Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.178.844ON1131113154170.0
YML117W (NAB6)8.844ON1134113446260.0
Skud_13.248.844ON1128113344430.0
Suva_13.268.844ON1122113442010.0
TDEL0B005408.844ON1115102119030.0
NCAS0B002808.844ON108198216750.0
CAGL0B02365g8.844ON105098116640.0
ZYRO0G14256g8.844ON1259109416750.0
KNAG0G034408.844ON1053100416180.0
TPHA0I002708.844ON103994714840.0
SAKL0D01364g8.844ON1082100114331e-179
KLTH0C03784g8.844ON99796114151e-178
NDAI0E002708.844ON119853111671e-139
Kwal_27.102398.844ON91460411461e-139
Kpol_1068.58.844ON103251511401e-137
KAFR0A028508.844ON104248011211e-134
TBLA0B032808.844ON136230410361e-120
ABL122C8.844ON10436519891e-115
Ecym_46158.844ON10673208566e-97
KLLA0D01485g8.844ON11514228291e-92
NCAS0H010406.183ON6292134443e-45
KNAG0M004306.183ON4432134317e-45
AFL061C6.183ON5232184341e-44
TBLA0B052106.183ON7102144422e-44
SAKL0A05280g6.183ON5822144317e-44
KAFR0B066906.183ON5332144289e-44
NDAI0F022606.183ON6802134332e-43
Ecym_22336.183ON5762184254e-43
Kpol_1002.696.183ON5902134264e-43
TPHA0J022106.183ON5932624265e-43
TDEL0G016206.183ON5842144247e-43
CAGL0C01419g6.183ON6392144242e-42
KLLA0E19031g6.183ON6522134242e-42
Kwal_27.111586.183ON5672134085e-41
Suva_16.1236.183ON5962144071e-40
KLTH0H04906g6.183ON5692144051e-40
ZYRO0G08140g6.183ON6322134072e-40
YPL184C (MRN1)6.183ON6122144062e-40
Smik_6.3906.183ON6252134044e-40
Skud_16.946.183ON6142133992e-39
SAKL0E07128g2.306ON40193910.040
TDEL0G023602.306ON402209870.11
TPHA0C035202.306ON44275850.21
ZYRO0A02398g2.306ON41075850.23
Ecym_33442.306ON42175820.42
Skud_4.478.466ON34377820.45
Kwal_26.87638.670ON42682810.56
ACR135C8.670ON376200810.60
Kpol_1043.342.306ON44275810.60
NDAI0E011908.670ON358221810.62
KLTH0D11088g8.670ON42284810.71
TBLA0B071702.306ON47076810.75
KAFR0H016208.466ON33078800.78
KLLA0E08779g2.306ON47573800.79
YNL016W (PUB1)2.306ON45375800.85
Suva_14.3302.306ON45775800.89
Skud_14.3122.306ON45975800.92
Suva_4.398.466ON34875790.93
Smik_14.3132.306ON45175790.98
NDAI0F01720singletonON474111791.1
KAFR0D016608.797ON212175771.2
Ecym_24038.670ON375162781.5
Kpol_1045.553.211ON66953781.7
ZYRO0F07238g8.670ON389183771.7
TPHA0G010808.797ON22083752.0
Kpol_1036.373.211ON249353782.1
SAKL0D10098g1.370ON15450732.2
TDEL0B010108.797ON210164742.7
KAFR0G023206.104ON62079762.7
KLLA0C05522g6.104ON54084763.1
YOR242C (SSP2)8.670ON37156753.5
TPHA0L012008.466ON32280735.1
NCAS0B061402.306ON443172726.7
Suva_8.2928.670ON370182727.7
NDAI0C056508.566ON42952727.9
Smik_15.4268.670ON37159719.0
Kpol_543.175.486ON42874719.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.17
         (1131 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...  2091   0.0  
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...  1786   0.0  
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...  1716   0.0  
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...  1622   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   737   0.0  
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     649   0.0  
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   645   0.0  
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   649   0.0  
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   627   0.0  
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   576   0.0  
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   556   e-179
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   549   e-178
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     454   e-139
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   446   e-139
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   443   e-137
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   436   e-134
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   403   e-120
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   385   e-115
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   334   6e-97
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   323   1e-92
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   175   3e-45
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   170   7e-45
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   171   1e-44
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   174   2e-44
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   170   7e-44
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   169   9e-44
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    171   2e-43
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   168   4e-43
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   168   4e-43
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   168   5e-43
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   167   7e-43
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   167   2e-42
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   167   2e-42
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   161   5e-41
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   161   1e-40
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   160   1e-40
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   161   2e-40
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   160   2e-40
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   160   4e-40
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   158   2e-39
SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {...    40   0.040
TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.3...    38   0.11 
TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.3...    37   0.21 
ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} simila...    37   0.23 
Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar t...    36   0.42 
Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON} Y...    36   0.45 
Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {O...    36   0.56 
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    36   0.60 
Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {O...    36   0.60 
NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.6...    36   0.62 
KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {...    36   0.71 
TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa] ...    36   0.75 
KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON...    35   0.78 
KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} simila...    35   0.79 
YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly ...    35   0.85 
Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 ...    35   0.89 
Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016...    35   0.92 
Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON} Y...    35   0.93 
Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016...    35   0.98 
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    35   1.1  
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    34   1.2  
Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar t...    35   1.5  
Kpol_1045.55 s1045 (135384..136286,136336..136344,136387..137484...    35   1.7  
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    34   1.7  
TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON...    33   2.0  
Kpol_1036.37 s1036 (92633..100114) [7482 bp, 2493 aa] {ON} (9263...    35   2.1  
SAKL0D10098g Chr4 (844371..844835) [465 bp, 154 aa] {ON} similar...    33   2.2  
TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON...    33   2.7  
KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {O...    34   2.7  
KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some s...    34   3.1  
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    33   3.5  
TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.4...    33   5.1  
NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa] ...    32   6.7  
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    32   7.7  
NDAI0C05650 Chr3 (1305925..1307214) [1290 bp, 429 aa] {ON} Anc_8...    32   7.9  
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    32   9.0  
Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON} (37962..3...    32   9.7  

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
            (REAL)
          Length = 1131

 Score = 2091 bits (5417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1039/1131 (91%), Positives = 1039/1131 (91%)

Query: 1    MSNQNQRKPVANYAYRQQQDYNGMNAMVGNPIIYHPVDFINGAGQYGPSQHPAYYSNSPL 60
            MSNQNQRKPVANYAYRQQQDYNGMNAMVGNPIIYHPVDFINGAGQYGPSQHPAYYSNSPL
Sbjct: 1    MSNQNQRKPVANYAYRQQQDYNGMNAMVGNPIIYHPVDFINGAGQYGPSQHPAYYSNSPL 60

Query: 61   PNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAYSRPVSXXXXX 120
            PNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAYSRPVS     
Sbjct: 61   PNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAYSRPVSNHNNY 120

Query: 121  XXXXXXXXXXXXXGMVTPSNYYRIEXXXXXXXXXXXXXXXXXXKGCDXXXXXXXXXXXXX 180
                         GMVTPSNYYRIE                  KGCD             
Sbjct: 121  NGNNNSNQNNNNNGMVTPSNYYRIERNSFSRNNNSTRNSTHNNKGCDNRNSSGRRTSTRN 180

Query: 181  XIFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLE 240
             IFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLE
Sbjct: 181  NIFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLE 240

Query: 241  STYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKF 300
            STYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKF
Sbjct: 241  STYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKF 300

Query: 301  VCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPL 360
            VCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPL
Sbjct: 301  VCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPL 360

Query: 361  KSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYL 420
            KSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYL
Sbjct: 361  KSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYL 420

Query: 421  KKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVEXXXXXXXXXX 480
            KKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVE          
Sbjct: 421  KKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVENNNDNNNSNN 480

Query: 481  XXXXXXDANTHNSNNSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKLQGIQLDGTDLE 540
                  DANTHNSNNSTRASLYG                EEIDILTTKLQGIQLDGTDLE
Sbjct: 481  HKSNISDANTHNSNNSTRASLYGNSNVSLASLPSSVSLNEEIDILTTKLQGIQLDGTDLE 540

Query: 541  INYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNGSIV 600
            INYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNGSIV
Sbjct: 541  INYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNGSIV 600

Query: 601  PQQLMATPSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINP 660
            PQQLMATPSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINP
Sbjct: 601  PQQLMATPSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINP 660

Query: 661  RSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVG 720
            RSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVG
Sbjct: 661  RSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVG 720

Query: 721  WGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLRE 780
            WGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLRE
Sbjct: 721  WGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLRE 780

Query: 781  DFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKF 840
            DFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKF
Sbjct: 781  DFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKF 840

Query: 841  GGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKE 900
            GGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKE
Sbjct: 841  GGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKE 900

Query: 901  RAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLGLGV 960
            RAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLGLGV
Sbjct: 901  RAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLGLGV 960

Query: 961  ASSEVNRAASDETDYEDLFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVIN 1020
            ASSEVNRAASDETDYEDLFNK          IEVIMHSPSDPEYALKSQTLRSSSQTVIN
Sbjct: 961  ASSEVNRAASDETDYEDLFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQTVIN 1020

Query: 1021 SKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGETTSN 1080
            SKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGETTSN
Sbjct: 1021 SKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGETTSN 1080

Query: 1081 RKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHTEE 1131
            RKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHTEE
Sbjct: 1081 RKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHTEE 1131

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score = 1786 bits (4626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 884/1134 (77%), Positives = 944/1134 (83%), Gaps = 3/1134 (0%)

Query: 1    MSNQNQRKPVANYAYRQQQDYNGMNAMVGNPIIYHPVDFINGAGQYGPSQHPAYYSNSPL 60
            MSN N +KPVANYAYRQQQDYNGMNAMVGNP++YHPVDF+NGAGQYGPSQHPAYY+NSPL
Sbjct: 1    MSNSNSKKPVANYAYRQQQDYNGMNAMVGNPMMYHPVDFVNGAGQYGPSQHPAYYTNSPL 60

Query: 61   PNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAYSRPVSXXXXX 120
            PNIPPTPFDTAYGASL PSHLLMGSPFVSSPNMQ GY+ ARSSN KRKAYSRPVS     
Sbjct: 61   PNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSARSSNLKRKAYSRPVSNHNGY 120

Query: 121  XXXXXXXXXXXXXGMVTPSNYYRI-EXXXXXXXXXXXXXXXXXXKGCDXXXXXXXXXXXX 179
                         GMVTPSNYYR+                    KGCD            
Sbjct: 121  NGNSNSNQNNTNNGMVTPSNYYRMGRNSFSRNNNSTRNVTHNNNKGCDTRNNSGRRTFAR 180

Query: 180  XXIFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTL 239
              IFDDI  E+LLQRPF INYK+LPTGDDAYRTRSLLIENVD S DLHSIVKNFVKSNTL
Sbjct: 181  NNIFDDILPEMLLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTL 240

Query: 240  ESTYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLK 299
            ES Y+I   KSDD KD +T NLSILISFLT+ DCLNFYNNILQRLSEFKTFLKSE+LNLK
Sbjct: 241  ESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLK 300

Query: 300  FVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSP 359
            FVCLNYD KCL TFIE +ALTEN E+ DITN S+MISASLHH++ NKDATRSII+EFKSP
Sbjct: 301  FVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISASLHHNIANKDATRSIIIEFKSP 360

Query: 360  LKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDY 419
            ++ ++LF KKLQFLDRS NKRYILESID+VNTDVPSNQFPENYAVLTFLNI MAIEVLDY
Sbjct: 361  VEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNISMAIEVLDY 420

Query: 420  LKKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVEXXXXXXXXX 479
            LKKYSK LGISKCFYVSLAPLV+SS RSSVANIYE KTSTHRLSVPSV            
Sbjct: 421  LKKYSKNLGISKCFYVSLAPLVVSSARSSVANIYEGKTSTHRLSVPSVTAGNNNDSNNNG 480

Query: 480  XXXXXXXDA-NTHNSNNSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKLQGIQLDGTD 538
                       T N+N+S   S+YG                EEID+L TKLQG++LDGT 
Sbjct: 481  NNNKSNMSGITTLNNNSSIGVSVYGHSNMSLTSLSSSVSLNEEIDMLATKLQGVELDGTY 540

Query: 539  LEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNGS 598
            LEINY DYQTPT+ EHSTHLSNVKISKT ENSRQF  DIPSPLPLNE MFMNDSN SNG+
Sbjct: 541  LEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQDIPSPLPLNEHMFMNDSNQSNGA 600

Query: 599  IVPQQLMATPSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNI 658
            I+PQQL+ATPSPVS  +QMNQRVLPNPITQSLEQNFNVSAKVASSMGSD+GNRTIYIGNI
Sbjct: 601  IIPQQLIATPSPVSPNLQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNI 660

Query: 659  NPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 718
            NPRS+AEDICNVVRGGILQSIKY+PEK+ICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR
Sbjct: 661  NPRSKAEDICNVVRGGILQSIKYIPEKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 720

