +I   L  F    + P V +   FF  +A ++  I+  +  V E  F +
Sbjct: 351 GVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGFFLALAGSI--ILIQLHLVKEDLFWK 408

Query: 430 TQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVET 489
                  ++ FG+ + +P +  I     P E +G+A  +  T     + +   + A+V  
Sbjct: 409 IFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMASVLG 468

Query: 490 QLDP-DGK-----HLLKGYRGAQYLGIGLASLACMISGLYM------------VESFIND 531
            ++   GK         G++   Y  + + +L  +++ + +            +ES ++ 
Sbjct: 469 NINEMKGKSNAIQKFRTGFQNCSYFTVAVGALGFLVTAICIRDIPPLNDDMSDLESSVHR 528

Query: 532 HKAKAATEND 541
            K +   E D
Sbjct: 529 TKVEFDREKD 538

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 91/241 (37%), Gaps = 28/241 (11%)

Query: 46  TNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGS 105
            NL   + E   K Q   Y +      L    C    LLN A     +S+++ L+  +  
Sbjct: 7   ANLTKALQEIRNKCQKSPY-QLNVNVGLIFLGCTF-DLLNVA---SMISLIDDLAKKYNI 61

Query: 106 EGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT-NYSGSD 164
              + SW + S+ +    FI   GRLGDI G   +  +      I SL+C +  N+    
Sbjct: 62  SYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLCAVMPNFPA-- 119

Query: 165 TFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGL 224
             F + RA QG+  A ++P    +I  +      +K   I   G  + IG  LG +  G 
Sbjct: 120 --FAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIG--LGLIIGGA 175

Query: 225 IGTENPNQWPWAFYAFSIASLI------------NFGLSIYAIPNNIPTNIHHFSMDWIG 272
                       +  F++ SLI            NF       P  I       S+D+IG
Sbjct: 176 FAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVENFDKK----PQKIQAQTSVKSLDFIG 231

Query: 273 S 273
           S
Sbjct: 232 S 232

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 83/205 (40%), Gaps = 21/205 (10%)

Query: 20  ENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCM 79
           E  ++ P + +      EE   G    +LE +  E N            W          
Sbjct: 6   ETSSLLPARSTI-----EEVPEGEYEISLEKKYHEHNLSLPKVPILSSLW---------- 50

Query: 80  ISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKK 139
           +    +   +T   +IMN +++ F +E + K W+  SF L + +F  + G+L DI G K 
Sbjct: 51  LGSFFSSLDSTIVANIMNRVAEEF-AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKF 109

Query: 140 MLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFR 199
            +L  +     + L C +T ++ + T F I RA  G+G   +  N +  I    +  T  
Sbjct: 110 AVLTAHFF---FGLGCLLTCFAQNVTQFSIARAICGMGAGGI--NAMSSITTSDICTTRE 164

Query: 200 KNIVISFVGAMAPIGATLGCLFAGL 224
           + I   +   +  +G  LG    GL
Sbjct: 165 RGIFQGYANIVFGMGQVLGAPLGGL 189

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 5/92 (5%)

Query: 89  TTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLV 148
            +  +S+++ LS  +     + SW + S+ +    FI   GRLGDI G  ++  V     
Sbjct: 45  VSSMISLIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCF 104

Query: 149 IIWSLICGIT-NYSGSDTFFIICRAFQGLGIA 179
            I SL+CG+  N+      F + RA QG+  A
Sbjct: 105 AILSLLCGLMPNFEA----FAVMRALQGIAAA 132

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 78/175 (44%), Gaps = 11/175 (6%)

Query: 96  MNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLIC 155
           +  L   FG + N  +  +  + L  G    ISG L D++G + ++L+G ++ ++ S+  
Sbjct: 114 LRQLEKQFGLDENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASIGL 173

Query: 156 GITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGA 215
                 G   F    R  Q +GI+  +    G++G+  +     K+   +FVGA + +  
Sbjct: 174 ACAPSYGVIVFL---RIIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATSGL-V 224

Query: 216 TLGCLFAGLIGTENPNQWPWA--FYAFSIASLINFGLSIYAIPNNIPTNIHHFSM 268
            LG  F  LIG      W W   F+  +I    +F ++   +P    T + + S+
Sbjct: 225 LLGQCFGSLIGAVLAAAWNWRAIFWFLTIGCGTSFIIAFLLLPETKRTLVGNLSI 279

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 64/137 (46%), Gaps = 10/137 (7%)

Query: 41  RGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILS 100
           R T+ +  ED++ E   +         A  +   +++  +   L    +T   +IMN ++
Sbjct: 15  RITSSSADEDDLEEMYHR------HNLALPKGPILYSLWMGSFLGSLDSTIVANIMNKVA 68

Query: 101 DSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNY 160
           + F  E + K W++ SF L + +F  + G+L D+ G K  L+V +   ++    C  T  
Sbjct: 69  EEF-EESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLVG---CLFTAL 124

Query: 161 SGSDTFFIICRAFQGLG 177
           S +   F I RA  G+G
Sbjct: 125 SRNLVEFSIARAVCGMG 141

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (56%), Gaps = 4/79 (5%)

Query: 94  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 153
           +IMN +++ F SE + K W+  SF L + +F  + G+L D+ G K  LL+ Y  ++I   
Sbjct: 57  NIMNRVAEEF-SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIG-- 113

Query: 154 ICGITNYSGSDTFFIICRA 172
            C +T  + + T F + RA
Sbjct: 114 -CLLTCLARNVTEFAVARA 131

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/245 (22%), Positives = 105/245 (42%), Gaps = 21/245 (8%)

Query: 2   SVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQN 61
           S+ +  E ++  +  + +++  + P  + +    +EE+      +N     VE    + N
Sbjct: 5   SIELTGEGKKNPEILVSIDSFGIEPSMEIASHGINEESGTDAEVSN----HVEKKPNF-N 59

Query: 62  PKYFKYAWQEYL----FIFTCMISQLLNQAGTTQTL----SIMNILSDSFGSEGNSKSWL 113
            KY K A  E L     ++TC  S  L        +    +I+  ++  FG+   +  W+
Sbjct: 60  SKYGKNAMGEDLPSGIVLYTCAFSLALAIFLAALDIMIVSTIIEDVAKKFGAYSKT-GWI 118

Query: 114 MASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAF 173
            A + L +    L+ GR+  I G K  +L   ++  I SLI G+ N   S    I  R  
Sbjct: 119 FAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGVAN---SMNMLIGGRVI 175

Query: 174 QGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQW 233
            G+G + +  ++  +IG+  V    R+ ++I+ + +   + + +G    G   T     W
Sbjct: 176 AGVGGSGI-QSLAFVIGSNLVDER-RRGLIIACMSSAFAVASVIGPFLGGAFTTH--ATW 231

Query: 234 PWAFY 238
            W FY
Sbjct: 232 RWCFY 236

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 106/259 (40%), Gaps = 20/259 (7%)

Query: 7   VESEEKNDDCMEVENEAVFPPKKSSRDNGS---EETLRGTAFTNLEDEMVECNQKWQNPK 63
           +E E    D  E+++   F   KS  +  S    E    TAFT LE E+        NP 
Sbjct: 49  LEKESDMTDISEIKDTD-FDSDKSKEEQSSIVRNEKHPETAFTALEPEIA------YNPP 101

Query: 64  YFKYAWQEYLFIFTCMIS-QLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSG 122
           Y  ++  + + I   +I    L        +  + IL   F +   + +  +A+F  V  
Sbjct: 102 YSAFSNYQVVSILLIIIYIGFLGPVTGNIYIPALPILQSEFNTSTTAINGTVAAFMGVFA 161

Query: 123 SFILISGRLGDIYGLKKMLLVGYVLVIIWS-LICGITNYSGSDTFFIICRAFQGLGIAFV 181
               +     D  G K + +   ++ +I + L+  +  +  +     I R FQ +G + V
Sbjct: 162 VGPFLWAVHADFGGRKFLYIFSLMIALIANVLLAAVPKHLAA---LYILRVFQAIGTSAV 218

Query: 182 LPNVLGIIGNIYVGGTFRKNIVISFVGA-MAPIGATLGCLFAGLIGTENPNQWPWAFYAF 240
           +P  +G + ++       K +    +G  M PI   LG +F GLI   N NQW W F   
Sbjct: 219 IPLGVGTVSDLISPMNRAKGVSYFMLGPNMGPI---LGPIFGGLI-LMNGNQWRWLFGFT 274

Query: 241 SIASLINFGLSIYAIPNNI 259
           SI + +   L +  +P  +
Sbjct: 275 SITTGVGLILIVTFLPETL 293

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 64/131 (48%), Gaps = 6/131 (4%)

Query: 94  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 153
           +IMN +++ F  E +   W+  SF L S  F  I G+L D+ G + +L++ Y L +   L
Sbjct: 69  NIMNSVTEEF-KESHRIQWVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLAYSLFL---L 124

Query: 154 ICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPI 213
            C +T Y+ +   F   RA  G+G   +    +  +G+++      ++I  S+   +  I
Sbjct: 125 GCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMF--SVKEQSIYQSYAHIIYTI 182