Query: 719  VGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL 778
            VGWGHYSGPLPK ISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL
Sbjct: 721  VGWGHYSGPLPKLISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL 780

Query: 779  REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEK 838
            REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKEST  NE GE+T K ATE+
Sbjct: 781  REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTVQNESGEVTLKRATEE 840

Query: 839  KFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDK 898
            KFGGRY+GLLINYGKDRCGNINKNL+AGKNSRFYKKVKRPSYNIRLSKLEE+RRQNE D+
Sbjct: 841  KFGGRYKGLLINYGKDRCGNINKNLIAGKNSRFYKKVKRPSYNIRLSKLEEKRRQNEIDE 900

Query: 899  KERAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVNR-SNETVGIGGLG 957
            KE+AFDK LNLESLGISLD+HKD G GE    N  G E E+E EA N   NET   GGLG
Sbjct: 901  KEKAFDKPLNLESLGISLDAHKDNGGGETGTANNTGHENESELEAENENGNETGSFGGLG 960

Query: 958  LGVASSEVNRAASDETDYEDLFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQT 1017
            L VASS+V RA SDETDYED+FNK          +EVIMHSPSDPEYALKSQTLRSSSQT
Sbjct: 961  LAVASSDVKRATSDETDYEDIFNKSSGSSDSSSDVEVIMHSPSDPEYALKSQTLRSSSQT 1020

Query: 1018 VINSKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGET 1077
            VINSKRPVK EDEE+AV +SQ N++SSLR APPRAPSTLSYN SK NETP++DI  NGET
Sbjct: 1021 VINSKRPVKIEDEEEAVGMSQLNYRSSLRQAPPRAPSTLSYNHSKNNETPMQDIFTNGET 1080

Query: 1078 TSNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHTEE 1131
             +NRKK RGSF RHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTH +E
Sbjct: 1081 ANNRKKKRGSFARHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
            (REAL)
          Length = 1128

 Score = 1716 bits (4443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 866/1133 (76%), Positives = 939/1133 (82%), Gaps = 7/1133 (0%)

Query: 1    MSNQNQRKPVANYAYRQQQDYNGMNAMVGNPIIYHPVDFINGAGQYGPSQHPAYYSNSPL 60
            M N N RKP ANYAYRQQ DYNGMNAMVGN ++YHPVDFING GQYG SQHPAYY+NSPL
Sbjct: 1    MPNSNPRKPGANYAYRQQHDYNGMNAMVGNQMMYHPVDFINGVGQYGSSQHPAYYTNSPL 60

Query: 61   PNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAYSRPVSXXXXX 120
            PN+PPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSN KRKAYSRPVS     
Sbjct: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNLKRKAYSRPVSNQNGY 120

Query: 121  XXXXXXXXXXXXXGMVTPSNYYRIEXXXXXXXXXXXXXXX-XXXKGCDXXXXXXXXXXXX 179
                         GM+TPSNYYR                     KGCD            
Sbjct: 121  NGNSSNHNHSGN-GMMTPSNYYRNGRNSSSRNNNSTRNVSHNNNKGCDTRNSSGRRASSR 179

Query: 180  XXIFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTL 239
              IFD+I+ E+LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHS+VKNFVK NTL
Sbjct: 180  SNIFDEINPEILLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTL 239

Query: 240  ESTYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLK 299
            ES Y + N+K+DDL+D +T NLS+LISFLTRSDCLNFYNNILQRLSEFK FLKS+SLNLK
Sbjct: 240  ESAYFVDNDKNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLK 299

Query: 300  FVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSP 359
            FVCLNY+ +CLSTF+E +   E  EQ+   NDS MISASLHHD+ENKDATRSII+EFKS 
Sbjct: 300  FVCLNYESECLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSA 359

Query: 360  LKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDY 419
            L+ TELF K+LQFLD S NKRYILESID+VNTDVPSNQFPENYAVLTFLNIFMA+EVLDY
Sbjct: 360  LEKTELFRKRLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDY 419

Query: 420  LKKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVEXXXXXXXXX 479
            LKK+SK L ISKCFYVSL PL++SSTRSSVANIYE KT+T RLSVPSVP           
Sbjct: 420  LKKFSKSLEISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPA-GIKNDNNNN 478

Query: 480  XXXXXXXDANTHNSNNSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKLQGIQLDGTDL 539
                     N  N+N+S  +S+YG                EEID+LTTKLQGI+LDGT L
Sbjct: 479  SNKGNISSINAQNNNSSIGSSIYGNSNISLTSLSSSVSLNEEIDLLTTKLQGIELDGTSL 538

Query: 540  EINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNGSI 599
            EI  HDY TPT++EHSTHLSN+KISKTVENSR FP DIPSPLPLNE+MFMNDSN SNG++
Sbjct: 539  EITSHDYSTPTINEHSTHLSNIKISKTVENSRHFPQDIPSPLPLNEQMFMNDSNQSNGAV 598

Query: 600  VPQQLMATPSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNIN 659
            +PQQL+A PSP+SS +Q+NQRVLPN ITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNIN
Sbjct: 599  IPQQLIAAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNIN 658

Query: 660  PRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRV 719
            PRSRAEDICNVVRGGILQSIKY+PEKRI FVTFIEAPSAVQFYANSFIDPIVLHGNMLRV
Sbjct: 659  PRSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRV 718

Query: 720  GWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLR 779
            GWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYK+LHETL+LPDAEQLR
Sbjct: 719  GWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLR 778

Query: 780  EDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKK 839
            EDFSTYGDIEQINYLSDSHCCWINFMNISSAI LVEEMNKES AH++ GE+  KTA E+K
Sbjct: 779  EDFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEK 838

Query: 840  FGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKK 899
            F GRY+GLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKK
Sbjct: 839  FDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKK 898

Query: 900  ERAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVN-RSNETVGIGGLGL 958
            E +FDK LNLESLGISLD HKD GIG IE +N  G EIE+E EA N   NET G+GGLGL
Sbjct: 899  E-SFDKVLNLESLGISLDPHKDAGIGVIETENITGDEIESEIEAENVNDNETTGLGGLGL 957

Query: 959  GVASSEVNRAASDETDYEDLFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTV 1018
            GVA+ +V RA SDETDYE+LFNK          IEVIMHSPSDPEYALKSQTLRSSSQTV
Sbjct: 958  GVANCDVKRATSDETDYEELFNKSSGSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQTV 1017

Query: 1019 INSKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGETT 1078
            INSKRPVK EDE+D V ISQ NH+SSLR APPRAPSTLSY+  KK+ET  +D   N ET 
Sbjct: 1018 INSKRPVKVEDEDD-VGISQLNHRSSLRQAPPRAPSTLSYDHLKKSETSFQD-SRNAETA 1075

Query: 1079 SNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHTEE 1131
            +NR++ RGS PRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN ++EE
Sbjct: 1076 NNRERKRGSLPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSEE 1128

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
            (REAL)
          Length = 1122

 Score = 1622 bits (4201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 831/1134 (73%), Positives = 916/1134 (80%), Gaps = 15/1134 (1%)

Query: 1    MSNQNQRKPVANYAYRQQQDYNGMNAMVGNPIIYHPVDFINGAGQYGPSQHPAYYSNSPL 60
            MSN N RKP AN+AYR+Q D+NGMNAMVGNP++YHPVDF+NGAGQYGPSQHPAYY+NSPL
Sbjct: 1    MSNSNSRKPSANHAYRKQHDHNGMNAMVGNPMLYHPVDFMNGAGQYGPSQHPAYYTNSPL 60

Query: 61   PNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSNFKRKAYSRPVSXXXXX 120
            PN+PPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGY+  RSS F RKAYSRP+S     
Sbjct: 61   PNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFNRKAYSRPISSQNSY 120

Query: 121  XXXXXXXXXXXXX--GMVTPSNYYR-IEXXXXXXXXXXXXXXXXXXKGCDXXXXXXXXXX 177
                           GM+TPS+YYR                     KG +          
Sbjct: 121  NANHNNNNNNSNSNNGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIHKGYETRNSSGRRTS 180

Query: 178  XXXXIFDDISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSN 237
                IFD+I  E LLQ+PFRINYKILP GDDAYRTRSLLIENVD S DLHS+VKNFVKSN
Sbjct: 181  SRINIFDEIDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSN 240

Query: 238  TLESTYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLN 297
             LES YI+G++++D+L+ E+T NLSILISFLTR DCLNFYNNILQRLSEFKTFLKS+SLN
Sbjct: 241  ALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLN 300

Query: 298  LKFVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFK 357
            LKFVCLNYD K L T +ED+ L+ + EQ    + S+MISASLHHD+ENKDATRSII+EFK
Sbjct: 301  LKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASLHHDVENKDATRSIIIEFK 360

Query: 358  SPLKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVL 417
            SPL+  ELF +KLQFLDRS NKRYILESIDIV+TDVPSNQFPENY VLTFLNIFMAIEVL
Sbjct: 361  SPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFPENYVVLTFLNIFMAIEVL 420

Query: 418  DYLKKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVEXXXXXXX 477
            DYLKKYSKKLGISKCFYVSL PL++SS RSSVA+IYE K+S+HRLS PSVP         
Sbjct: 421  DYLKKYSKKLGISKCFYVSLTPLMVSSARSSVASIYESKSSSHRLSTPSVPAGNNNDINN 480

Query: 478  XXXXXXXXXDANTHNSNNSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKLQGIQLDGT 537
                       N +N+N S  +S+YG                EEI++LTTKLQGI LDGT
Sbjct: 481  ----------INNNNNNGSIGSSIYGNSNISLTSLSSSVSLNEEIEVLTTKLQGIDLDGT 530

Query: 538  DLEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNG 597
             LE+  HDY TP ++EHS HLSN+KISKTV+NSRQF  DIPSPLPLNE MFM DSN SNG
Sbjct: 531  ILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDIPSPLPLNEHMFMTDSNQSNG 590

Query: 598  SIVPQQLMATPSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGN 657
            +IV QQL+  PSP S   QMNQRVLPNPITQSLEQNFNVSAKVASSMGSD+GNRTIYIGN
Sbjct: 591  TIVSQQLITAPSPQSPNPQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGN 650

Query: 658  INPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNML 717
            INPRSRAEDICNVVRGGILQ+IKY+ EKRICFVTFIEA SAVQFYANSFIDPIVLHGNML
Sbjct: 651  INPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEAASAVQFYANSFIDPIVLHGNML 710

Query: 718  RVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQ 777
            RVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYK+LHETL+LPDAEQ
Sbjct: 711  RVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQ 770

Query: 778  LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATE 837
            LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMN+E T H++ GE+  KTATE
Sbjct: 771  LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNEEPTGHDDSGELIPKTATE 830

Query: 838  KKFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEND 897
            +KF GRY+GLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEND
Sbjct: 831  EKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEND 890

Query: 898  KKERAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLG 957
            KKE +FDK LNLESLGISLD HK   I E E +   G E           NETVG+GGLG
Sbjct: 891  KKE-SFDKVLNLESLGISLDPHKGTDIDEAEAEGTTGAE-VENEVEAENGNETVGLGGLG 948

Query: 958  LGVASSEVNRAASDETDYEDLFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQT 1017
            LGV +S+V RA SDETDY++ FNK          IEVIMHSPSDPEYALKSQTLRSSSQT
Sbjct: 949  LGVVNSDVKRALSDETDYDEFFNKSSRSSDSSSDIEVIMHSPSDPEYALKSQTLRSSSQT 1008

Query: 1018 VINSKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGET 1077
            V+NSKRP K E+E+  V +SQFNH+SSL+ APPRAPSTLS+N SKKN+ PI+D   N E 
Sbjct: 1009 VLNSKRPAKVENEDGLVGLSQFNHRSSLKQAPPRAPSTLSHNHSKKNQMPIQDAGINAEV 1068

Query: 1078 TSNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHTEE 1131
            T N+ K RGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN +++E
Sbjct: 1069 TDNKTKKRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/1021 (42%), Positives = 605/1021 (59%), Gaps = 152/1021 (14%)

Query: 192  LQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNEKSD 251
             + PF + Y++LP G+D +RTRSLL ENVD S DLHS V NF     +ES Y+  +E   
Sbjct: 162  FKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKSE--- 218

Query: 252  DLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCLS 311
                    ++SIL+SF +++ CL+FYN++LQRLSE+K+ L S++L L FV L Y    +S
Sbjct: 219  ------GDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYK---VS 269

Query: 312  TFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPLKSTELFNKKLQ 371
               E+D   E+  + D  N ++  + SL +D+ N+ ATRSI++ FK+P    EL +KKL+
Sbjct: 270  DTSEEDIDKEDDSKPDAFNITA--AGSLRYDVINRGATRSIMITFKTPCSKDELIDKKLE 327

Query: 372  FLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLKKYSKKLGISK 431
            FL + NN RY+LESID+V  D PS  FP+NYAVLTFLNIFMA+E+LDY++ +S+KL ISK
Sbjct: 328  FLKKENNTRYVLESIDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISK 387