Query: 214 GATLGCLFAGL 224
           G  LG    G+
Sbjct: 183 GEVLGAPIGGI 193

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 51/109 (46%), Gaps = 8/109 (7%)

Query: 82  QLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKML 141
            LLN A     +S+++ L+  +     + SW + S+ +    FI   GRLGDI G   + 
Sbjct: 41  DLLNVA---SMISLIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSILF 97

Query: 142 LVGYVLVIIWSLICGIT-NYSGSDTFFIICRAFQGLGIAFVLPNVLGII 189
            V      I SL+C +  N+      F + RA QG+  A ++P    +I
Sbjct: 98  TVSCFFFAILSLLCAVMPNFPA----FAVFRAIQGISAAGLVPCAYALI 142

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (54%), Gaps = 4/84 (4%)

Query: 94  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 153
           +IMN +++ F  E + K W+  S+ L + +F  + G+L D+ G K  +L  +     + L
Sbjct: 59  NIMNRVAEEF-QESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAH---FFFGL 114

Query: 154 ICGITNYSGSDTFFIICRAFQGLG 177
            C +T ++ S T F I RA  G+G
Sbjct: 115 GCLLTCFANSVTQFAIARAICGVG 138

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 95/234 (40%), Gaps = 8/234 (3%)

Query: 28  KKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMI-SQLLNQ 86
           +K S++    E    TA +  E  +   N+  + P Y  ++ ++ L IF  +I    L  
Sbjct: 94  EKKSKEELKIEKRIATATSTEETSLKSANRSKEPPPYTAFSKKQRLIIFLVIIYVGFLGP 153

Query: 87  AGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYV 146
                 +  + +L +SF     + +  ++ F  V     L      D  G K + +V  +
Sbjct: 154 LSGNIYIPALPLLQESFNVSATTINATVSVFMAVFSVGPLFWALFADFGGRKFLYIVSLL 213

Query: 147 LVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISF 206
           L II +++      +    FF+  R  Q  G + V+   +G + +I    +  + +    
Sbjct: 214 LTIIVNILLSAVPTNIGALFFL--RIAQAFGSSSVMSLGIGTVSDITPPKSRGRAVSYFM 271

Query: 207 VGA-MAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNI 259
           +G  M PI   L  + AGLI   + N W W F    I S I   L +  +P  +
Sbjct: 272 LGPNMGPI---LAPIIAGLILMSS-NNWRWLFGFICIISGIALFLVVLLLPETL 321

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 60/122 (49%), Gaps = 12/122 (9%)

Query: 41  RGTAFTNLEDEMVECNQKWQNP----KYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIM 96
           +GT + ++++E    +    +P    K        YL IF       L  A  T   +IM
Sbjct: 51  QGTDYGSIDNEDDSRDGVASSPVPPDKLLVITLSMYLGIF-------LAAADGTLVSTIM 103

Query: 97  NILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICG 156
             ++  F +E    SW+  ++ L S +F  + G+L DI+G K +L++  ++ ++  L+CG
Sbjct: 104 AHIASEF-NELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCG 162

Query: 157 IT 158
           +T
Sbjct: 163 LT 164

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 67/145 (46%), Gaps = 11/145 (7%)

Query: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVL 186
           ISG L D+YG + ++L G ++ ++ S+    +N  G   F    R  Q  GI+ ++    
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASIGLACSNSYGVIVFL---RCVQSAGISPLIAISS 208

Query: 187 GIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWA--FYAFSIAS 244
           G++G+        K+   SFVGA++   A +G  F  LIG      + W   F+  +I  
Sbjct: 209 GVVGDFTT-----KSERGSFVGAVSGF-ALMGQAFGSLIGAGLTAAYDWRAIFWFLTIGC 262

Query: 245 LINFGLSIYAIPNNIPTNIHHFSMD 269
              F ++ + +P    T   + S+ 
Sbjct: 263 GTCFVINFFLLPETKRTITGNLSIK 287

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 65/147 (44%), Gaps = 18/147 (12%)

Query: 34  NGSEETLRGTAF--------TNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCM-ISQLL 84
           + SE  LRGT          TN +  + E  +  ++ +    A      I T + +   L
Sbjct: 2   DESESQLRGTLLPHDSLEYGTNSDKTLTETQRCQEHNRSLPKAP-----ILTSLWLGSFL 56

Query: 85  NQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVG 144
                +   +IMN +++ F  E + K W+  SF L + +F  + GR  DI G K  LL+ 
Sbjct: 57  ASIDASIVANIMNKIAEEF-HESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIA 115

Query: 145 YVLVIIWSLICGITNYSGSDTFFIICR 171
               ++ +L   +T ++ + T F I R
Sbjct: 116 QSFFLLGTL---LTCFARNVTEFAIAR 139

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 60/143 (41%), Gaps = 10/143 (6%)

Query: 99  LSDSFGSEGNSKS---WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLIC 155
           L D+ G E N  +   WLMA + L +  F+L+ GR+  + GLK  L+   V+    SL+ 
Sbjct: 30  LYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLMA 89

Query: 156 GITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGA 215
           G  N  G     I  R   G G + +   V G +G   V    R   VI+ +G    +  
Sbjct: 90  GAANSMG---MLIGARVISGFGGSGIESLVYG-VGTSIVEEKHRAR-VITVLGIAYMLAE 144

Query: 216 TLGCLFAGLIGTENPNQWPWAFY 238
             G    G  G      W W FY
Sbjct: 145 GAGPFVGG--GLAEHVSWRWCFY 165

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 59/132 (44%), Gaps = 17/132 (12%)

Query: 112 WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICR 171
           WL+  + L +  F L+ GRL  I GLK  L    V+  I SLI  ++N  G     I  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMG---MIIGGR 102

Query: 172 AFQGLGIAFVLPNVLGIIGNIYVGGT-----FRKNIVISFVGAMAPIGATLGCLFAGLIG 226
              G G +       GI   ++V GT       + +VI+ +G    +   +G +  G   
Sbjct: 103 VVAGCGGS-------GIQSLVFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAF- 154

Query: 227 TENPNQWPWAFY 238
           TEN + W W FY
Sbjct: 155 TENVS-WRWCFY 165

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 8/146 (5%)

Query: 93  LSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWS 152
           ++I+N ++D F +  +   WL+  + L +  F L+ GR   I+G K  L+V  ++  I S
Sbjct: 41  VTILNTIADKFNAY-SKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGS 99

Query: 153 LICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAP 212
           L+  ++N   S    I  R   G G + +   V  I  ++    T  +  +++ +     
Sbjct: 100 LVIAVSN---SMDMIIGGRVIAGCGASGIQTLVFAIATSLVDEHT--RGTIVTLLSLSYA 154

Query: 213 IGATLGCLFAGLIGTENPNQWPWAFY 238
           + + LG    G + TE    W W FY
Sbjct: 155 VASALGPYIGGAL-TEYVT-WRWCFY 178

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 59/135 (43%), Gaps = 15/135 (11%)

Query: 108 NSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFF 167
           N   WL+  + L S  F L+ GR+  + GLK  L++  ++  I SLI  ++N  G     
Sbjct: 78  NDVGWLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMG---ML 134

Query: 168 IICRAFQGLGIAFVLPNVLGIIGNIYVGGTF----RKNIVISFVGAMAPIGATLGCLFAG 223
           I  R   G G +       GI   +Y+ GT     R   ++  V   A +G+  G    G
Sbjct: 135 IAGRVVAGAGGS-------GIQSLVYIVGTSLVSERSRGMVIMVLTFAFVGSNAGGPILG 187

Query: 224 LIGTENPNQWPWAFY 238
               E+ + W W F+
Sbjct: 188 GALNEHAS-WRWCFF 201

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 11/110 (10%)

Query: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVL 186
           ISG L D+YG + ++L+G ++ +  S+    +N  G   F    R  Q  GI+ ++    
Sbjct: 141 ISGGLADVYGRRPVILIGMLIYVCASIGLACSNSYGVIVFL---RCLQSAGISPIIAINS 197

Query: 187 GIIGNIYVGGTFRKNIVISFVGAMAPIGATL-GCLFAGLIGTENPNQWPW 235
           G++G+  V     K    +FVGA++  G TL G  F  LIG      + W
Sbjct: 198 GVVGDFTV-----KQERGTFVGAVS--GFTLMGQAFGSLIGAALTAAFDW 240

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 94  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150
           +I+  L D   SE N     SW+  ++ L S +F  + G+L DI+G + +L+   ++  +
Sbjct: 158 TIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCL 217

Query: 151 WSLICGITN 159
            +LICG++ 
Sbjct: 218 GALICGMSK 226

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 5/125 (4%)

Query: 48  LEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEG 107
           L DE   C+   +    +  +  ++  + +  +   L+   +T   +IMN +++ F  E 
Sbjct: 11  LPDEQ-HCDALDEEYTKYNLSLPKFPILVSLWLGSFLSSIDSTIVANIMNKVAEEF-QES 68

Query: 108 NSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFF 167
             K W+  SF L + +F  + G+L DI G K  LL        + L C +T+ S +   F
Sbjct: 69  QEKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLTALSF---FGLGCFLTSLSTNIKQF 125

Query: 168 IICRA 172
            I RA
Sbjct: 126 AIARA 130

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 11/110 (10%)

Query: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVL 186
           ISG L D+YG + ++L+G ++ +I S+    +   G+  F    R  Q  GI+ ++    
Sbjct: 137 ISGGLADVYGRRPIILLGMLIYVIASIGLACSKSYGAVVFL---RCLQSAGISPIIAINS 193

Query: 187 GIIGNIYVGGTFRKNIVISFVGAMAPIGATL-GCLFAGLIGTENPNQWPW 235
           G+ G+  V     K+   +FVGA++  G TL G  F  LIG      + W
Sbjct: 194 GVAGDFTV-----KSERGTFVGAVS--GFTLMGQAFGSLIGAALTAAYDW 236

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 87/202 (43%), Gaps = 14/202 (6%)

Query: 28  KKSSRDNGSEETLRGTAFTNLEDE-MVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQ 86
           + ++ + G ++T    +    E + +VE  Q +  P       Q++  +F   I+   + 
Sbjct: 47  RTTTNELGDDDTSSECSHDEQEQQHIVEGEQNY--PHTLLTYRQKWFMVFLMTITGFWSS 104

Query: 87  AGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYV 146
            G+      +  L   F  + N  +  +  + L  G    ISG L D+YG + ++L G +
Sbjct: 105 LGSPIYYPALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGML 164

Query: 147 LVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISF 206
           + ++ S+  GI   + S    +  R  Q +GI+  +    G++ +  V     K    +F
Sbjct: 165 IFVVASI--GIAK-APSYGVIVFLRCIQSIGISPTIAISSGVVSDFTV-----KRERGTF 216

Query: 207 VGA---MAPIGATLGCLFAGLI 225
           VGA   +  IG  +G L   +I
Sbjct: 217 VGATSGLVLIGQGIGPLLGAVI 238

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 83/218 (38%), Gaps = 22/218 (10%)

Query: 18  EVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFT 77
           E+E +        S D+  + T + TA T     ++   QKW               +  
Sbjct: 59  EIEGDLDSETSSHSSDDKVDPTQQITAETKAPYTLLSYGQKWG-------------MVAI 105

Query: 78  CMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGL 137
             +    +  G+      +  L   F  + N  +  +  + L  G    +SG L D +G 
Sbjct: 106 LTMCGFWSSLGSPIYYPALRQLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGR 165

Query: 138 KKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGT 197
           + ++L G ++ +I S+        G     I  R  Q +GI+  +    G++G+  +   
Sbjct: 166 RPIILAGMLIYVIASIGLACAPSYG---VIIFLRCIQSIGISPTIAISSGVVGDFTL--- 219

Query: 198 FRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPW 235
             K+   +FVGA +     LG  F  LIG     +W W
Sbjct: 220 --KHERGTFVGATSGF-VLLGQCFGSLIGAVLTARWDW 254

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 112 WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICR 171
           WL+  + L +  F+L+ GRL +I G  + L++  V+  I SLI  ++N  G+     +  
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIA 106

Query: 172 AFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPN 231
            F G GI     ++  ++G   V   +R  I+I+ +     I   +G    G        
Sbjct: 107 GFGGSGI----ESLAFVVGTSIVQENYR-GIMITALAVSYVIAEGVGPFIGG--AFNEHL 159

Query: 232 QWPWAFY 238
            W W FY
Sbjct: 160 SWRWCFY 166

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 37.7 bits (86), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 11/106 (10%)

Query: 72  YLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRL 131
           YL IF   I   +    +    S  N LS          SW+  S+ L S +F  + G++
Sbjct: 118 YLGIFLAAIDNTIVSTTSAHVASEFNQLSKV--------SWIATSYLLSSATFQPLYGKV 169

Query: 132 GDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLG 177
            DI+G K +L+   V  +I  L+CG+   S S  + +I R   G+G
Sbjct: 170 SDIFGRKCLLVFTNVAFLIGCLMCGL---SKSFWWLVIARFVAGVG 212

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 65/145 (44%), Gaps = 8/145 (5%)

Query: 94  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 153
           +I++++++ FG+   +  WL+  + L +    LI GR   I G +  L++  ++    SL
Sbjct: 59  TIIDVVAEQFGNYSKT-GWLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSL 117

Query: 154 ICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPI 213
           I  + +   S    I  R   G+G    L  +  +IG   VG   R  +VIS +     +
Sbjct: 118 IAALAS---SMNMLIFGRVVAGVG-GSGLQTLCFVIGCTMVGERSRP-LVISILSCAFAV 172

Query: 214 GATLGCLFAGLIGTENPNQWPWAFY 238
            A +G +  G   T     W W FY
Sbjct: 173 AAIVGPIIGGAFTTH--VTWRWCFY 195

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 72/165 (43%), Gaps = 12/165 (7%)

Query: 78  CMISQLLNQAGTTQTLSIMNILSDSFGSE----GNSKSWLMASFPLVSGSFILISGRLGD 133
           C+IS LL        + I+  L D+ G +    GN   WL+  + L +  F+L+ GRL +
Sbjct: 10  CVISLLLTLFLAALDIVIVVTLYDTIGIKFHDFGN-IGWLVTGYALSNAVFMLLWGRLAE 68

Query: 134 IYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIY 193
           I G K+ L++  ++  I SLI  ++N   +     +   F G GI     ++  ++G   
Sbjct: 69  ILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGI----ESLAFVVGTSI 124

Query: 194 VGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFY 238
           V    R  I+I+ +     I   +G    G         W W FY
Sbjct: 125 VRENHR-GIMITALAISYVIAEGVGPFIGGAFNEH--LSWRWCFY 166

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 71/165 (43%), Gaps = 12/165 (7%)

Query: 78  CMISQLLNQAGTTQTLSIMNILSDSFGSE----GNSKSWLMASFPLVSGSFILISGRLGD 133
           C+IS LL        + I+  L D+ G +    GN   WL+  + L +  F+L+ GRL +
Sbjct: 10  CIISLLLTLFLAALDIVIVVTLYDTIGIKFHDFGN-IGWLVTGYALTNAVFMLLWGRLAE 68

Query: 134 IYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIY 193
           I G  + L++  ++  + SLI  ++N  G+     +   F G GI     ++  ++G   
Sbjct: 69  ILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIAGFGGSGI----ESLAFVVGTSI 124

Query: 194 VGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFY 238
           V    R  ++ +   +   I   +G    G         W W FY
Sbjct: 125 VQENHRGTMITALATSYV-IAEGVGPFIGG--AFNEHLSWRWCFY 166

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 82/207 (39%), Gaps = 10/207 (4%)

Query: 32  RDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQ 91
            DN S+E    T   +   E+VE N+K  +       +  Y  + +  ++  L+      
Sbjct: 5   EDNSSKELC--TQAESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILI 62

Query: 92  TLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIW 151
             +I+  +S  F +E +   WL+  + L +    L+ GR   I G K  +L+  ++  + 
Sbjct: 63  VSTIIETVSRDF-NEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVG 121

Query: 152 SLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMA 211
           SL+  + N   S    I  R   G+G + +      II  +       + + IS +    
Sbjct: 122 SLVSALAN---SMNMLIGGRVISGVGGSGLQTLCFLIISTLV--NERSRGMAISVLSCSF 176

Query: 212 PIGATLGCLFAGLIGTENPNQWPWAFY 238
            + + +G    G   T     W W FY
Sbjct: 177 AVASIVGPFLGGAFTTH--VTWRWCFY 201

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 4/79 (5%)

Query: 94  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 153
           +IMN +++ F  E + K W+  SF L + +F  + G+L DI G +  LL  +     + L
Sbjct: 55  NIMNRVAEEF-EESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFF---FGL 110

Query: 154 ICGITNYSGSDTFFIICRA 172
            C +T ++ S   F + RA
Sbjct: 111 GCLLTCFAQSVEQFALARA 129

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 94  SIMNILSDSFGSEGNS---KSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150
           +I++ L    GSE NS    SW+  S+ L S +   + G+L D  G K +L+    +  I
Sbjct: 104 TIVSTLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAI 163

Query: 151 WSLICGITN 159
             LICG++N
Sbjct: 164 GCLICGLSN 172

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 94  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150
           +I++ L     SE N     SW+  ++ L S +F  + G++ DI+G K +L+   V+  +
Sbjct: 147 TIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFAL 206

Query: 151 WSLICGIT 158
             LICG++
Sbjct: 207 GCLICGLS 214

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 60/149 (40%), Gaps = 20/149 (13%)

Query: 96  MNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLIC 155
           + ++++ F     S  W+++ + L      L+ GR   I G K  LLV  ++    SLI 
Sbjct: 142 IEVIAEQFKDYSKS-GWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLIS 200

Query: 156 GITNYSGSDTFFIICRAFQGLG------IAFVLPNVLGIIGNIYVGGTFRKNIVISFVGA 209
            I+N   S    I  R   G+G      + FV+ + L             + I+IS +  
Sbjct: 201 AISN---SMNMLIGGRVVAGIGGSGIQSLCFVIASTL--------TPDRSRVIIISVLSC 249