Query: 432  CFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVEXXXXXXXXXXXXXXXXDANTH 491
            CF++S+ P +    R SV+      ++++  S+ S+                    +  +
Sbjct: 388  CFFISIQPQIPDGKRLSVS------SASNGRSMESI--------------------SGNY 421

Query: 492  NSNNSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKLQGIQLDGTDLEINYHDYQTPTV 551
             S N++  SL                  +EID +T KLQ +      LE+  ++Y+ P+ 
Sbjct: 422  RSKNASVTSL--------ESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSF 473

Query: 552  HEHSTHLSNVKISKTVENSRQFPHDIPSP---------LPLNERMFMNDSNHSNG----- 597
              H+ HL+NV +S+      Q    +PSP         LP  +    ND N++       
Sbjct: 474  EGHTDHLTNVTVSEAASLDSQL--TMPSPQEVTVNEYVLPNQDMPLPNDMNYAPSVQDVD 531

Query: 598  ----SIVPQQLMAT-------PSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMGS 646
                S+VP   M         P P    ++ N   +  PITQSL++ +  SA+VASSMG 
Sbjct: 532  AVPPSMVPMSTMPNTPYGCYMPPP---NVRQNGN-MTKPITQSLQRQYATSAEVASSMGG 587

Query: 647  DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
             +GNRT+YIGNI+PRSR EDICNVVRGGILQ++K++ EKRICFVTF+EA +AVQFY N+F
Sbjct: 588  GIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVEASAAVQFYTNAF 647

Query: 707  IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
            IDPIVLHGNML+VGWGH+SGPLPKSI+LAVT+GASRNVYVSLPEFAFK+K+I+DPQY++ 
Sbjct: 648  IDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFKDKYIYDPQYEEY 707

Query: 767  HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
            ++   LPD EQLR+DFS YGDIEQINYL+D HCCW+NF NIS+AI LVEE+  E   +  
Sbjct: 708  NKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLVEEVKYEGGGN-- 765

Query: 827  DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSK 886
                       K  GGRY+GL+I YGKDRCGN+NKN +AGKNSRFYKKVK+PS+NIRLSK
Sbjct: 766  ---------FYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRLSK 816

Query: 887  LEERRRQNEND---KKERAFDKALNLESLGISLDSHKDIGIGEIEN-------------- 929
            +EE RRQ+E     ++E   +K L   SLGI++DS+      ++++              
Sbjct: 817  MEEERRQHEETLRRQQENNSEKFLQFGSLGITIDSNGKEDPEKVDDVDFEDEVKFDSNSP 876

Query: 930  ----KNCIGREI-ENEAEAVNRSNETVGIGGLGLGVASSEVNR--AASDETDYEDLFNKX 982
                +   G+E  + E E +  SN++ G  GL +  +  +  R   A+  T      ++ 
Sbjct: 877  KKTVEQASGKESDQEEQELLKLSNKSQGAQGLNIVESQGQSTREKEATKLTRNHSENDET 936

Query: 983  XXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKAEDEEDAVEISQFNHK 1042
                     +E+I++SP + E   KS++ R   +   N +R + A   E A    +F   
Sbjct: 937  SAKSDASSDVELIINSPEEEESNFKSKSNRGFRK---NDRRKL-ANCAEGASSKERFKST 992

Query: 1043 SS----------LRHAPPRAPSTLSYN-----RSKKNETPIRDIVPNGETTSNRKKNRGS 1087
            ++          L   PP AP+T+S N     + + N   +RD    GE+  +  +   +
Sbjct: 993  TNDVSSALSSSSLEANPPMAPATISRNYSLMFKQQYNHEKLRDF--EGESFDDESQQESN 1050

Query: 1088 F----------------PRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAE-DNTHTE 1130
            F                   ++IPGSDVMAQYLAQ+QHSTF+YAANILGAS + DN + +
Sbjct: 1051 FDFESTQQTRRRRYPNRRHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLD 1110

Query: 1131 E 1131
            E
Sbjct: 1111 E 1111

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 35/43 (81%)

Query: 51 HPAYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93
           P YY   P+ N PPTPFDTAYG +LLPSHLLMGSPFVSSPN+
Sbjct: 44 QPMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNL 86

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/982 (40%), Positives = 555/982 (56%), Gaps = 116/982 (11%)

Query: 191  LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNEKS 250
            L  +PFR++YKILP+GDDAYRTRSLL ENV  S +LH+ +  FV+ + +ES Y+I +  S
Sbjct: 172  LFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHDS 231

Query: 251  DDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCL 310
            D   D+ T   SIL+SFLTR  CL FYNN+LQRL EFK  LKSE+L L FV + Y     
Sbjct: 232  DK-PDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKY----- 285

Query: 311  STFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPLKSTELFNKKL 370
                +D+   E    +D    S     S++ +L N  ATRSI+++FK+P    ELF+KKL
Sbjct: 286  ----QDENEEEETNIVD--EPSFYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKL 339

Query: 371  QFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLKKYSKKLGIS 430
            +FL++ NN RYILESID+VN     N+FP++YA+LTF+NI MA+E+ DYLK +  + GI 
Sbjct: 340  KFLNQENNSRYILESIDLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQ 399

Query: 431  KCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVEXXXXXXXXXXXXXXXXDANT 490
             C +V + P  +S   S  A+I       +  ++ S   +                    
Sbjct: 400  DCMFVQVIPKAVSCVSSKRASIISKDNDNNDETLSSQQKKNDILK--------------- 444

Query: 491  HNSNNSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKLQGIQLDGTDLEINYHDYQTPT 550
                NS+  SL                  E++D L+ KL+   ++   L ++   Y  P+
Sbjct: 445  ----NSSIISL-------PSAENDQVSDEEKLDKLSEKLKSTNIEELILIVDTATYPRPS 493

Query: 551  VHEHSTHLSNVKISKTVENSRQFPHDIP---------------SPLPLNERMFMNDSNHS 595
               H  HL N  +S +  +S  F   +P                 LP N + F N  N  
Sbjct: 494  FLSHDEHLPNATLSLS-SSSNPFEQQLPYSYEEDDDQRTNVRSGSLPANPQ-FPNMPNLP 551

Query: 596  NGSIVPQQLMATPSPVS--------------STIQMNQRVLPNPITQSLEQNFNVSAKVA 641
             G I P   M   +P+               +    N     NPI+++LEQ+   +++V 
Sbjct: 552  KGYISPNPNMNYNTPLMYPNGYFVNDPAFSMNNNYNNNTNYRNPISKTLEQHATTTSQVV 611

Query: 642  SSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQF 701
            +S+G+D GNRTIYIGNIN RS+ EDICNVVRGGILQ++KY+  K ICF+TFIEA +A+ F
Sbjct: 612  NSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHKHICFITFIEASAAIHF 671

Query: 702  YANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDP 761
            YANSFIDPIVLH + L++GWG+Y  PLPK+++LAVT+GASRNVYVSLPEFAFK+KFI+DP
Sbjct: 672  YANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVYVSLPEFAFKDKFINDP 731

Query: 762  QYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKES 821
            +Y++ H+   LP A+QLR DFS YG IEQINYL DSHCCW+NF+NIS+AI LVE+     
Sbjct: 732  EYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFLNISAAIRLVED----- 786

Query: 822  TAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYN 881
             AHN       ++   +KF  RY+GL+INYGKDRCGN+NK+L++ KNSRFYKKVK  S N
Sbjct: 787  -AHN-----PVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMSNKNSRFYKKVKSISNN 840

Query: 882  IRLSKLEERRRQNEND----KKERAFDKALN-LESLGISLDS-HKDIGIGEIENKNCIGR 935
            ++L +LEE+R+ +       +K  + D  L+ L++ GI +D+   +   G IE  N + +
Sbjct: 841  VKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDTVSNNEEDGNIEKGNTLSK 900

Query: 936  EIENEAEAVNRSNETVGIGGLGLGVASSE--VNRAASDETDYEDLFNKXXXXXXXXXXIE 993
             I+ +           G   LG  +      +N    + T+  +              IE
Sbjct: 901  -IDTDVN---------GFNALGFKIEPKHDMMNETMDNNTEGNNTLENISSDESSN--IE 948

Query: 994  VIMHSPSDPEYALKSQTL---RSSSQTVINSKRPVKAEDEEDAVEISQFNHKSSLRHAPP 1050
            +++ SP   E   K   +   +  S    N KR   +  +      +Q  H+++      
Sbjct: 949  LMISSPK--ESVQKGDVITNQKPHSNNHHNFKRNSSSNRQRYKETDTQNTHRNNNNSNAT 1006

Query: 1051 RAPSTLSYNRSKKNETPIRDIVPN-GETTSNRKKNRGSFPRHRTIPGSDVMAQYLAQVQH 1109
             AP          N+     I PN  E   N KK+  +    R IPGSDVMAQYLAQ+QH
Sbjct: 1007 FAP----------NKEFGFGISPNVDEHQKNNKKHNTNDKEARVIPGSDVMAQYLAQLQH 1056

Query: 1110 STFMYAANILGASAEDNTHTEE 1131
            STFMYAANILGASAED ++ +E
Sbjct: 1057 STFMYAANILGASAEDGSYYDE 1078

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 37/47 (78%), Positives = 42/47 (89%), Gaps = 1/47 (2%)

Query: 45  QYGPSQHPAYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSP 91
           QY P+Q P YY  SPLPN+PPTPFDTAYGA+LLPSHLLMGSPFV++P
Sbjct: 61  QYFPTQQP-YYQTSPLPNVPPTPFDTAYGATLLPSHLLMGSPFVATP 106

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/981 (40%), Positives = 552/981 (56%), Gaps = 140/981 (14%)

Query: 185  DISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSI-VKNFVKSNTLESTY 243
            D++ +L+   P  INY++LP+GDD Y+TRSLL ENV ++ ++ S+ ++  +  + +ES Y
Sbjct: 161  DVTKKLI--SPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVY 218

Query: 244  IIGNEKSDDLKDEQTSNLSIL-ISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVC 302
            +     +     E   +   L +SFL+R   L+FYNN LQRL +FK  L S  L++ FV 
Sbjct: 219  VFQQTDTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVS 278

Query: 303  LNYDFKCLSTFIEDDALTENVEQIDITNDSSMIS-ASLHHDLENKDATRSIIVEFKSPLK 361
             +Y         +D     N E+ +I     ++   +L  ++ + DATRSI +EF S ++
Sbjct: 279  FSYVTDEDKDKDKDKDKDINTEKRNIKRSQELLKEPALGEEIFSHDATRSIAIEFYSQVE 338

Query: 362  STELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLK 421
               LF +KL FLD  +NKRYILE++DI++ +  ++ FP NY +LTF+NI MAIEVLDYLK
Sbjct: 339  QDALF-EKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLK 397

Query: 422  KYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVEXXXXXXXXXXX 481
                   +++CF+VSL P   S   SS   +    ++    SV  V              
Sbjct: 398  ANLMTYSVNECFFVSL-PGCKSQRESSTTPVLGHISTEGSKSVSEV-------------- 442

Query: 482  XXXXXDANTHNSNNSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKLQGIQLDGTDLEI 541
                   N  N  N+                        E++ L+ +L  ++L+   L+I
Sbjct: 443  -------NLANGGNTVMID-------------------RELESLSDELASLKLEEKCLKI 476

Query: 542  NYHDYQTPTVHEHSTHL-SNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNGSIV 600
               DY  P +  H  H+  +   S  + +    P         N  M+++D+   + SI+
Sbjct: 477  IRSDYPKPEIRSHDDHIPGSTNFSMYIFDDGMNPEG-------NSGMYLHDNLTDHSSII 529

Query: 601  PQQLMATPSPVSSTIQMNQRVLP------------------------NPITQSLEQNFNV 636
                     P  S + +    LP                          ITQS+E   N 
Sbjct: 530  GSPFSNYIDPSISHVMLPNNGLPVGGFDAPGKFPIEPISGPPFNHTNKVITQSIEDRLNT 589

Query: 637  SAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAP 696
            SA++A++MG D  NRT+YIGNINPRS+ EDICNVVRGGILQ++K++ +KRICFVTFIEA 
Sbjct: 590  SARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKFIEDKRICFVTFIEAS 649

Query: 697  SAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEK 756
            +A QF ANSFIDPIVLHGN LRVGWG+ SGPLPKSI+LAVT+GA+RNVYVSLPE+AFK+K
Sbjct: 650  AAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGANRNVYVSLPEYAFKDK 709

Query: 757  FIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEE 816
            FI+DP+YK+ HE   LP  EQLR+DF+TYG+IEQINYL DSHCCW+NF+NI+SAI LVE+
Sbjct: 710  FINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCWVNFINIASAIRLVED 769

Query: 817  MNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVK 876
            +N     HN +GE  H     KKF  RYEGL+INYGKDRCGNINKNL+AGK S+FYKKVK
Sbjct: 770  IN-----HN-NGEEFH-----KKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFYKKVK 818