Query: 210 MAPIGATLGCLFAGLIGTENPNQWPWAFY 238
              + A +G    G + T     W W FY
Sbjct: 250 SYAVAAVVGPFLGGALTTH--VTWRWCFY 276

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 94  SIMNILSDSFGSEGNSKS---WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150
           +I+  L     SE N  S   W+  ++ L S +F  + G++ DI+G + ++++  +  I+
Sbjct: 79  TIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFIL 138

Query: 151 WSLICGITN 159
             LICG++ 
Sbjct: 139 GCLICGLSK 147

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 59/137 (43%), Gaps = 9/137 (6%)

Query: 99  LSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT 158
           L   F  + N  +  +  + L  G    ISG L D +G + ++L G ++ ++ S+     
Sbjct: 127 LEKQFNVDENMINITVVVYLLFQGVSPTISGGLADCFGRRPIILAGMLIYVVASIGLACA 186

Query: 159 NYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG 218
              G     I  R  Q +GI+  +    G++G+  +     K+   +FVGA +     LG
Sbjct: 187 PSYG---VIIFLRCIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATSGF-VLLG 237

Query: 219 CLFAGLIGTENPNQWPW 235
             F  LIG     +W W
Sbjct: 238 QCFGSLIGAVLTARWDW 254

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 59/137 (43%), Gaps = 9/137 (6%)

Query: 99  LSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT 158
           L   F  + N  +  +  + L  G    +SG L D +G + ++L G ++ ++ S+     
Sbjct: 126 LEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASIGLACA 185

Query: 159 NYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG 218
              G   F    R  Q +GI+  +    G++G+  +     K+   +FVGA +     LG
Sbjct: 186 PSYGVIIFL---RCIQSIGISPTIAISSGVVGDFTL-----KHERGTFVGATSGF-VLLG 236

Query: 219 CLFAGLIGTENPNQWPW 235
             F  LIG     +W W
Sbjct: 237 QCFGSLIGAVLTARWDW 253

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 90  TQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVI 149
           T   +IMN ++  F +E + K W+  S+ L + +F  + G+L DI G K  ++  +    
Sbjct: 60  TVVANIMNSIAAEF-AESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAH---F 115

Query: 150 IWSLICGITNYSGSDTFFIICRA 172
            ++L C +T ++ + T F I RA
Sbjct: 116 FFALGCLLTCFAQNVTQFSIARA 138

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%)

Query: 111 SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGIT 158
           SW+  ++ L S +F  I G++ DI+G K +L+   +   + SLICG++
Sbjct: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLS 206

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 72/167 (43%), Gaps = 10/167 (5%)

Query: 75  IFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKS---WLMASFPLVSGSFILISGRL 131
           ++ C+IS +L+       + I++ + ++   E    S   W+ A + L S    LI GR+
Sbjct: 54  LYACVISLILSIFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRI 113

Query: 132 GDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGN 191
             + G K  +L   ++  + SL+  + N   S    I  R   GLG + +      II  
Sbjct: 114 AAVCGFKSSMLTAIIIFEVGSLVAALAN---SMDMLIGGRVIAGLGGSGIQTLCFVIIST 170

Query: 192 IYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFY 238
           +      ++ ++I+ +G+   I + +G    G   T     W W F+
Sbjct: 171 LVEES--KRGLLIACMGSAFGIASVVGPFLGGAFTTHVT--WRWCFW 213

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 94  SIMNILSDSFGSEGN---SKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150
           ++++ L    GSE N      W+  S+ L S  F  + G+L DI+G K +L+   ++   
Sbjct: 415 TVVSTLMAHIGSEFNQIPKVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFF 474

Query: 151 WSLICGITN 159
             +ICG++N
Sbjct: 475 GCIICGMSN 483

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (46%), Gaps = 9/109 (8%)

Query: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVL 186
           +SG L DIYG + ++L G ++ ++ S+     N  G     I  R  Q  GI+ ++    
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASIGIAACNSYG---VIIFLRCLQSTGISPLIAISS 209

Query: 187 GIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPW 235
           G +G+  V     K    +FVGA++ +   +G  F  LIG      + W
Sbjct: 210 GAVGDFTV-----KAERGTFVGAVSGL-VLMGQAFGSLIGAALAAAYNW 252

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 102/263 (38%), Gaps = 24/263 (9%)

Query: 6   LVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYF 65
           L+ ++E++D  M+  N   F       D   E     + +     +  E       P Y 
Sbjct: 36  LIPTDEESD--MDSYNPITFDQDSVEIDKLDEPIDTTSLYKTKSGQHNE--PTLDEPPYS 91

Query: 66  KYAWQEYLF-IFTCMISQLLNQAGTTQTLSIMNILSDSFG-SEGNSKSWLMASFPLVSGS 123
           ++  +E +F +  C  + L +    +    +++++   F  +E      ++  F   + S
Sbjct: 92  RFGRKEKIFLVIQCAFTGLFSSIAGSIYYPVLSVMEKEFYITEEQVNVSVVVYFIFQALS 151

Query: 124 FILISGRLGDIYGLKKMLLVGYVLVIIWSL-ICGITNYSGSDTFFIICRAFQGLGIAFVL 182
             L+ G L D  G + ++L   VL     + +   TNYS      I  R  Q  GI+ V+
Sbjct: 152 PTLMGG-LADSLGRRPVVLSSIVLYFCACIGLARCTNYSQ----LIGLRCLQAAGISPVI 206

Query: 183 PNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGAT--LGCLFAGLIGTENPNQWPWA--FY 238
               GI+G++               G M  +  T  LG  F  LIG    ++W W   F+
Sbjct: 207 AVNSGIMGDVTTKAERG--------GYMGLVSGTQVLGTAFGALIGAGLSSRWSWRSIFW 258

Query: 239 AFSIASLINFGLSIYAIPNNIPT 261
              I S I   +SI  +P    T
Sbjct: 259 FLVIGSGICLIVSIIVLPETKRT 281

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 58/290 (20%), Positives = 120/290 (41%), Gaps = 53/290 (18%)

Query: 8   ESEEKNDDCMEVENEAVFPPKKSSR---------------DNGSEETLRGTAFTNLED-- 50
            ++E+N   M++E  +  P + +S                +NGS ET      T L D  
Sbjct: 7   RAQEQNS--MDIEQRSSQPSRSNSHAGSPGYEKVQPLYAAENGSTET--APTATGLFDSS 62

Query: 51  EMVECNQK------------WQNPKYFKYAWQEYLFI---FTCMISQLLNQAGTTQTLSI 95
            +V  +Q+            +++ + +    ++ + +   F C++  +    GT+     
Sbjct: 63  HVVPVSQRRGLLSRLALVPEFRDARLYPPRVKKLILVIVAFACILGPM----GTSIIYPA 118

Query: 96  MNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLIC 155
           +  +   FG+     S  + ++    G F +    L D  G + + ++ + L++++S+  
Sbjct: 119 IGTIMQDFGTSRFLVSVSVGTYLAALGIFPIWWSSLADKNGRRTVYVLSFALLVVFSV-- 176

Query: 156 GITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGA-MAPIG 214
             T +S +   FII R   G   A V     G I ++YV     +N+   ++G  MAP  
Sbjct: 177 -GTAFSRNIETFIILRILCGAASASVQSVGAGTIADLYVPEERGRNLGYYYLGPLMAP-- 233

Query: 215 ATLGCLFAGLIGTENPNQWPWAF--YAFSIASLINFGLSIYAIPNNIPTN 262
                L + ++ +   N+W W    +   I + + F L ++A+P  + T 
Sbjct: 234 -----LLSPIVSSLLVNRWSWRSTQWFMVILAALTFLLLVFALPETLRTQ 278

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 6/87 (6%)

Query: 94  SIMNILSDSFGSEGNS---KSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150
           +I++ L    GSE NS    SW+  S+ L S +   + G+L D  G K +L+   V+  I
Sbjct: 100 TIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSI 159

Query: 151 WSLICGITNYSGSDTFFIICRAFQGLG 177
             LICG+   S S  + ++ R   G+G
Sbjct: 160 GCLICGM---STSIWWVVVGRFVSGIG 183

>Suva_13.174 Chr13 (278964..280589) [1626 bp, 541 aa] {ON} YMR011W
           (REAL)
          Length = 541

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 60/131 (45%), Gaps = 17/131 (12%)

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGL---GIAFVL 182
           L  GRLGDIYG +K+ L+  +LV I  ++  I +      +F I R   G+   GIA + 
Sbjct: 122 LTLGRLGDIYG-RKIGLMCVILVYIVGIVIQIASTDKWYQYF-IGRIISGMGVGGIAVLS 179

Query: 183 PNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTENPNQWP------W 235
           P ++      ++ GT      +SF   M  +G  LG C   G     N  QW       +
Sbjct: 180 PTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYSNSIQWRVPLGMNF 234

Query: 236 AFYAFSIASLI 246
           AF  F IA ++
Sbjct: 235 AFAIFMIAGML 245

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 86/207 (41%), Gaps = 15/207 (7%)

Query: 32  RDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQ 91
           R N ++ T +      LED   E N+    PK F      Y  +    +S  L       
Sbjct: 34  RRNSTQSTSKQNVSVVLEDNASESNEL---PKGFIL----YASLIALALSLFLAALDIMI 86

Query: 92  TLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIW 151
             +I+  ++  FGS  +   WL   + L +    LI GR+    G K+ +L   V+  I 
Sbjct: 87  VSTIIEEVAKQFGSY-SEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIG 145

Query: 152 SLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMA 211
           SLI  + N   S +  I  R   G+G    + ++  +IG+  V  + ++ I+I+ +    
Sbjct: 146 SLISALAN---SMSMLIGGRVIAGVG-GCGIQSLSFVIGSTLVEES-QRGILIAVLSCSF 200

Query: 212 PIGATLGCLFAGLIGTENPNQWPWAFY 238
            I + +G    G+  +     W W FY
Sbjct: 201 AIASVVGPFLGGVFTSS--VTWRWCFY 225

>TDEL0C04590 Chr3 (831668..833257) [1590 bp, 529 aa] {ON} Anc_2.242
           YNL065W
          Length = 529

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 49/108 (45%), Gaps = 9/108 (8%)

Query: 128 SGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLG 187
           SG L DIYG + ++++G ++ +  S+    +N  G   F    R  Q   I+  +    G
Sbjct: 119 SGGLADIYGRRPVIVIGMIIYVAVSVGLACSNSYGVLVFL---RILQSACISPTIAISSG 175

Query: 188 IIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPW 235
            +G+  +   F +    +FVGA +   A LG  F  LIG      W W
Sbjct: 176 FVGDFTL--KFERG---TFVGATSGF-ALLGQAFGSLIGAALAAAWDW 217

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 41/229 (17%), Positives = 88/229 (38%), Gaps = 20/229 (8%)

Query: 18  EVENEAVFPPKKSSRDNGSEETLRG--TAFTNLEDEMVECNQ--------KWQNPKYFKY 67
           E E+    P +K +       +L G   +  +++ E   C +         + +P Y ++
Sbjct: 5   EKEDIRKTPTEKDTESKHERLSLPGDNESMCSIDVEQSSCTRTKSARLEPHYTSPPYSRF 64

Query: 68  AWQE-YLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFIL 126
             +E +L +  C  +   +         ++ ++ D F       +  +  + +  G    
Sbjct: 65  GRREKFLLVVQCAFTGFFSTIAAAIYYPVLTVIEDLFDISEEKVNITVVVYFIFQGISPT 124

Query: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVL 186
           + G L D  G + ++++    V+++   C     S S    I  R  Q  GI+ V+    
Sbjct: 125 LMGGLADYLGRRPIVILS---VLVYFSACVGLACSQSYAQIIALRCLQAAGISPVIAINS 181

Query: 187 GIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPW 235
           GI+G++       +   + +V     +G+     F  LIG    ++W W
Sbjct: 182 GIMGDVTTRA--ERGGYVGYVSGCQVVGSA----FGALIGAGLSSRWGW 224

>Skud_13.163 Chr13 (274262..275905) [1644 bp, 547 aa] {ON} YHR094C
           (REAL)
          Length = 547

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 61/131 (46%), Gaps = 17/131 (12%)

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGL---GIAFVL 182
           L  GRLGDIYG +++ L+  VLV I  ++  I + +    +F I R   G+   GIA + 
Sbjct: 122 LTLGRLGDIYG-RRIGLMCVVLVYIVGIVIQIASSNKWYQYF-IGRIISGMGVGGIAVLS 179

Query: 183 PNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTENPNQWP------W 235
           P ++      ++ GT      +SF   M  +G  LG C   G     N  QW       +
Sbjct: 180 PTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYTNSVQWRVPLGLGF 234

Query: 236 AFYAFSIASLI 246
           AF  F IA ++
Sbjct: 235 AFAIFMIAGML 245

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 11/110 (10%)

Query: 127 ISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVL 186
           ISG L D+YG + ++L+G ++ +  S+    +   G   F    R  Q  GI+ ++    
Sbjct: 141 ISGGLADVYGRRPVILMGMLIYVCASIGLACSQSYGVIVFL---RCLQSAGISPIIAINS 197

Query: 187 GIIGNIYVGGTFRKNIVISFVGAMAPIGATL-GCLFAGLIGTENPNQWPW 235
           G++G+  +     K+   +FVGA++  G TL G  F  LIG      + W
Sbjct: 198 GVVGDFTL-----KHERGTFVGAVS--GFTLMGQAFGSLIGAALTAAFDW 240

>TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.570
           YBR180W
          Length = 653

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 62/146 (42%), Gaps = 7/146 (4%)

Query: 129 GRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGI 188
           G   D+ G K + L   +LV + +L+  +   + +  F  + R FQ  G + V+    G 
Sbjct: 167 GVYADVCGRKWLYLCSLILVTVINLLLAVLPANLASLF--VLRVFQAFGSSSVITLGSGT 224

Query: 189 IGNIYVGGTFRKNIVISFVGA-MAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLIN 247
           + +I       K I    +G  M PI   LG + AGLI   N + W W F    I S I 
Sbjct: 225 VTDITPMKHRGKAIAYFMLGPNMGPI---LGPIIAGLILI-NGDYWRWLFGFTCIMSAIG 280

Query: 248 FGLSIYAIPNNIPTNIHHFSMDWIGS 273
           F L +  +P  +   + +    W  S
Sbjct: 281 FLLVLIFLPETLRCIVGNGDPRWRNS 306

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 94  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150
           +I++ L D   SE  +    SW+ AS+ L +  F  + G+L DI+G K +LL   ++  +
Sbjct: 170 TILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGL 229

Query: 151 WSLICG 156
             L+CG
Sbjct: 230 GCLVCG 235

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 95  IMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLV 143
           IMN +++ F +  N K W+  S+ L + +F  + GRL DI G K   L+
Sbjct: 89  IMNRVAEDFNAS-NQKQWIATSYLLTNTAFQPLYGRLSDIIGRKYTQLI 136

>Suva_4.275 Chr4 complement(487620..489671) [2052 bp, 683 aa] {ON}
           YBR043C (REAL)
          Length = 683

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 68/165 (41%), Gaps = 9/165 (5%)

Query: 71  EYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGR 130
           + + +F    S ++   GT+     +N ++  F +     +  +  + L  G F L    
Sbjct: 106 KKMIVFLIAFSSMMGPMGTSIIFPAINAITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSS 165

Query: 131 LGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIG 190
           L ++ G +   +  + ++  +S+   +     S   FI  R   G   A V     G + 
Sbjct: 166 LSELEGRRTTYITSFAMLFAFSIGSALAPDINS---FIALRMLCGAASASVQSVGAGTVA 222

Query: 191 NIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPW 235
           ++Y+     KN+   ++G +      L  L + +IG+   N+WPW
Sbjct: 223 DLYISEDRGKNLSYYYLGPL------LAPLLSPIIGSLLVNRWPW 261

>YMR011W Chr13 (288079..289704) [1626 bp, 541 aa] {ON}
           HXT2High-affinity glucose transporter of the major
           facilitator superfamily, expression is induced by low
           levels of glucose and repressed by high levels of
           glucose
          Length = 541

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 62/133 (46%), Gaps = 21/133 (15%)

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTF--FIICRAFQGL---GIAF 180
           L  GRLGD+YG +++ L+  VLV I  ++  I +   SD +  + I R   G+   GIA 
Sbjct: 122 LTLGRLGDMYG-RRIGLMCVVLVYIVGIVIQIAS---SDKWYQYFIGRIISGMGVGGIAV 177

Query: 181 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTENPNQWP----- 234
           + P ++      ++ GT      +SF   M  +G  LG C   G     N  QW      
Sbjct: 178 LSPTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGL 232

Query: 235 -WAFYAFSIASLI 246
            +AF  F IA ++
Sbjct: 233 NFAFAIFMIAGML 245

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 52/270 (19%), Positives = 107/270 (39%), Gaps = 19/270 (7%)

Query: 1   MSVHVLVESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVEC--NQK 58
           MS  +   +E++  D     ++      +S  ++  +E++   +  N ++++ +   NQ 
Sbjct: 1   MSEQIDKLNEQEKVDITPRSSDGYTHKVRSYHNDDDDESVINISDINPKNQLCQTKSNQN 60

Query: 59  WQN---PKYFKYAWQEYL-FIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLM 114
             +   P Y ++   E +  +  C  +   +         +++++ + F       +  +
Sbjct: 61  EPDIASPPYSRFGTTEKMILVIQCAFTGFFSSIAGAIYYPVLSVIENEFNITEEMVNITV 120

Query: 115 ASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQ 174
             + +  G    I G L D  G + ++L     V+++   C     S +    I+ R  Q
Sbjct: 121 VVYFIFQGIAPSIMGGLADSMGRRPVVLSS---VLVYCCACIGLACSHTYAQIIVLRCLQ 177

Query: 175 GLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLF-AGLIGTENPNQW 233
             GI+ V+    GI+G+I       +   + +V     IG+  G L  AGL  T     W
Sbjct: 178 AAGISPVIAINSGIMGDITTRA--ERGGYVGYVSGFQVIGSAFGALIGAGLSAT-----W 230