Query: 877  RPSYNIRLSKLEERRRQNENDKKERAFDKALNLESLGISLD------SHKDIGIGEIENK 930
            +PSY+IR+ K+EE+R+  E++   +    ++ L+SLGIS+D      S    G    E  
Sbjct: 819  KPSYDIRIKKMEEKRKMQEDNLLSQK-KNSIQLDSLGISVDRTFSNESKLSGGHTTTEEN 877

Query: 931  NCIGREIE-NEAEAVNRSNETVGIGGLGLGVASSEV--NRAASDETDYEDLFNKXXXXXX 987
              + +++E N+ ++ +    + G  G+GL    S +  + + SDE+   D  N       
Sbjct: 878  GGVKQDLESNDYKSDHPQISSNGPIGIGLSSKKSPIFDDISGSDESVISDFENSASKET- 936

Query: 988  XXXXIEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKAEDEEDAVEISQFNHKSSLRH 1047
                      S SD +Y    QT  S   T                     F  K++L H
Sbjct: 937  ----------SSSDRKY----QTTNSRGDT---------------------FVPKTNLSH 961

Query: 1048 APPRAPSTLSYNRSKKNET-PIRDIVPNGETTSNRKKNRGSFPRH---RTIPGSDVMAQY 1103
            APPRAPST++    K +   P+    P  +     K+   +FP     R IPGSDVMAQY
Sbjct: 962  APPRAPSTINMTYKKISYVPPLNGQAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQY 1021

Query: 1104 LAQVQHSTFMYAANILGASAE 1124
            LAQ+QHSTFMYAANILGAS E
Sbjct: 1022 LAQLQHSTFMYAANILGASVE 1042

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 43/63 (68%), Gaps = 10/63 (15%)

Query: 57  NSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPN---------MQGGYSP-ARSSNFK 106
           NSP  N+PPTPFDTAYGASLLPSHLLMGSP +S+ N         + GGY+   RS  F+
Sbjct: 43  NSPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFR 102

Query: 107 RKA 109
           R +
Sbjct: 103 RNS 105

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
            {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
            YML117W NAB6 Putative RNA-binding protein based on
            computational analysis of large-scale protein-protein
            interaction data
          Length = 1259

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1094 (38%), Positives = 577/1094 (52%), Gaps = 210/1094 (19%)

Query: 188  SELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGN 247
            ++ + + PF + Y++LP GDD YRTRSLL ENV+ S DL+S V  + +   +ES Y+   
Sbjct: 207  ADKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMF-K 265

Query: 248  EKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDF 307
            +++D  K       S+L+SFL+R  CL+ YN++LQRL+EFKT LKS+SL + FV L Y  
Sbjct: 266  DRNDKTKH------SVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRK 319

Query: 308  KCLSTFIE--DDALTENVEQIDITNDSSM---------------ISASLHHDLENKDATR 350
                  ++  D++ +  + + D T+ S                 + ASL +D+ N+ ATR
Sbjct: 320  HVDENEVDQNDNSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATR 379

Query: 351  SIIVEFKSPLKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNI 410
            S+ +E       T+L +++L FL  +NN+RY+LESI ++N   P   FP+NYA+LTFLNI
Sbjct: 380  SVALELDGEYDKTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNI 439

Query: 411  FMAIEVLDYLKK-YSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPV 469
             MA+EVLDY++   + +    KCF+VS++    +S+   +     + TS     V S   
Sbjct: 440  SMAVEVLDYVRNNETARSKFQKCFFVSVSSCPQTSSDGGI-----VTTSNSITPVAS--- 491

Query: 470  EXXXXXXXXXXXXXXXXDANTHNSNNSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKL 529
                             D   + S N++ +SL                  +EID L++ L
Sbjct: 492  -------GGSAGIATNGDLGGYTSKNASLSSL--------NSVGSYISLDQEIDFLSSSL 536

Query: 530  QGIQLDGTDLEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFM 589
            +G       + +   +Y  P   E S HLSN  + +      Q    I SP P    +  
Sbjct: 537  KGSHT----ITVAVDEYPKPFFAEFSDHLSNASVLEASALDTQ----ISSPHPQEVIVPS 588

Query: 590  NDSNHSNGS--IVPQQLMATPS------PVSSTIQMNQ-----------RVLPNPITQSL 630
             DS    G+  +      ATP+      P+   + MN            + +  PITQSL
Sbjct: 589  QDSPLVGGAPPLDAVHPAATPALSSQVLPLQPHMAMNSGIYMEPFGRRNKTMIKPITQSL 648

Query: 631  EQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFV 690
            ++ F  SA+VA+SMG  +GNRT+YIGNI+PRS+ EDICNVVRGGILQSI+++ +K ICFV
Sbjct: 649  QKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDKHICFV 708

Query: 691  TFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPE 750
            TFIEA +AVQFY N+FIDPIVLHGNML+VGWGH+SGPLPKS+SLAVT+GASRNVYVSLP+
Sbjct: 709  TFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVYVSLPD 768

Query: 751  FAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSA 810
            FAFK+K+I+DPQY++  +   LP  EQLR DF+ +GDIEQIN+LSD HCCW+NFMNISSA
Sbjct: 769  FAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFMNISSA 828

Query: 811  ISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNSR 870
            I LVEE+         DGE  HK+     F  RY GL+I YGKDRCGN+NKNL++GKNSR
Sbjct: 829  IKLVEEIKY------NDGEAFHKS-----FDNRYRGLIIGYGKDRCGNVNKNLISGKNSR 877

Query: 871  FYKKVKRPSYNIRLSKLEERRRQNEN---DKKERAFDKALNLESLGISLD---------- 917
            FYKKVK+PSYNIRLS++EE R+++E     + +   +K L   SLGI L+          
Sbjct: 878  FYKKVKKPSYNIRLSRMEEERKKHEETLRSQNQNNDEKMLQFGSLGIHLEGNDNNKTSYE 937

Query: 918  ------------------SHKDIGIG--------------------EIENKNCIGREIEN 939
                              + K  G G                      EN     +  E 
Sbjct: 938  RSLNGEEEEEQEEVEPNEAEKANGEGGREKDEDNNQEPMNPISKDGNSENHGSGEKYQEE 997

Query: 940  EAEAVNRSNETVGIGGLGL-GVASSEVNRAASDETDYEDLF----NKXXXXXXXXXXIEV 994
            E E +  SN++  I GLG+  VA +  +  AS + D  D      ++          +E+
Sbjct: 998  EKELLKLSNKSQIIDGLGIAAVAGNGKDMVASQDQDILDRAHESGDEESLDSGVSSNVEL 1057

Query: 995  IMHSPSDPE-----------YALKSQTLRSSSQTVINSKRPVKAEDEEDAVEISQFNHKS 1043
            I+HSP + +              KS+ L + S T         +   E A  +S      
Sbjct: 1058 ILHSPLEGDSNNQKKHEKNNKPFKSKKLENVSATGTGDVSNYNSSLGEGASAVSN----P 1113

Query: 1044 SLRHAPPRAPSTLSYNRSKKNET------PIRD--------------------------- 1070
            S+   PP APST+S N S   +T      P RD                           
Sbjct: 1114 SISMNPPIAPSTISRNYSLMMKTQNGHPHPRRDSSDRQNQQQQQQQQQQQQQQQQQQQQH 1173

Query: 1071 -----IVPN---------------GETTSNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHS 1110
                   PN               G +   + K R      + IPGSDVMAQYLAQ+QHS
Sbjct: 1174 QQQQQQQPNPSSSHNSGDRMSSHVGNSRGQQGKGRNKRRNAKAIPGSDVMAQYLAQLQHS 1233

Query: 1111 TFMYAANILGASAE 1124
            TFMYAANILGA+AE
Sbjct: 1234 TFMYAANILGATAE 1247

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/69 (57%), Positives = 49/69 (71%), Gaps = 5/69 (7%)

Query: 27  MVGNPIIYHPVDFINGAGQYGPSQHPAYYS--NSPLPNIPPTPFDTAYGASLLPSHLLMG 84
           M  +P+ + PV  +    QY P Q PAYY+    PL N PPTPFDTAYG +LLPSHLL+G
Sbjct: 47  MANSPMAFPPVGSLQA--QYAPPQ-PAYYAAAGPPLMNPPPTPFDTAYGITLLPSHLLIG 103

Query: 85  SPFVSSPNM 93
           SPFVSSP++
Sbjct: 104 SPFVSSPDL 112

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1004 (41%), Positives = 545/1004 (54%), Gaps = 183/1004 (18%)

Query: 191  LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNEKS 250
            L Q PF I+YKILP GDD YRTRSLL+ N+D   DLH+ V  FV++N++ES YI      
Sbjct: 155  LFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITK---- 210

Query: 251  DDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCL-----NY 305
               + +Q      L+SFL+   CLNFYNN+LQRL EFK  LK+ SL L FV +       
Sbjct: 211  ---EGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKV 267

Query: 306  DFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENK-DATRSIIVEFKSP---LK 361
            + K    F  DD                M  A+LH D+  +  ATRSI +EF      L 
Sbjct: 268  EGKIYRRFAADDG-------------DGM--ANLHFDMAAQTGATRSIAIEFVDKDVILT 312

Query: 362  STELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLK 421
              EL NKKL+FL   NN RYILE I +  T   +  F +NYA++TFL+I MA+E++DYLK
Sbjct: 313  RDELLNKKLKFLSEGNN-RYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLK 371

Query: 422  KYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVEXXXXXXXXXXX 481
               K+L ++K FYV +      S  +S    +   T ++R + P                
Sbjct: 372  LNIKQLHLTKFFYVQVTHPPQQSPAASQKKPHANDTESNRDTSPP--------------- 416

Query: 482  XXXXXDANTHNSNNSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKLQGIQLDGTDLEI 541
                 D     +N+                        +++D L  KL+ I+L  + L++
Sbjct: 417  -NSKKDQEFFPNNSMLSLV----------SSESSTSLADDVDGLVNKLKSIELQESTLKL 465

Query: 542  NYHDYQTPTVHEHSTHLSNVKISKTVENSR----------------QFPHDIPSP----L 581
               DY  P   + S H + +  S  V  +R                 FP+DI SP    L
Sbjct: 466  RVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGPQSSISTPRAFGAFPNDIGSPPASFL 525

Query: 582  PLNERMFMNDSNHSNG--SIVPQQLMATPS-PVSSTIQM----NQRV--------LPNPI 626
            PL       D NHSN   ++ P  + ATPS P+S   Q     +QR           +PI
Sbjct: 526  PL-------DLNHSNSVPNLPPGFIPATPSGPMSPQQQQLFLNSQRQQRDHAGGKFAHPI 578

Query: 627  TQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKR 686
            T SLE     S +VA++MGSD  NRTIYIGNINPRSRAEDICNVVRGGILQ+IK++  K 
Sbjct: 579  TDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAKH 638

Query: 687  ICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYV 746
            ICF+TFIEA +AVQFYAN+FIDPIVLHGN L++GWG Y+GPLPK I+LAVTIGASRNVY+
Sbjct: 639  ICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVYI 698

Query: 747  SLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMN 806
            SLPE AFK+K+I DP++K  HE+  LP  E LR+DF  YG IEQIN L+DSHCCW+NFMN
Sbjct: 699  SLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFMN 758

Query: 807  ISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAG 866
            ISSAI LVE+ + +    N+             F  RYEGL+INYGKDRCGNIN+NLVAG
Sbjct: 759  ISSAIRLVEDASTKQDHFNQ------------LFDHRYEGLVINYGKDRCGNINRNLVAG 806

Query: 867  KNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKERA---------FDK------------ 905
            K S+++KKVK+ + ++RLS+LEE+RR  + +++E           FD             
Sbjct: 807  KTSKYHKKVKKHTRDVRLSQLEEKRRNQDAERREMVNGTIPEENPFDAFAINTGSAEKKD 866

Query: 906  ALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLGLGVASSEV 965
             L+L+SLGIS        I E+E+ + I   + +  +  N S    GI  L     S   
Sbjct: 867  ELSLDSLGIS--------IMEVESASPISPVMGDLEDHTNGSYTDAGIAPLNYTNNSG-- 916

Query: 966  NRAASDETDYEDLFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPV 1025
              ++SD                    IE+I++ P+DP  ++       S+ +  + KR +
Sbjct: 917  --SSSD--------------------IELIINPPNDPNRSVGVLEGDPSTLSPPSDKRKL 954

Query: 1026 KAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYN---RSKKNETPIRDIVPN-GETTSNR 1081
             A  E  +               PP AP T+S      S  NE    +  P+ G   +  
Sbjct: 955  VALHEVSSP-------------PPPLAPDTISRQYAEASYHNELVTGNDHPDTGYGKAEN 1001

Query: 1082 KKNRGSFPRH-RTIPGSDVMAQYLAQVQHSTFMYAANILGASAE 1124
             ++R   PR+ RTIPGSDVMAQYLAQ+QHSTFMYAAN+LGAS E
Sbjct: 1002 GRHRQQLPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNE 1045