Query: 234 PWA--FYAFSIASLINFGLSIYAIPNNIPT 261
            W   F+  +I S +    SI  +P    T
Sbjct: 231 SWRSIFWFLAIGSGVCLVASIIILPETKRT 260

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 62/145 (42%), Gaps = 8/145 (5%)

Query: 94  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 153
           +I+  +S  FG + +   WL   + L +   +LI GR+  + G K   L   V+  + SL
Sbjct: 65  TIIEEVSQKFG-DYSKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSL 123

Query: 154 ICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPI 213
           +  + N   S    I  R   G+G + V   V  +I +  V    R  ++I+ + +   I
Sbjct: 124 VSALAN---SMDMLIGGRVIAGIGGSGVQSLVF-VISSTLVEERNR-GLIIAVMSSSFGI 178

Query: 214 GATLGCLFAGLIGTENPNQWPWAFY 238
            + +G    G   T     W W FY
Sbjct: 179 ASVVGPFLGGAFTTH--VTWRWCFY 201

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 94  SIMNILSDSFGSEGNSK---SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150
           +I++ L    GSE N     SW+  ++ L S +F  + G++ DI+G K +L    V   I
Sbjct: 113 TIVSTLLARIGSEFNELPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFI 172

Query: 151 WSLICGITNYSGSDTFFIICRAFQGLG 177
             LICG      S    +I R   G+G
Sbjct: 173 GCLICGTAK---SFWVLVIGRFISGVG 196

>Smik_13.171 Chr13 (279108..280733) [1626 bp, 541 aa] {ON} YDR345C
           (REAL)
          Length = 541

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 62/133 (46%), Gaps = 21/133 (15%)

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTF--FIICRAFQGL---GIAF 180
           L  GRLGD+YG +++ L+  VLV I  ++  I +   SD +  + I R   G+   GIA 
Sbjct: 122 LTLGRLGDMYG-RRIGLMCVVLVYIVGIVIQIAS---SDKWYQYFIGRIVSGMGVGGIAV 177

Query: 181 VLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTENPNQWP----- 234
           + P ++      ++ GT      +SF   M  +G  LG C   G     N  QW      
Sbjct: 178 LSPTLISETAPKHIRGT-----CVSFYQLMITLGIFLGYCTNYGTKDYSNSVQWRVPLGL 232

Query: 235 -WAFYAFSIASLI 246
            +AF  F IA ++
Sbjct: 233 NFAFAIFMIAGML 245

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 93/227 (40%), Gaps = 17/227 (7%)

Query: 13  NDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEY 72
            D+        + P +K  +++ S  T+ G     L++  V     ++ P++ K  W   
Sbjct: 28  EDNSSGTSPTGISPAEKFRQESSSIHTVNGKRV--LQEYEVYDKLGYEFPQWKK--WSIV 83

Query: 73  LFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLG 132
             IF C +S   N +     LS+   +S  F     + +     F +  G    +     
Sbjct: 84  TVIFVCQLSMNFNGSVYPHALSL---ISKEFHVSSQAANTSQMIFKVAYGFGCELWAPWS 140

Query: 133 DIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNV-LGIIGN 191
           + YG + ++ +      IW ++ G     G+    II   F G GI+    +V LG++ +
Sbjct: 141 EEYGRRNIMQLSLFFTNIWQILGGKAPNFGT----IIVARFLG-GISQAGGSVTLGVVAD 195

Query: 192 IYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFY 238
           ++          +++V   + +GA +G +F GL+  E    W W F+
Sbjct: 196 MWQPQD--HGYAVAYVVLASVLGAVIGPVFGGLM--EEHLSWHWNFW 238

>Ecym_2085 Chr2 complement(147345..153377) [6033 bp, 2010 aa] {ON}
           similar to Ashbya gossypii ACL143C
          Length = 2010

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 72/157 (45%), Gaps = 38/157 (24%)

Query: 22  EAVFPPKKSSRDNGSEET-LRGT-AFTNLEDEMVECNQKWQNPKY-FKYAWQEYLFIFTC 78
           + +FP K  + D+GS+++ LR +  F N  ++     QK Q P+   + +W    F+ T 
Sbjct: 405 QKLFPFKSITGDDGSQKSNLRSSMTFVNSNEQ-----QKLQIPRAAMRNSWNRMDFLSTV 459

Query: 79  ------MIS----QLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILIS 128
                 M+S     L+++    +TLS++ IL  +    G S               IL S
Sbjct: 460 CFWISFMLSFKNYDLIHRIRIFKTLSVLRILRLTDTDSGVSS--------------ILKS 505

Query: 129 GRLGDIYGLKKMLLVGYVLVIIWSL--ICGITNYSGS 163
            +    YGL ++  VG++L+  W    I G+ N+ GS
Sbjct: 506 IK----YGLPQLFNVGFMLLYFWVFFAILGVQNFQGS 538

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 94  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 153
           ++MN +++ F  E + K W+  SF L + +F  + G+L D+   +K+  +         L
Sbjct: 62  NVMNRIAEEF-QESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFFLGL 120

Query: 154 ICGITNYSGSDTFFIICRAFQGLG 177
           I  I+ ++ + T F I RA  G+G
Sbjct: 121 I--ISCFAQNVTQFAIGRAVCGIG 142

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 56/127 (44%), Gaps = 7/127 (5%)

Query: 111 SWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIIC 170
           SW+ AS+ + S SF  + G   D+ G +K L    ++  I  L CGI   S +  +    
Sbjct: 105 SWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGI---SINILWLSFM 161

Query: 171 RAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENP 230
           RAF   GI       L  I N  +  T ++ I  +F   +  +GA  G  F G+I   + 
Sbjct: 162 RAFT--GIGGGGLITLSTIVNSDMIPTSKRGIFQAFQNLLLGLGAICGASFGGVI--TSS 217

Query: 231 NQWPWAF 237
             W W F
Sbjct: 218 IGWRWCF 224

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 77/205 (37%), Gaps = 12/205 (5%)

Query: 60  QNPKYFKYAWQEY-LFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFP 118
            +P Y ++   E  L I  C  +   +         ++ ++   F       +  +  + 
Sbjct: 87  DSPPYSRFGRTEKSLLIIQCAFTGFFSSVAGAIYYPVLTVIEKKFNITEELVNITVVVYF 146

Query: 119 LVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGI 178
           +  G      G L D  G + ++L     ++++   C     S + T  ++ R  Q  GI
Sbjct: 147 IFQGLAPSFMGGLADSLGRRPVVLFS---ILVYCCACIGLALSQNYTQIVVLRCLQAAGI 203

Query: 179 AFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWA-- 236
           + V+    GI G+I       +   + +V     IG+     F  LIG    + W W   
Sbjct: 204 SPVIAINSGICGDITTRA--ERGAYVGYVSGFIVIGSA----FGALIGAGLSSTWGWRSI 257

Query: 237 FYAFSIASLINFGLSIYAIPNNIPT 261
           F+  +I S I   +SI  +P    T
Sbjct: 258 FWFLTIGSGICLMISIIVLPETKRT 282

>Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON}
           YMR011W (HXT2) - high affinity hexose transporter-2
           [contig 245] FULL
          Length = 570

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 11/112 (9%)

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGL---GIAFVL 182
           L  GRLGD+YG +++ L+  +LV +  +I  I + +    +F I R   GL   GIA + 
Sbjct: 134 LTLGRLGDMYG-RRLGLMAVILVYVVGIIIQIASSNKWYQYF-IGRIVSGLGVGGIAVLS 191

Query: 183 PNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTENPNQW 233
           P ++      ++ GT      +SF   M  +G  +G C   G     N  QW
Sbjct: 192 PTLISETAPKHLRGT-----CVSFYQLMITLGIFMGYCTNYGTKTYSNAVQW 238

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 66/157 (42%), Gaps = 26/157 (16%)

Query: 143 VGYVLVIIWSLI-----CGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGT 197
           +G   V++WS++     C     S + T  II R  Q  GI+ V+    GI+G++     
Sbjct: 138 LGRRPVVLWSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAINSGIMGDVTTKA- 196

Query: 198 FRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWA--FYAFSIASLINFGLSIYAI 255
             +   + +V     +G+ LG     LIG    ++W W   F+  +I S     +S + +
Sbjct: 197 -ERGGYVGYVAGFQILGSALG----ALIGAALSSRWDWRAIFWFLAIGSGACALVSFFVL 251

Query: 256 PNNIPTNIHHFSMDWIGSXXXXXXXXXXNFVWNQAPI 292
           P    T + + S+                 V+N+API
Sbjct: 252 PETKRTVVGNGSIR-------------PKPVFNRAPI 275

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 53/116 (45%), Gaps = 13/116 (11%)

Query: 122 GSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFV 181
           GSF L  GRLGDIYG +  L+V  V+ II ++I   +  +     ++I R   GLG   +
Sbjct: 134 GSFFL--GRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQ--YMIGRIIAGLGCGLI 189

Query: 182 LPNVLGIIGNIYVGGTFRKNI---VISFVGAMAPIGATLG-CLFAGLIGTENPNQW 233
                 I+  + +     KN+   ++S    M  +G  LG C   G     N  QW
Sbjct: 190 -----AILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKKYHNSRQW 240