 Score = 68.9 bits (167), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/46 (71%), Positives = 38/46 (82%), Gaps = 1/46 (2%)

Query: 57  NSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNM-QGGYSPAR 101
           NSP+ N  PTPFDTAYGA+LLPSHLLMGSPFVS+PN+ Q  Y+  R
Sbjct: 83  NSPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQR 128

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/947 (38%), Positives = 516/947 (54%), Gaps = 148/947 (15%)

Query: 196  FRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNEKSDDLKD 255
            ++I+Y+ILP GDD Y TRSLL EN++ S DLH+ ++ FV    +ES Y++ + ++     
Sbjct: 210  YKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYET----- 264

Query: 256  EQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCLSTFIE 315
             Q S  SIL+SF +RS CL+FYN++LQ+LSE+KT L SE+L L FV L Y    L   I 
Sbjct: 265  HQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCY----LQNNIN 320

Query: 316  DDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPL-KSTELFNKKLQFLD 374
                  +VE      D  + S  + + + N  ATRS+ +EF   + K  +     L FL 
Sbjct: 321  KGNGKISVESQKNETDFELTSL-IQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLS 379

Query: 375  RSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLKKYSKKLGISKCFY 434
             + NKRYI+ES+ IVN +   N+FP +Y +L+FLNI M IEVL Y++  +    I  C Y
Sbjct: 380  SNANKRYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLY 439

Query: 435  VSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVEXXXXXXXXXXXXXXXXDANTHNSN 494
            VS        T+ +V+N       ++R S+                         +   N
Sbjct: 440  VSF-----DRTKHAVSN-------SNRQSL--------------------SKKGTSDTLN 467

Query: 495  NSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKLQGIQLDGTDLEINYHDYQTPTVHEH 554
              T  S                    EI+I   KL  +++      ++  +Y  P +   
Sbjct: 468  TYTLESPINHNTEVDMNDIPSIYDENEIEI-ANKLSELEIQTHTFNLDISNYSNPHIEIR 526

Query: 555  STHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSNHSNGSIVPQQLMATPSPVSST 614
            + HL NV IS+              P+     ++ N    S  S   + +  T   +SS 
Sbjct: 527  AEHLPNVSISR-------------DPM-----IYANPIYQSPPSGYMENMWTTTPFLSSH 568

Query: 615  I----QMNQRVLPN-----------PITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNIN 659
            I      N RV  N           P+ Q+L+  F  SA++AS MG  VGNRTI+IGNIN
Sbjct: 569  IVHEEYANDRVDYNMKHYNNQLYNVPLPQTLQSQFATSAEMASKMGGGVGNRTIFIGNIN 628

Query: 660  PRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRV 719
            PRS+ EDICNV RGGI+Q +KY+ EK ICFV FI+  +A QFYANSFIDPI+LH N L++
Sbjct: 629  PRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAAQFYANSFIDPIILHNNTLKI 688

Query: 720  GWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLR 779
            GWG + GPLPK+I LAVT GASRNVYVSLPEFAFK+K+I+DP YK+ H    LP  +QLR
Sbjct: 689  GWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLR 748

Query: 780  EDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKK 839
            EDFS +G++EQIN+L D HCCWINF NI SAI LVE         NED    H+     +
Sbjct: 749  EDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVE------LVKNEDNNNFHE-----R 797

Query: 840  FGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKK 899
            +  RY+GL+I YGKDRCGN+NK+LV+ KNSR+++KVK+PSYNIRL +LEE R++N  D+ 
Sbjct: 798  YKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKPSYNIRLQQLEEERKRN--DEI 855

Query: 900  ERAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLGLG 959
            ++  +K +NL+SLGI+   +++I                       + +ET+ +  L L 
Sbjct: 856  KQIDNKRINLDSLGITTSPNQNI-----------------------QEDETLSLAKLKL- 891

Query: 960  VASSEVNRAASDETDYEDLFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVI 1019
              S    + + +E+D +D              +E+I++SP +     KS   R      +
Sbjct: 892  -TSDTGFKNSENESDIDD------SASNSSTDVELIINSPGN---GFKSHRNRKPKPNNL 941

Query: 1020 N-SKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGETT 1078
            +  +RP     + DA+           +   P AP+ LS++  + + T + +  P  E T
Sbjct: 942  DLGERP-----KVDAI---------VFKADGPMAPNKLSHDYHRTHNTRVDN--PRSERT 985

Query: 1079 SNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAED 1125
              R          + IPGSDVM+QYLAQVQHSTFMYAAN+L AS E+
Sbjct: 986  RKRT-------HKKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEE 1025

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 3/44 (6%)

Query: 68  FDTAYGASLLPSHLLMGSPFVSSPN---MQGGYSPARSSNFKRK 108
           FD AYG +LLPSH+LM SPFVS+PN   +    SP+R  ++ R+
Sbjct: 112 FDYAYGTTLLPSHILMNSPFVSTPNKSYLSFQASPSRGISYNRR 155

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  556 bits (1433), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 380/1001 (37%), Positives = 523/1001 (52%), Gaps = 185/1001 (18%)

Query: 195  PFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYII--------- 245
            P+ IN+KILP GDD Y TRSLL+ NV+ S  LH  +  FVK   +ES Y++         
Sbjct: 182  PYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPEEEEEEEE 241

Query: 246  -----GNEKSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKF 300
                   E+ ++ +  +    SIL+SFLT++ CL+FYNN+LQ+LS+FK  L S+SL L F
Sbjct: 242  EEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNF 301

Query: 301  VCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPL 360
            V L       S  I DD L                          K ATRSI +EFK+  
Sbjct: 302  VSLT------SEDIRDDVL-------------------------RKGATRSIALEFKNSF 330

Query: 361  KSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYL 420
             + +L  + ++ L  ++N R+++E IDIVNT+ P+  F  +YA++ F++I MA+E   YL
Sbjct: 331  TTKQL--ESIEILSNASNSRFVVEKIDIVNTESPNKNFNTHYAIIHFISISMAVEASSYL 388

Query: 421  KKYSKKLGISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVEXXXXXXXXXX 480
              + +KLGIS+ F       V  S          I  S +  S P+              
Sbjct: 389  LNWDEKLGISRLF------FVTDSI---------INKSDYFRSAPA-------------- 419

Query: 481  XXXXXXDANTHNSNNSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKLQGIQLDGTDLE 540
                        S +++R+S+                  + ++  T KLQG+ L    L 
Sbjct: 420  ------------SQDASRSSV---------------SIDQTLEFATKKLQGLVLKERTLS 452

Query: 541  INYHDYQTPTVHEHSTHLSNVKISK--------TVENSRQFPHDIPSPLPLNERMFMND- 591
            I    Y    + EH  HL+++ ISK        +   S Q   ++ S  P+ + M+++D 
Sbjct: 453  IKPKTYPQAEIEEHQHHLTSISISKPLLSSNNNSSSVSLQGNQNLTSS-PVTQEMYLHDT 511

Query: 592  SNHSNGSIVPQQLMAT------PSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVASSMG 645
            SN +   ++ Q  MA+      P P    + + +     PI Q+L+Q    +A+VAS+MG
Sbjct: 512  SNSTREDVMIQSSMASGTSNFVPPPPHYYMDVTK-----PIRQTLQQQLTTTAQVASNMG 566

Query: 646  SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANS 705
              +GNRT+Y+GNINPRS+ EDICNVVRGGILQ IK+   K +CFVTFIEA +AVQF+AN+
Sbjct: 567  GGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTFIEAAAAVQFFANA 626

Query: 706  FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 765
             I+PIVLHGN+L+VGWGH+ G L +SI+LAVTIGASRNVYVSLPE+AFK+KFI DP++++
Sbjct: 627  SIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKFIKDPEFQE 686

Query: 766  LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHN 825
              E   LP  EQLR+DFS +G+IEQINYL D HCCW+NFMNI+SAI LVE+ N       
Sbjct: 687  FREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDAN------- 739

Query: 826  EDGEMTHKTATEKKFGG----RYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYN 881
                     A  KKF G    RY+GL+I YGKDRCGN+NKNLVA K SRF+KKVK+ SY 
Sbjct: 740  --------GADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANKKSRFFKKVKKASYK 791

Query: 882  IRLSKLEERRRQNENDKKERAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEA 941
            IR+ K  +    N  +      D A      GI + S + I   E+E    + + IE E 
Sbjct: 792  IRMHKQNKAGGSNGQEPISSFQDNA-----FGICI-SPRGIESEEVEALPDVPQNIEEEK 845

Query: 942  EAVNRSNETVGIG---GLGLGVA-SSEVNRAASDETD------YEDLFNKXXXXXXXXXX 991
               N     +  G   G GLG+  S  +N+   +  D       E+ F+           
Sbjct: 846  NPQNNGLLKLANGNGIGEGLGIEFSPGLNKEGHEGDDKFDCIQQENGFDGKDEDESYSSD 905

Query: 992  IEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKAEDEE---------------DAVEI 1036
               I    S PE +   +     S T   +  P     +E               D   +
Sbjct: 906  SSDIDIIVSAPEQSSAEEDDDKRSVTSYTNGHPTNKFKKEKSRTKLKRRPTSGLTDLYSL 965

Query: 1037 SQFN---HKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGETTSNRKKNRGS-----F 1088
            + F      +SL   PP APST+S + S  +         NG   +++K++ G       
Sbjct: 966  NGFPSMVSSTSLDAVPPLAPSTVSRHYSVASSHSNNSYHNNGRHDASKKRHGGGKGNTHH 1025

Query: 1089 PRHR---TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1126
             RHR    IPGS VMAQYLAQ+QHSTFMYAANILG +  DN
Sbjct: 1026 GRHRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDN 1066

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (61%), Gaps = 6/91 (6%)

Query: 6  QRKPVANYAYRQQQDYNGMNAMVGNPIIYHPVDFINGAGQYG-----PSQHPAYYSNSPL 60
          Q K  +++ Y      NG+       + YHP+  +NG  Q       PSQ   YY+ SP+
Sbjct: 5  QNKNYSSHQYATMAPPNGIQPHYPQTMAYHPMGPMNGGVQPTMQMSLPSQQ-GYYAGSPM 63

Query: 61 PNIPPTPFDTAYGASLLPSHLLMGSPFVSSP 91
          P+ P TPFDT+YGA+LLPSHLLMGSPF+S+P
Sbjct: 64 PSAPQTPFDTSYGATLLPSHLLMGSPFISTP 94

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  549 bits (1415), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 379/961 (39%), Positives = 531/961 (55%), Gaps = 149/961 (15%)

Query: 193  QRPFRINYKILP----TGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNE 248
            QR + + + ILP     G D Y TRSLL  N++  T LH  +  F K + +ES Y++ ++
Sbjct: 133  QRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQ 192

Query: 249  KSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFK 308
            +            S+L+SFLT+  CL+FYN +LQ+LSEFK  LKS+ L L F  L  D K
Sbjct: 193  QQ-----------SVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASLR-DVK 240

Query: 309  CLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPLKSTELFNK 368
               T          +++I I             ++    ATRS+I+EF+  +    L +K
Sbjct: 241  TGPT----------LQEIKI-------------EVLRAGATRSLILEFQDKV-DLALLSK 276

Query: 369  KLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLKKYSKKL- 427
             L F+  +   RY++E+I+IVN    S  F  +YA++ F++I MA+E ++YLK  S KL 
Sbjct: 277  SLGFI-VNEGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKLA 335

Query: 428  GISKCFYVSLAPLVISSTRSSVANIYEIKTSTHRLSVPSVPVEXXXXXXXXXXXXXXXXD 487
            G+ K  YV+       +T +S  + ++  +S+                            
Sbjct: 336  GLIKFRYVN-------TTSASGKSEFQTLSSSQ--------------------------- 361

Query: 488  ANTHNSNNSTRASLYGXXXXXXXXXXXXXXXXEEIDILTTKLQGIQLDGTDLEINYHDYQ 547
             N    +N++ + + G                E +  L +KLQ   L    L ++   Y 
Sbjct: 362  LNERALSNTSDSDISGG---------------ESVASLGSKLQQTSLGEQTLVVDPTQYG 406

Query: 548  TPTVHEHSTHLSNVKISKTVENSRQFPHDIPS--PLPLNERMFMND--SNHSNGSIVPQQ 603
             P V E S HL +V ISK + NS+   +D+ S    P  + + +ND   + S GS+V  +
Sbjct: 407  RPLVEERSEHLPHVTISKAL-NSKSSLNDLTSNTTSPQPQEVLVNDHEDSSSRGSMVSLK 465

Query: 604  LMATPSPVSSTIQ-----MNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNI 658
               +  P    I      MN   +  P+ Q+L+Q +  +A+VA++MG  +GNRT+YIGNI
Sbjct: 466  QANSHGPAYPPIPGYPFYMN---MSKPLGQTLQQQYTTTAQVATAMGGGLGNRTVYIGNI 522

Query: 659  NPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLR 718
            +PRS+ EDICNVVRGGILQS+KY+  K ICFVTFIEA SAVQF+ANS I+PIVLHGN+L+
Sbjct: 523  SPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLK 582

Query: 719  VGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQL 778
            VGWGH+SG LP+SISLAVTIGASRNVYVSLPE AFK+KFI DP+Y++  E   LP  EQL
Sbjct: 583  VGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQL 642

Query: 779  REDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEK 838
             EDFS +GDIE +N+L D HCCWINFMNIS+AI LVE+ N      N + +  H     +
Sbjct: 643  YEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDAN------NPNNDSFH-----E 691

Query: 839  KFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDK 898
            KFG RY+GL I YGKDRCGN+NKNLVA KNS+++KKVK+ SYNIRL K ++       + 
Sbjct: 692  KFGNRYKGLFIGYGKDRCGNVNKNLVANKNSKYFKKVKKASYNIRLRKQQKGASDAPTEV 751

Query: 899  KERA--FDKALNLESLGISLDSHKDIGIGEIEN--KNCIGREIENEAEAVNRSNETVGIG 954
            K+ A   DK +  ++ GIS        +G+ +N  ++    +   E E +  S+     G
Sbjct: 752  KDEAKELDKPIKADAFGIS--------VGDTQNLVRDSDEEQKLEEDELLRLSDLNNTGG 803

Query: 955  GLGLGVASSEVNRAASDETDYEDLFNKXXXXXXXXXXIEVIMHSPSDPEYA-LKSQTL-R 1012
            GLG+ +ASS         T   D  +K          +++++ +P   + + L+S+T  R
Sbjct: 804  GLGISLASST---GEETNTPVSDESSKEESVSSESSDVDILVSAPGSADTSQLESKTAPR 860

Query: 1013 SSSQTVINSKRPVKAEDEEDAV-EISQFNHKSSLRHAPPRAPSTLS--YNRSKKNETPIR 1069
            S  Q  + +  P K       +  +S     +SL   PP APSTLS  Y  + K+ +   
Sbjct: 861  SPKQPRVLANVPEKPSAFSAIIPRVSS----ASLDAVPPLAPSTLSRQYTATSKHNSRRG 916

Query: 1070 DIVPNGETTSNRKKNRGS-------FPRHR---TIPGSDVMAQYLAQVQHSTFMYAANIL 1119
                  E +S R  +  S        PR R    IPGSDVMAQYLAQ+QHSTFMYAANIL
Sbjct: 917  SRFGTTEKSSPRYNDIRSQDSKKPLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANIL 976

Query: 1120 G 1120
            G
Sbjct: 977  G 977

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 39/56 (69%), Gaps = 1/56 (1%)

Query: 47  GPSQHPAYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARS 102
           G  ++  YY  + +P  P TPFDT+YG SLLPSHLLM SPF+++P M G  SP R+
Sbjct: 32  GSREYSGYYHGNRVPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGM-GSASPHRA 86

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  454 bits (1167), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 259/531 (48%), Positives = 334/531 (62%), Gaps = 62/531 (11%)

Query: 625  PITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPE 684
            PI ++LE  FN SA+VASSMG ++GNRTIYIGN+NPRS+AED+CNVVRGGILQSIK +  
Sbjct: 702  PIVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIAS 761

Query: 685  KRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNV 744
            KRICFVTFIEA +AVQFYANSFIDP++LHGN L++GWG+Y  PL KSI+LAVTIGASRNV
Sbjct: 762  KRICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNV 821

Query: 745  YVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINF 804
            YVSLPEFAFK+KF++DP+YK+ HE   LP  +QLR DF+ YG IEQINYLSDSHCCW+NF
Sbjct: 822  YVSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNF 881

Query: 805  MNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLV 864
            MNI+SAI LVE++N       +D   +      KKF  RY+GL+INYGKDRCGN+N+NL+
Sbjct: 882  MNITSAIKLVEDVNNNP----KDNTFS------KKFNHRYDGLIINYGKDRCGNVNRNLI 931

Query: 865  AGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKERAFDKALNLESLGISLDSHKDIGI 924
            + KNSR Y+KVK+ S N +L +L+E+RR  +   KE   +  +N   L  SLD+   +GI
Sbjct: 932  SNKNSRHYRKVKKFSDNYKLRQLQEKRRVEQEKGKE--LNGGVNDNKLP-SLDA---LGI 985

Query: 925  GEIENKNCIGREIENEAEAVNRSNE-------------TVGIGGLGLGVASS------EV 965
            G       + R    E + V  SNE             T     LG  + S+      E 
Sbjct: 986  G-------LQRTAPPEEQKVPESNEDDANYDSAVTESDTNTFNALGFRIQSNTDSHDDEQ 1038

Query: 966  NRAASDETDYEDLF-NKXXXXXXXXXXIEVIM---HSPSDPEYAL-KSQTLRSSSQTVIN 1020
            N    +E +  D+  +           +E+I+   H+ SD      K +T+R + Q +  
Sbjct: 1039 NDEKGEEQEEVDVIAHADDISSVNSSDVEIIIDCPHNESDTSMIQEKKKTIRKNQQKIDR 1098

Query: 1021 SKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIVPNGETTSN 1080
              +   A   E    I   N+K  L H           NR K+ +  I+D  P+  +T  
Sbjct: 1099 LAKARNAMFPEHRETIPDINNK--LFHDRKNKDK----NRRKQVQGGIQDQDPHLSSTGK 1152

Query: 1081 RKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHTEE 1131
            ++         R IPG+DVMAQYL Q+QHSTFMYAANILG SAEDNT+ +E
Sbjct: 1153 QQ---------RVIPGADVMAQYLTQLQHSTFMYAANILGVSAEDNTYYDE 1194

 Score =  197 bits (500), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 128/300 (42%), Positives = 169/300 (56%), Gaps = 56/300 (18%)

Query: 191 LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNEKS 250
           L Q+PF I+YK+LPTGDDAYRTRSLL  NV  S DLHS + +FV+ +++ES Y+I N  +
Sbjct: 180 LFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLISN--T 237

Query: 251 DDLKDEQTSN----LSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYD 306
           DD KD+   N     SIL+SFL+R  CL+FYNN+LQRL+EFKT L+S+SL L FV LNY 
Sbjct: 238 DDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVILNYL 297

Query: 307 FKC---LSTFIEDDALTE--------NVEQIDITNDSSMISASLHHDLENKDATRSIIVE 355
            K     +  I ++ L +        N  + D  N  + ++A L  DL N DATR I++E
Sbjct: 298 EKTDDGSTANISNNQLNQIQENENDVNTNEFDYRNSMNTVNA-LKFDLINPDATRFIMIE 356

Query: 356 FKSPLKSTELFNKKLQFL-DRSNNKRYILESIDIVNT--------------------DVP 394
            K+      L NK L FL D   N RYILESID+ N                     + P
Sbjct: 357 LKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNENENSP 416

Query: 395 SNQ-----------------FPENYAVLTFLNIFMAIEVLDYLKKYSKKLGISKCFYVSL 437
             +                 FP +YAVL+F+NI+MA+E+ DYLK    K GI+   YV +
Sbjct: 417 QGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYVQI 476

 Score = 85.9 bits (211), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 52/72 (72%), Gaps = 2/72 (2%)

Query: 21  YNGMNAMVGNPIIYHPVDFINGAGQYGPSQHPAYYSNSPLPNIPPTPFDTAYGASLLPSH 80
           Y  +N  V NP + +  D  NG+ QY  +   AYY  SPLPN PPTPFDTAYGA+LLPSH
Sbjct: 42  YISLNHSVHNPNMVYQHD-PNGS-QYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSH 99

Query: 81  LLMGSPFVSSPN 92
           LLMGSP+VS+PN
Sbjct: 100 LLMGSPYVSTPN 111

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  446 bits (1146), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 265/604 (43%), Positives = 356/604 (58%), Gaps = 57/604 (9%)

Query: 546  YQTPTVHEHSTHLSNVKISKTVEN--SRQFPHD-IPSPLPLNERMFMNDSNHSNGSIVPQ 602
            Y  P V EH+ H S++ ISK + +  SR      I SP P    +  +++  S  SIV  
Sbjct: 329  YGPPVVEEHNQHCSHITISKALSSKVSRNGSSSSIASPQPQEVLVSNSEAPSSRNSIVSL 388

Query: 603  QLMATPSPVSSTIQMNQRV-LPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPR 661
                +  P       +  + +  P+ Q+L+Q +  +A+VA++MG   GNRT+YIGNI+PR
Sbjct: 389  LSARSQGPTYPVPGYHYYMDMSKPLGQTLQQQYTATAQVATAMGGGAGNRTVYIGNISPR 448

Query: 662  SRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 721
            S+ EDICNVVRGGILQS+KY+  K ICFVTFIEA SAVQF+ANS I+PIVLHG++L+VGW
Sbjct: 449  SKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGW 508

Query: 722  GHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLRED 781
            GH+SG LP+SISLAVTIGASRNVYVSLPE+AFK+KFI DP+Y+   E   LP  +QL +D
Sbjct: 509  GHHSGNLPQSISLAVTIGASRNVYVSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDD 568

Query: 782  FSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFG 841
            FST+GDIE IN+L D HCCWINFMNIS+AI LVE+ N      N + E  H     +KF 
Sbjct: 569  FSTFGDIELINFLEDGHCCWINFMNISNAIKLVEDAN------NSNNESFH-----EKFE 617

Query: 842  GRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEER--RRQNENDKK 899
             RY GL I YGKDRCGN+NKNLV+ KNS+++KKVK+ SYNIRL + ++     Q ++ K 
Sbjct: 618  NRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKASYNIRLRRQQKSDIEAQAKSGKG 677

Query: 900  ERAFDKALNLESLGISLDSHKDIGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLGLG 959
            +   +K L +++ GIS+ S  D    + E K      IE E E +  S      GGLG+ 
Sbjct: 678  DENSEKKLQVDAFGISVGSQPDARYSDEEQK------IE-ENELLLLSKPNSAEGGLGIS 730

Query: 960  VAS----SEVNRAASDETDYEDLFNKXXXXXXXXXXIEVIMHSPSDP---EYALKSQTLR 1012
            V+     +E N A   +       NK          +++++ +P      +      T R
Sbjct: 731  VSQDVTVTENNTACGGK-------NKTGSVSSGSSEVDILVSAPGSANTSQLEGGGPTQR 783

Query: 1013 SSSQTVINSKRPVKAEDEEDAVEISQFNHKSSLRHAPPRAPSTLSYNRSKKNETPIRDIV 1072
            +++ +    +R           EI+    K+SL   PP AP+ L+ +    N  P R   
Sbjct: 784  TTAASNGKKERSSGVSKLHCFSEIAPRVSKASLDAVPPLAPAALNCHY---NSAPRRSAR 840

Query: 1073 PNG-------------ETTSNRKKNRGSFPRHR---TIPGSDVMAQYLAQVQHSTFMYAA 1116
             NG             +  S   + + S  R R    IPGS+VMAQYLAQ+QHSTFMYAA
Sbjct: 841  KNGHDHDSNPVSGSKSDIGSKSTQGKSSKSRQRNAQAIPGSNVMAQYLAQLQHSTFMYAA 900

Query: 1117 NILG 1120
            +ILG
Sbjct: 901  DILG 904

 Score =  139 bits (350), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 132/248 (53%), Gaps = 42/248 (16%)

Query: 193 QRPFRINYKILP---TGD-DAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNE 248
           Q P+++ + ILP    GD D +RTRSL   N++    LH  +  F K + +ES Y++  E
Sbjct: 60  QIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDRE 119

Query: 249 KSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFK 308
           +            S+L+SFLT+  CL+FYN ILQ+LSEFK  L+S+ L+L F        
Sbjct: 120 QQ-----------SVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSF-------- 160

Query: 309 CLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPLKSTELFNK 368
                    A  + VE       S      +  ++    ATRS+ +EFK  +    L  K
Sbjct: 161 ---------ASPQKVE-------SGPTLQEIKFEVLRAGATRSLGLEFKDEIDFASLL-K 203

Query: 369 KLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLK-KYSKKL 427
           K  F D S   RY++ESI+ VNTD PS  F  NYA++ F++I MA+E ++YLK +  +  
Sbjct: 204 KFDFFDNSG-PRYVIESIETVNTDKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTPESF 262

Query: 428 GISKCFYV 435
           G++K  YV
Sbjct: 263 GLTKVSYV 270

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score =  443 bits (1140), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 244/515 (47%), Positives = 326/515 (63%), Gaps = 67/515 (13%)

Query: 626  ITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEK 685
            + ++ +  F  SA++A++MG   GNRT+YIGNINPRS+AEDICNVVRGG LQ IK+  EK
Sbjct: 556  LLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEK 615