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 112 WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICR 171
           WL   + L +   +LI GR+    G K  +L   V+  I SLI  +   + S    I  R
Sbjct: 100 WLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISAL---ASSMNMLIGGR 156

Query: 172 AFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPN 231
              G+G    + ++  +IG+  V  + ++ ++I+ + +   I + +G    G+  +    
Sbjct: 157 VIAGIG-GCGIQSLSFVIGSTLVEES-KRGMLIAILSSSFAIASVVGPFLGGVFTSS--V 212

Query: 232 QWPWAFY 238
            W W FY
Sbjct: 213 TWRWCFY 219

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 49/260 (18%), Positives = 99/260 (38%), Gaps = 34/260 (13%)

Query: 7   VESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFK 66
           V+SE+ +      E+EAV  P   +R N +E  +                     P Y +
Sbjct: 33  VDSEDNDKMIKTNEDEAVKEPIYRTRSNQTEPDIANA------------------PPYSR 74

Query: 67  Y-AWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFI 125
           + A  +   +  C  + L +         +++++   F       +  +  + +  G   
Sbjct: 75  FDAKYKMALVLQCAYTGLFSTMAGAIYYPVLSVIEKQFHITEELVNITVVVYFIFQGIAP 134

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTF--FIICRAFQGLGIAFVLP 183
            + G L D  G + ++L  + + + +    G+   + + T+   ++ R  Q  GI+ V+ 
Sbjct: 135 TLMGGLADSLGRRPVVL--FAVTVYFGACIGL---ACAQTYAQIVVLRCLQAAGISPVIA 189

Query: 184 NVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWA--FYAFS 241
              GIIG++       +   + ++         LG  F  LIG    ++W W   F+  +
Sbjct: 190 INSGIIGDVTTRA--ERGGYVGYISGFQ----VLGSAFGALIGAGLSSRWGWRSIFWFLA 243

Query: 242 IASLINFGLSIYAIPNNIPT 261
           I S +    SI  +P    T
Sbjct: 244 IGSGVCLVFSIIMLPETKRT 263

>ADL258W Chr4 (247672..249276) [1605 bp, 534 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL065W (AQR1),
           YIL121W and YIL120W (QDR1); Tandem gene duplication in
           Saccharomyces cerevisiae
          Length = 534

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 44/205 (21%), Positives = 81/205 (39%), Gaps = 34/205 (16%)

Query: 37  EETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTL--- 93
           E  +  +  + +   M+  +QKW                   M+  LL  AG   +L   
Sbjct: 47  EACVSTSEISKIPHSMLRYSQKW-------------------MMVALLTSAGFWSSLGSP 87

Query: 94  ---SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150
                +  L   FG   +  +  +  + L  G    +   L D YG + ++L+G ++ I+
Sbjct: 88  AVYPALRNLQREFGVSEDLVNIAVVVYLLFQGVAPTVCSGLADTYGRRPVILMGMLIFIV 147

Query: 151 WSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAM 210
            S+    +N   S    I  R  Q  GI+ ++    G++G+  +     K+   +F+GA+
Sbjct: 148 SSIGIACSN---SFALVIALRCIQSSGISPIIAINSGVVGDFTL-----KSERGTFIGAV 199

Query: 211 APIGATLGCLFAGLIGTENPNQWPW 235
           + +   LG  F  LIG      + W
Sbjct: 200 SGL-TLLGQAFGSLIGASLTAAYNW 223

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 64/145 (44%), Gaps = 8/145 (5%)

Query: 94  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 153
           +I+  ++  FGS  +   WL   + L +    LI GR+    G K+ +L   V+  + SL
Sbjct: 98  TIIEEVAKQFGSY-SEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSL 156

Query: 154 ICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPI 213
           I  + N   S    I  R   G+G    + ++  +IG+  V  + R  ++I+ +     I
Sbjct: 157 ISALAN---SMNVLIGGRVIAGVG-GCGIQSLSFVIGSNLVEESNR-GVLIAILSCSFAI 211

Query: 214 GATLGCLFAGLIGTENPNQWPWAFY 238
            + +G    G+  +     W W FY
Sbjct: 212 ASVVGPFLGGVFTSR--VTWRWCFY 234

>Skud_2.155 Chr2 complement(291487..293553) [2067 bp, 688 aa] {ON}
           YBR043C (REAL)
          Length = 688

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/163 (19%), Positives = 67/163 (41%), Gaps = 9/163 (5%)

Query: 73  LFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLG 132
           + +F    S ++   GT+     +N ++  F +     +  +  + L  G F L    + 
Sbjct: 108 MIVFLIAFSSMMGPMGTSIIFPAINAITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSMS 167

Query: 133 DIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNI 192
           ++ G +   +  + L+  +++      ++     FI  R   G   A V     G + ++
Sbjct: 168 ELEGRRTTYITSFALLFAFNIGSA---FAPDINSFIALRMLCGAASASVQSVGAGTVADL 224

Query: 193 YVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPW 235
           Y+     KN+   ++G +      L  L + +IG+   N+WPW
Sbjct: 225 YISEDRGKNLSYYYLGPL------LAPLLSPIIGSLLVNRWPW 261

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 67/162 (41%), Gaps = 12/162 (7%)

Query: 94  SIMNILSDSFGSE---GNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVII 150
           +I+  L  +  SE    N  SW+  S+ L   +F  + G+L D++G K +L+   +    
Sbjct: 50  TIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGF 109

Query: 151 WSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAM 210
             ++CG   ++ S     I R   G+G   +  N L  I    +    ++ +       M
Sbjct: 110 GCILCG-APFTKSLWMLCIGRFIAGVGGGGL--NSLSTITTSDIIPLRQRGV----YQGM 162

Query: 211 APIGATLGCLFAGLIGT--ENPNQWPWAFYAFSIASLINFGL 250
             I   LGC    LIG   +    W WAF      SL++  L
Sbjct: 163 GNIVFALGCASGSLIGAFLQQRIGWRWAFLCQVPLSLLSCSL 204

>ZYRO0G21648g Chr7 complement(1783532..1784998) [1467 bp, 488 aa]
           {ON} similar to uniprot|P38142 Saccharomyces cerevisiae
           YBR241C Hypothetical ORF
          Length = 488

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 62/133 (46%), Gaps = 21/133 (15%)

Query: 122 GSFILISGRLGDIYGLKKMLLVGYVLVIIWSLIC-GITNYSGSDTFFIICRAFQGL--GI 178
           GSF   +G L D++G KK  L+  VL +  SL+  G  +Y+      ++ R   GL  G+
Sbjct: 100 GSFF--AGPLADMFGRKKASLIASVLGLFGSLVLFGSNSYAA----LLVGRVIVGLASGV 153

Query: 179 AFVLPNV-LGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTE--NPNQWPW 235
             V+ ++ +  I  I + G F         G+M  +    G L    +  +  +  +W W
Sbjct: 154 YVVITSLFINEICPIELKGAF---------GSMNQLSINSGILLTQTLALKLADTYRWRW 204

Query: 236 AFYAFSIASLINF 248
             +A  IAS+INF
Sbjct: 205 LMFAAGIASVINF 217

>Smik_2.161 Chr2 complement(302754..304823) [2070 bp, 689 aa] {ON}
           YBR043C (REAL)
          Length = 689

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 32/163 (19%), Positives = 66/163 (40%), Gaps = 9/163 (5%)

Query: 73  LFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLG 132
           + +F    S ++   GT+     +N ++  F +     +  +  + L  G F L    L 
Sbjct: 108 MIVFLIAFSSMMGPMGTSIIFPAINAITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSLS 167

Query: 133 DIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNI 192
           ++ G +   +  + L+  +++   +     S   FI  R   G   A V     G + ++
Sbjct: 168 ELEGRRTTYITSFALLFAFNIGSALAPDINS---FIALRMLCGAASASVQSVGAGTVADL 224

Query: 193 YVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPW 235
           Y+     KN+   ++G +      L  L + + G+   N+WPW
Sbjct: 225 YISEDRGKNLSYYYLGPL------LAPLLSPIFGSLLVNRWPW 261

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 5/101 (4%)

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNV 185
           LI   + DIYG +    V   L +I+++ C I N   +    +ICR F G+  +  L  V
Sbjct: 296 LIWSPMSDIYGRRLTYFVSMGLYVIFNIPCAIPNNIAT---LMICRFFCGVWSSSGLCLV 352

Query: 186 LGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIG 226
            G + +++   T  +   I+F       G   G L  G I 
Sbjct: 353 GGSLADMFPSET--RGRAIAFFAYAPYCGPVFGPLVNGFIS 391

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 52/259 (20%), Positives = 96/259 (37%), Gaps = 32/259 (12%)

Query: 19  VENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYA-------WQE 71
           + N ++   ++   DN + +     A ++ + E    + +  N   F           Q+
Sbjct: 9   MRNASIAKEEREGSDNNNVDRSSSDAISDNDAERSNSHSEIDNESNFDMVPYSRFSHKQK 68