Query: 686  RICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVY 745
             ICFVTFIEA SA QFYANSFIDPI+LH N LRVGWG +SGPLPKSISLAVT+GASRNVY
Sbjct: 616  GICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVY 675

Query: 746  VSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFM 805
            VSLPE+AFK+KFI+DP+YK+ H    LP  E+LR+DFS +G++EQ+N+L+D HCCWINFM
Sbjct: 676  VSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFM 735

Query: 806  NISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVA 865
            NI SAI LVE +N  +      G+  H     +++  RY+GL+I YGKDRCGN+NK+L++
Sbjct: 736  NIRSAIKLVESVNSSN-----GGKTFH-----ERYANRYKGLIIGYGKDRCGNVNKSLIS 785

Query: 866  GKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKERAFDKALNLESLGISLDSHKDIGIG 925
            GKNS+FY+KVK+PSYNIRL +LEE R+Q E   K +  +K++NL S GI +++       
Sbjct: 786  GKNSKFYRKVKKPSYNIRLQQLEEERKQEE---KNKISNKSINLNSFGIQVETPS----- 837

Query: 926  EIENKNCIGREIENEAEAVNRSNETVGIGGLGLGVASSEVNRAASDETDYEDLFNKXXXX 985
                        +NE+E      E   I   GLG++ S+ N      ++  DL       
Sbjct: 838  ------------QNESEQ-----EEPKISLDGLGMSLSKPN------SENHDLKETDDSD 874

Query: 986  XXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKAEDEEDAVEISQFN--HKS 1043
                  IE+I+  P           +R +++   N K+  +  D  + +         K+
Sbjct: 875  SDISTDIELIIDPP-----------VRENTKGNKNKKQNHRKNDMNNNLNFGNPPPVSKT 923

Query: 1044 SLRHAPPRAPSTLSYNRSKKNETPIRDIV-----------PNGETTS--NRKKNRGSFPR 1090
             L  +PP AP+TLS +  K ++    D+             N   TS  N    R S   
Sbjct: 924  LLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSENDSNTSSKNASHKRSSKKN 983

Query: 1091 HRTIPGSDVMAQYLAQVQHSTFMYAANILGASAED 1125
             + +PGSDVM+QYLAQ+QHSTFMYAANILGAS+++
Sbjct: 984  KKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDE 1018

 Score =  183 bits (465), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 117/280 (41%), Positives = 154/280 (55%), Gaps = 36/280 (12%)

Query: 196 FRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNE------- 248
           F I+YK+LP G+D Y+TRSLL ENVD+S DLH  +K FV    +ES Y+I +        
Sbjct: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNK 310

Query: 249 ------------KSDDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESL 296
                         +D         SIL+SFL+R  CL+FYN++LQRLSEFKT L S  L
Sbjct: 311 NNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370

Query: 297 NLKFVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEF 356
            L FV L Y  +       DD      E+ D    S  +  SL +D+  + ATRSI VEF
Sbjct: 371 TLSFVLLKYKNQDRP----DD------EESDF---SPALPLSLEYDIIKRGATRSIAVEF 417

Query: 357 KSPLKSTELF-NKKLQFLDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIE 415
             P+ S E F N KL FL    NKRYI+ES+DI+N        P+N  +LTFLNI M ++
Sbjct: 418 NQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPKNTVILTFLNISMTVD 477

Query: 416 VLDYLKKYSKKLGISKCFYVSL---APLVISSTRSSVANI 452
           V+D ++   K  GISKC +V+     P V +  R S+ +I
Sbjct: 478 VMDRIRLERKDSGISKCVFVTFNKENPTVPNMKRLSLVDI 517

 Score = 79.0 bits (193), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 34/46 (73%), Positives = 38/46 (82%)

Query: 53  AYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYS 98
            YY+N  +PN PPTPFD+AYGASLLPSHLLMGSPFVS+P M   YS
Sbjct: 111 VYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYS 156

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  436 bits (1121), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 243/480 (50%), Positives = 299/480 (62%), Gaps = 89/480 (18%)

Query: 520 EEIDILTTKLQGIQLDGTDLEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPS 579
           EE+  +  KL+GI+L    L+I   DY  P  +  + HL NV IS   +  +     IP 
Sbjct: 460 EEVISIADKLKGIKLKDISLDILPRDYPEPEFNFSTDHLPNVTISVPTQLDQ-----IPG 514

Query: 580 PLPLNERMFMNDSNHS----------------NGSIVPQQLMATPSPVSSTIQMNQRV-- 621
             P  + +++ND + S                NG+ +    M  PS    +  M+Q    
Sbjct: 515 -TPRTQEIYINDMSPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPS---QSFYMDQNTQI 570

Query: 622 ---------LPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVR 672
                      +PIT SLE   + SAKVAS+MGSD GNRTIYIGNINPRS+AEDICNVVR
Sbjct: 571 QEAPFRSNSFIHPITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVR 630

Query: 673 GGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSI 732
           GGILQSIK++  K ICFVTFIEA +AVQFYAN+FIDPIVLHGN L++GWG+YSGPLPKSI
Sbjct: 631 GGILQSIKFIESKHICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSI 690

Query: 733 SLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQIN 792
           +LAVTIGASRNVYVSLPEFAFK+K+I+DP++K+ HE   LPD EQLR DFS+YG  EQIN
Sbjct: 691 ALAVTIGASRNVYVSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQIN 750

Query: 793 YLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYG 852
           YLSDSHCCW+NFMNISSAI LVEE   +    NE            KF  RY GL+INYG
Sbjct: 751 YLSDSHCCWVNFMNISSAIKLVEEATNDFDRFNE------------KFDERYNGLVINYG 798

Query: 853 KDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKERAFD-------- 904
           KDRCGNINKNL+AGKNSRFYK   R ++N +LSKLEE+RR  ++D++E  F         
Sbjct: 799 KDRCGNINKNLIAGKNSRFYK--IRQNHNFKLSKLEEKRR--DHDRRENGFKHVYNDEET 854

Query: 905 ---------------------KALNLESLGISLDSHKDIG--------IGEIENKNCIGR 935
                                K L L+SLGISL+S  +I         + + EN+  I +
Sbjct: 855 IYNESMETDNQHNEESKENDGKFLQLDSLGISLESKNEIADDINDALTVDQFENEKSITK 914

 Score = 81.3 bits (199), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 34/41 (82%), Positives = 37/41 (90%)

Query: 53  AYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNM 93
            YY  SPLPN PPTPFDTAYGA+LLPSHLLMGSPF+SSPN+
Sbjct: 63  TYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  403 bits (1036), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 191/304 (62%), Positives = 241/304 (79%), Gaps = 20/304 (6%)

Query: 624  NPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMP 683
            N +TQ+LE +FN S ++++ +G   GNRT+YIGNINPRS+ ED+CNVVRGGILQ I ++ 
Sbjct: 799  NNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLR 858

Query: 684  EKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 743
            +K ICFVTFIEA +A QF+AN++IDPIVLHGN+L+VGWG++SGPLPKSISLAVTIGA+RN
Sbjct: 859  DKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRN 918

Query: 744  VYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 803
            VYVSLPEFAFK+KFI++P Y+K HE   LP+  QLR+DFS YG+IEQINYL+D HCCWIN
Sbjct: 919  VYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWIN 978

Query: 804  FMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNL 863
            FMNI+SAI+LVEE+N+      +DG   H      KF GRY GL+I YGKDRCGN+NKNL
Sbjct: 979  FMNINSAITLVEEVNE------DDGIRFH-----NKFDGRYNGLIIGYGKDRCGNVNKNL 1027

Query: 864  VAGKNSRFYKKVKRPSYNIRLSKLEERRR-QNENDKK--------ERAFDKALNLESLGI 914
            VA KNS+F+KKVK+P+Y I+L K+EE RR Q EN+ +         +    A+NLESLGI
Sbjct: 1028 VATKNSKFFKKVKKPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQIRKPAVNLESLGI 1087

Query: 915  SLDS 918
            + +S
Sbjct: 1088 TFES 1091

 Score =  156 bits (395), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 113/302 (37%), Positives = 160/302 (52%), Gaps = 63/302 (20%)

Query: 191 LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNEKS 250
           LL+ P  ++YKILP G D +RTRSLL+EN+++S D  ++VKNF+    +ES Y+I     
Sbjct: 256 LLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIK---- 311

Query: 251 DDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCL 310
             L      N SIL+SF++R  CL+FYNN+LQRL EFKT L S+SL L FV L Y+F   
Sbjct: 312 --LNPGSKYN-SILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVILKYEFTDY 368

Query: 311 STFIE-------DDALTEN----VEQI------------------DITNDSS------MI 335
           +  I        D++ + N    ++ I                  DI ND +        
Sbjct: 369 NHPINEHASDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIEDIRNDLNKENFPLTF 428

Query: 336 SASLHHDLENKDATRSIIVEFKSPLKSTELFNKK-LQFLDRSNNKRYILESIDIVNT--- 391
           +++L  DL  + ATRS++++F   +   +L N+K   F++ + N RYILESI +VN    
Sbjct: 429 ASALQSDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILESISLVNIENN 488

Query: 392 -----------------DVPSNQFPENYAVLTFLNIFMAIEVLDYLKKYSKKLGISKCFY 434
                            D P ++F  NY +LTF NI MAIE  DY K    +L I  CF+
Sbjct: 489 TKNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFF 548

Query: 435 VS 436
           VS
Sbjct: 549 VS 550

 Score = 76.3 bits (186), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/64 (60%), Positives = 48/64 (75%), Gaps = 4/64 (6%)

Query: 51  HPAYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQG-GYSPAR-SSNFKRK 108
           +P YYS  P+P+ PPTPFD +YGA+LLPSHLLMGSPFVS+PN+    YS    SS   RK
Sbjct: 94  NPTYYS--PIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISSTPTRK 151

Query: 109 AYSR 112
           ++SR
Sbjct: 152 SFSR 155

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 64/118 (54%), Gaps = 26/118 (22%)

Query: 1035 EISQFNHKSSLRHAPPRAPSTLS--YNRSK---KNETP----------IRDIVPNG---- 1075
            +I Q N    L   PP A STL+  Y ++K   KN+ P          I   +P+     
Sbjct: 1239 KILQSNQVPVLNQYPPMASSTLTRTYRKTKLKPKNDNPKFITSDTEDEILSQLPDEVLDE 1298

Query: 1076 ----ETTSNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHT 1129
                    N+ KNR +    +TIPGSDVM+QYL Q+QHSTFMYAANILG SAEDN  T
Sbjct: 1299 KNPFRGPRNKNKNRNT---RKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNIT 1353

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  385 bits (989), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 249/651 (38%), Positives = 353/651 (54%), Gaps = 111/651 (17%)

Query: 545  DYQTPTVHEHSTHLSNVKIS---KTVENSRQF------------PHDIPSPLPLNERMFM 589
            +Y TP + +HS HL+++ IS   KT+  S                H + S L  +  +FM
Sbjct: 413  EYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATNAGNHHGVSSSL--SGVLFM 470

Query: 590  NDSNHSNGS--IVPQ---------------QLM-ATPSPVS----------STIQMNQRV 621
            ND + S  +  IVP                QLM   P P+S          S       +
Sbjct: 471  NDPSSSGSTPMIVPSELNLNTPVMGGPMQGQLMPGPPQPMSLHNPSDGNGGSPSYFMDPM 530

Query: 622  LPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKY 681
            +  PI Q+L++ +   A    S  + + NRT+YIGNI+PRS+ EDICNVVRGGILQ+IK+
Sbjct: 531  VGAPIGQTLQRQYLAGA----SQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKW 586

Query: 682  MPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGAS 741
            +  KRICFVTFIE  +AVQFYAN+ ++PIVLHGN+LRVGWG  SG LPK+I+LAVTIGAS
Sbjct: 587  ISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGAS 646

Query: 742  RNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCW 801
            RNVYVSLPE++FKEK+I++P++K  H    LP  EQLR+DF+ YG +EQINYL D HCCW
Sbjct: 647  RNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCW 706

Query: 802  INFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
            +NFMNI+ AI LVE+ N     + E            +F GRY+ L+I YGKDRCGN+NK
Sbjct: 707  VNFMNIAHAIRLVEDSNSPIEKNLEK--------FHAQFDGRYKNLIIGYGKDRCGNVNK 758

Query: 862  NLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKERAFDKALNLESL-GISLDSHK 920
            NL A KNSRFYKK+K+ SY+++     + ++  + D    + D   N E L G+ ++S K
Sbjct: 759  NLAANKNSRFYKKIKKQSYSMK-----QGKQPRKEDGIVNSDDLTKNNEVLPGVQMNSSK 813

Query: 921  DIGIGEIENKNCIGREIENEAEAVNRSNETVGIGGLGLGVASSEVNRAASDETDYED--- 977
            + G+G  E+++ +G +   E              GLG+ + S++++        Y D   
Sbjct: 814  NGGVG--ESQSLVGDQELAE--------------GLGISLTSAQISPDTGHTHHYSDGVE 857