Query: 72  YLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRL 131
            L +  C  +   +    +    ++ I+   F       +  +  + +  G    I G L
Sbjct: 69  MLLVVQCAFTGFFSTVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGVAPSIMGGL 128

Query: 132 GDIYGLKKMLL---VGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGI 188
            D +G + ++L   + Y    I  L C   NY+      +  R  Q  GI+ V+    GI
Sbjct: 129 ADTFGRRPIVLWAILAYFCACI-GLACA-HNYAQ----ILALRCLQAAGISPVIAINSGI 182

Query: 189 IGNIYV----GGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWA--FYAFSI 242
           +G++      GG         +VG +A     +G  F  LIG    ++W W   F+  +I
Sbjct: 183 MGDVTTKVERGG---------YVGLVAGF-QVVGTAFGALIGAGLSSKWGWRAIFWFLAI 232

Query: 243 ASLINFGLSIYAIPNNIPT 261
            S I    S   +P    T
Sbjct: 233 GSGICLVFSTLLMPETKRT 251

>Skud_6.61 Chr6 (114670..116310) [1641 bp, 546 aa] {ON} YFL011W
           (REAL)
          Length = 546

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 11/112 (9%)

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGL---GIAFVL 182
           L  GRLGDIYG +++ L+  +LV +  ++  I +      +F I R   G+   G+A + 
Sbjct: 115 LTLGRLGDIYG-RRIGLMWVILVYVVGIVIQIASTDKWYQYF-IGRIVSGMGVGGVAVLS 172

Query: 183 PNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTENPNQW 233
           P ++  I   ++ GT      +SF   M  +G  LG C   G     N  QW
Sbjct: 173 PTLISEISPKHLRGT-----CVSFYQLMITLGIFLGYCTNYGTKKYSNSIQW 219

>Kpol_1004.24 s1004 (52837..54528) [1692 bp, 563 aa] {ON}
           (52837..54528) [1692 nt, 564 aa]
          Length = 563

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 68/151 (45%), Gaps = 8/151 (5%)

Query: 12  KNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDE----MVECNQKWQNPKYFKY 67
           KN+D ++ +    +      R+ G++ +   ++  +  D     + +C+    +   FK 
Sbjct: 41  KNNDSIDNDENHNYETTIELRNEGTDYSESNSSTKDKLDHQEHVLEKCDSDKGSNSRFKP 100

Query: 68  AWQEYLFIFTCMISQ-LLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFP-LVSGSFI 125
            +   +   + + S   +N +  T +L +  I  DS+ +    K+    +F   V G   
Sbjct: 101 NYWALITSGSGLFSDGYINASIGTVSLCLKRIYGDSYTNSNAIKNVSSIAFAGTVCGQ-- 158

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICG 156
           LI G L D Y  K  +L+G  ++I++S++C 
Sbjct: 159 LIFGHLADNYSRKFAMLLGTSMLILFSILCA 189

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 60/145 (41%), Gaps = 8/145 (5%)

Query: 94  SIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 153
           +I++++++ FG+   +  WL+  + L +    L+ GR   I G +  L++  ++    SL
Sbjct: 57  TIIDVVAEQFGNYSKT-GWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSL 115

Query: 154 ICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPI 213
           +  + N        +I            L  +  +IG   V    R  +VIS +     +
Sbjct: 116 VAALANSMN----MLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRP-LVISILSCAFAV 170

Query: 214 GATLGCLFAGLIGTENPNQWPWAFY 238
            A +G +  G   T     W W FY
Sbjct: 171 AAIVGPIIGGAFTTH--VTWRWCFY 193

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 48/127 (37%), Gaps = 7/127 (5%)

Query: 112 WLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICR 171
           WL+  + L +    L+ GR G + G K  +L+  V+  + SLI        S T  I  R
Sbjct: 114 WLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAAT---SMTMLIGGR 170

Query: 172 AFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPN 231
              G+G + +      I   +    T  +   IS +     + +  G    G   T    
Sbjct: 171 VISGIGGSGIQTLCFVITSTLVTDRT--RGTAISILSCAFAVASVAGPFLGGAFATH--V 226

Query: 232 QWPWAFY 238
            W W FY
Sbjct: 227 TWRWCFY 233

>YBR043C Chr2 complement(321876..323945) [2070 bp, 689 aa] {ON}
           QDR3Multidrug transporter of the major facilitator
           superfamily, has a role in polyamine homeostasis;
           expression is upregulated under polyamine stress;
           required for resistance to quinidine, barban, cisplatin,
           and bleomycin
          Length = 689

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 32/163 (19%), Positives = 66/163 (40%), Gaps = 9/163 (5%)

Query: 73  LFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLG 132
           + +F    S ++   GT+     +N ++  F +     +  +  + L  G F L    L 
Sbjct: 108 MIVFLIAFSSMMGPMGTSIIFPAINSITTEFKTSVIMVNVSIGVYLLSLGVFPLWWSSLS 167

Query: 133 DIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNI 192
           ++ G +   +  + L+  +++   +     S   FI  R   G   A V     G + ++
Sbjct: 168 ELEGRRTTYITSFALLFAFNIGSALAPDINS---FIALRMLCGAASASVQSVGAGTVADL 224

Query: 193 YVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPW 235
           Y+     KN+   ++G +      L  L + + G+   N+WPW
Sbjct: 225 YISEDRGKNLSYYYLGPL------LAPLLSPIFGSLLVNRWPW 261

>TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.245
           YBR043C
          Length = 640

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 35/179 (19%), Positives = 82/179 (45%), Gaps = 12/179 (6%)

Query: 58  KWQNPKYFKYAWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASF 117
           ++++P+ +  + ++ L +     S L+    T+     +N +++S  +     +  +  +
Sbjct: 76  EFKDPRDYPASIKK-LIVLIIAFSSLMGPMATSIVFPAINPITESLDTTTFMVNISVGVY 134

Query: 118 PLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLG 177
            L  G F L      +++G + + +V ++++  +   C     S + + FII R   G  
Sbjct: 135 SLSLGIFPLWWSSFSEMHGRRSVYVVSFIMLFGF---CIGAALSPNISSFIILRVLCGAA 191

Query: 178 IAFVLPNVLGIIGNIYVGGTFRKNIVISFVGA-MAPIGATLGCLFAGLIGTENPNQWPW 235
            A V     G + ++Y+     +N+ I ++G  MAP+ A +  + +GL+      +W W
Sbjct: 192 SASVQSVGAGTVSDLYIPEDRGRNLGIYYMGPLMAPLIAPI--IASGLV-----TRWSW 243

>CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011w HXT2 high-affinity hexose transporter or
           uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10 or
           uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 11/112 (9%)

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGL---GIAFVL 182
           L  GRLGD+YG +++ L+  + V +  ++  I++ +    +F + R   GL   GIA + 
Sbjct: 128 LTLGRLGDMYG-RRLGLMAVITVYVVGIVIQISSTTTWYQYF-VGRIVSGLGVGGIAVLS 185

Query: 183 PNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTENPNQW 233
           P ++      ++ GT      +SF   M  +G  LG C   G     N  QW
Sbjct: 186 PTLISETAPKHLRGT-----CVSFYQLMITLGIFLGYCTNYGTKTHTNSIQW 232

>CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P23585 Saccharomyces
           cerevisiae YMR011w HXT2 high-affinity hexose transporter
           or uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10
           or uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 11/112 (9%)

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGL---GIAFVL 182
           L  GRLGD+YG +++ L+  + V +  ++  I++ +    +F + R   GL   GIA + 
Sbjct: 128 LTLGRLGDMYG-RRLGLMAVITVYVVGIVIQISSTTTWYQYF-VGRIVSGLGVGGIAVLS 185

Query: 183 PNVLGIIGNIYVGGTFRKNIVISFVGAMAPIGATLG-CLFAGLIGTENPNQW 233
           P ++      ++ GT      +SF   M  +G  LG C   G     N  QW
Sbjct: 186 PTLISETAPKHLRGT-----CVSFYQLMITLGIFLGYCTNYGTKTHTNSIQW 232

>KLLA0F10043g Chr6 complement(928691..930277) [1587 bp, 528 aa] {ON}
           uniprot|Q701Q9 Kluyveromyces lactis KLLA0F10043g jen2
           Carboxylic acid permease
          Length = 528

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 9/115 (7%)

Query: 126 LISGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNV 185
           LI G LGD YG K   ++   L+I+  +  G  N   S + F+ CRA  G+    ++ +V
Sbjct: 132 LIFGYLGDRYGRKYSFVLTMALIIVIQIGTGFVN---SFSAFLGCRAIFGI----IMGSV 184

Query: 186 LGIIGNIYV--GGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFY 238
            G+     +       K+I+          G  LG +F   I   +P+ W   F+
Sbjct: 185 FGVASATALENAPNKAKSILSGIFQEGYAFGYLLGVVFQRAIVDNSPHGWRAIFW 239

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,143,195
Number of extensions: 2236001
Number of successful extensions: 7322
Number of sequences better than 10.0: 261
Number of HSP's gapped: 7441
Number of HSP's successfully gapped: 267
Length of query: 545
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 430
Effective length of database: 40,294,809
Effective search space: 17326767870
Effective search space used: 17326767870
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)