Query: 978  -----LFNKXXXXXXXXXXIEVIMHSPSDPEYALKSQTLRSSSQTVINSKRPVKAEDEED 1032
                   +           I++I+ +P D     +S T     +    S R  +  +   
Sbjct: 858  EGDECDDDDAGYSTSGSSDIDIIV-APPDEFKRRESGTSSGKHKKKSKSTRRNQHSNAAS 916

Query: 1033 AVEISQ------FNHKS---SLRHAPPRAPSTLSYNRS--KKNETPIRDI---------- 1071
            +   +Q       +H S   SL   PP APS++  + +  +   TP R            
Sbjct: 917  SASYNQQYSLGSLDHTSSAGSLDAPPPLAPSSMQQHLADRRPRHTPGRSTDSSASQYNSQ 976

Query: 1072 VPNGETTSNRKKNRGSFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGAS 1122
             P      +R++ +  F   + I G DVM+QYL Q+ HSTF+YA NILGA+
Sbjct: 977  TPTNANYKSRRRRQAKF--SKPIAGQDVMSQYLEQLHHSTFLYATNILGAT 1025

 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 91/247 (36%), Positives = 137/247 (55%), Gaps = 43/247 (17%)

Query: 195 PFRINYKILPTGDDAYRTRSLLIENVD--RSTDLHSIVKNFVKSNTLESTYIIGNEKSDD 252
           P+ IN+KILP G D Y TRSLL+ N++  R  D+H+ + +FVK   +ES Y++     DD
Sbjct: 143 PYHINFKILPKGKDEYMTRSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLM-----DD 197

Query: 253 LKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCLST 312
                  N SIL+SFLT++ CL+FYNN+LQR SEFKT L S  L++ FVC          
Sbjct: 198 -------NHSILLSFLTKATCLDFYNNLLQRFSEFKTKLHSPKLSVSFVC---------- 240

Query: 313 FIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPLKSTELFNKKLQF 372
                             D S     L  ++  + ATRS+ VEF+  +K       +L+F
Sbjct: 241 -----------------QDESSWFKYLQMNVVTRGATRSLTVEFEDSVKELNEDFVRLKF 283

Query: 373 LDRSNNKRYILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLKKYSKK--LGIS 430
                ++R++LE ID++N    +  F   Y +L F++I MA+EV D+L++ S+K  L IS
Sbjct: 284 PWLFCSQRFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQPSQKRQLNIS 343

Query: 431 KCFYVSL 437
           +  +V++
Sbjct: 344 RIQFVNV 350

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/32 (71%), Positives = 28/32 (87%)

Query: 60 LPNIPPTPFDTAYGASLLPSHLLMGSPFVSSP 91
          +P +P TPFD  YGASLLPSH+LMGSPF+S+P
Sbjct: 56 MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP 87

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  334 bits (856), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 168/320 (52%), Positives = 218/320 (68%), Gaps = 39/320 (12%)

Query: 625 PITQSLEQNF-NVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMP 683
           PI Q+L++ +   + +V  S      NRT+YIGNI+PRS+ EDICNVVRGGILQ+IK++ 
Sbjct: 547 PINQALQRQYLTGTGQVGGS-----NNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIH 601

Query: 684 EKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 743
            KRICFVTFIEA +A+QFYAN+ ++PIVLHGN+LRVGWG  SG LPK+I+LAVTIGASRN
Sbjct: 602 SKRICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRN 661

Query: 744 VYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 803
           VYVSLPE++FKEK+I++P++K+ H    LP  EQLR+DF+ YG +EQINYL D HCCW+N
Sbjct: 662 VYVSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVN 721

Query: 804 FMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNL 863
           FMNI+ AI LVE+ N  S  + E            +F GRY+ L+I YGKDRCGN+NKNL
Sbjct: 722 FMNIAHAIRLVEDCNSLSQRNLE--------KFHAQFDGRYKNLIIGYGKDRCGNVNKNL 773

Query: 864 VAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEN------------------DKKERAFDK 905
            A KNSRF+KK+K+ +   + +K ++ +R   +                    KE   D+
Sbjct: 774 TANKNSRFFKKIKKLNCTTKPNKRQQSKRGTSSASSDDARKDDASTEKVPVSSKEPVCDE 833

Query: 906 ALNL-------ESLGISLDS 918
            L L       E LGISL S
Sbjct: 834 ILGLNDDNALAEGLGISLSS 853

 Score =  143 bits (360), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 146/250 (58%), Gaps = 48/250 (19%)

Query: 195 PFRINYKILPTGDDAYRTRSLLIENVDRST--DLHSIVKNFVKSNTLESTYIIGNEKSDD 252
           P+++N+KILP G D Y TRSLL  N++R    D+H+ + NF+K   +ES Y++     DD
Sbjct: 158 PYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL-----DD 212

Query: 253 LKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCLST 312
                  + SIL+SFLT++ CL+FYNN+LQR SEFK+ L S  L++ FVC          
Sbjct: 213 -------SHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC---------- 255

Query: 313 FIEDDALTENVEQIDITNDSSMISASLHHDLENKDATRSIIVEF--KSPLKSTELFNKKL 370
             +D+     + Q+++                 +  TRS+ +EF  +S   +++L ++K+
Sbjct: 256 --QDETNWFRLLQMNVV---------------TRGVTRSLCIEFEDQSMELTSDLIHEKI 298

Query: 371 QFLDRSNNKRYILESIDIVNTDVPSNQ-FPENYAVLTFLNIFMAIEVLDYLKKYS--KKL 427
            +L  S+  R+++E ID+VN   P NQ F   Y ++ F+ I MA+EV +YL++ S  K+L
Sbjct: 299 PWLFFSH--RFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQL 356

Query: 428 GISKCFYVSL 437
           GISK  +V++
Sbjct: 357 GISKIQFVNV 366

 Score = 63.2 bits (152), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 1/46 (2%)

Query: 60  LPNIPPTPFDTAYGASLLPSHLLMGSPFVSSP-NMQGGYSPARSSN 104
           +P +P TPFD  YGASLLPSH+LMGSPFVS+P   QG + P+ SS+
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGHFHPSASSH 124

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 25/31 (80%)

Query: 1092 RTIPGSDVMAQYLAQVQHSTFMYAANILGAS 1122
            + I G DVM+QYL Q+ HSTF+Y+ NILGA+
Sbjct: 1021 KPIAGQDVMSQYLEQLHHSTFLYSTNILGAT 1051

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  323 bits (829), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 184/422 (43%), Positives = 250/422 (59%), Gaps = 63/422 (14%)

Query: 534 LDGTDLEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPSPLPLNERMFMNDSN 593
           L  + L ++  +Y+ P V+E   HL++  ISK            P+ L ++E    N S+
Sbjct: 538 LTWSTLIVDVSEYKEPIVNEFDHHLNSWSISK------------PTTLYMHESGTTNFSS 585

Query: 594 H-----------SNGSIVPQQLMATPSPVSSTIQMNQRVLPNPITQSLEQNFNVSAKVAS 642
                       S+   VPQQ++    P      + + ++P  ITQ+++  +   +K   
Sbjct: 586 SNLSDDIDPLSISSHDPVPQQMLLNEYPY-----IMEPLMPPQITQTIQNQY---SKSIQ 637

Query: 643 SMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFY 702
           ++ + + +RT+YIGNINPRS+AEDICNVVRGGILQ IK++  KRICFVTFIE  +AVQFY
Sbjct: 638 AVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFY 697

Query: 703 ANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQ 762
           AN+ ++PI+LHGN+L+VGWG   GPLPK+I+LAVT+GASRNVYVSLP+ AFK+KFI+DPQ
Sbjct: 698 ANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQ 757

Query: 763 YKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKEST 822
           +K+      +P+  QL+ DF  YG +EQ+N+ SD HCCWINFMNISSAI LVEE +    
Sbjct: 758 FKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSD--- 814

Query: 823 AHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKN-------------- 868
                   T      KK  GRY GL+I YGKDRCGNIN+NLV  KN              
Sbjct: 815 --------TKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLVFNKNGKGSNHNRNSQNNN 866

Query: 869 -SRFYKKVKRPSY-----NIRLSKLEERRRQNENDKKERAFDKALNLESLGISLDSHKDI 922
            SR +++ K+ +      NI L           N K +R  D   N  SLG+  D  + +
Sbjct: 867 TSRGHRQRKQSATFSNASNIDLKHSSVANASIANGKLDRPMDNK-NFLSLGVDADFSEGL 925

Query: 923 GI 924
           GI
Sbjct: 926 GI 927

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/298 (28%), Positives = 136/298 (45%), Gaps = 79/298 (26%)

Query: 186 ISSELLLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYII 245
           I SEL +Q      Y ILP G+D YR+RSLL  NV+   D+   ++   K+  +ES Y+I
Sbjct: 209 IDSELKIQ----FQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLI 264

Query: 246 GNEKS-DDLKDEQTSN-------------------------------------------- 260
            +E + DD+++  TSN                                            
Sbjct: 265 KDEDTGDDIENLNTSNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQ 324

Query: 261 LSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCLSTFIEDDALT 320
            S L+SF T+  CL+FYNN+LQR +E K  +KS+ L + FV +  D + +          
Sbjct: 325 QSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEWM---------- 374

Query: 321 ENVEQIDITNDSSMISASLHHDLENKDATRSIIVEFKSPLKSTELFNKKLQFLDRSNNKR 380
                           A+L  ++ +  ATRS+ VEF     +++     L FL   N+ +
Sbjct: 375 ----------------ANLKMNVISLGATRSLYVEFADDSVTSDTIWDTLPFL--KNSGK 416

Query: 381 YILESIDIVNTDVPSNQFPENYAVLTFLNIFMAIEVLDYLKKYSKKLGISKCFYVSLA 438
           Y++  +D+V TD     F  +Y +L FL++ MA+EV + L+  +    +S+  +V+ A
Sbjct: 417 YVVIDVDVVTTDERRKNFGLHYCLLHFLSVTMALEVKELLE--TGDEAVSRVSFVTPA 472

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%)

Query: 63  IPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARSSN 104
           IP TPFD  YG +LLPSHLL+GSPFV++P   G  S    +N
Sbjct: 68  IPQTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGAN 109

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  175 bits (444), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 134/213 (62%), Gaps = 32/213 (15%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRT+Y+GN+    + E+ICNVVRGG+LQS+K + ++ +CFVTFI+  +A QFYA S 
Sbjct: 444 NLGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSS 503

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +  + +     +VGWG +SGPLP +++LAV+ GASRNVY+      F++  + DP+    
Sbjct: 504 LHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDPR---- 557

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
                +   + LR+ F  YG++EQIN+L + +CC+INF NIS+AI  ++++  +S  H E
Sbjct: 558 -----IFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKI--KSNPHFE 610

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
           D                   L IN+GKDRCGN+
Sbjct: 611 D-------------------LKINFGKDRCGNV 624

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 100/211 (47%), Gaps = 31/211 (14%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GNI      +++ + VR G+++ +K +PEK   F++F++  SA+ F++++ +  +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 770
            + G  +++GWG  +   P   +  +   A+RNV++        +    +P  +      
Sbjct: 274 NIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPITEA----- 328

Query: 771 SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEM 830
                 +LRED   +G+IE +  + +    +++F +I+SAI  V  +             
Sbjct: 329 ------KLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNL------------- 369

Query: 831 THKTATEKKFGGRYEGLLINYGKDRCGNINK 861
                  +     YE   I YGKDRC  I K
Sbjct: 370 -------RSMNPYYENKKIAYGKDRCAFITK 393

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  170 bits (431), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 126/213 (59%), Gaps = 34/213 (15%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRTIY+GN++ R R E++CNVVRGG+LQS+K++P++ +CFVTF +  +A QFYA + 
Sbjct: 261 NLGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMAS 320

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +  + +     ++GWG +SGPLP  ++ A++ GASRNVY       F      DP   + 
Sbjct: 321 LHGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEF 373

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
            E         LR+  S +G++EQ+N + +  C ++NF N+ SAI+ VE++ K       
Sbjct: 374 FEE------RHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQVKKWP----- 422

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                           +++ L +NYGKDRCGN+
Sbjct: 423 ----------------QFQQLKVNYGKDRCGNV 439

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 115/245 (46%), Gaps = 51/245 (20%)

Query: 650 NRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDP 709
           +RT+Y+GNI P     ++ + V+ G+++  +  P K   FV+F++  SA+ F++++ ++ 
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 710 IVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHET 769
           + +    +++GW   +   P   +   + GA+RNVY+                       
Sbjct: 98  LRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLG---------------------- 135

Query: 770 LSLPDAE---QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
            +LPD     +L +D S YG+I+ +  LS     +++  +I  AI  V  + ++      
Sbjct: 136 -NLPDGVSRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQRD------ 188

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYN-IRLS 885
                +K  ++++         +++GKDRC  + K     + SR  + +  P  + +R+ 
Sbjct: 189 -----NKIYSDRR---------VSFGKDRCAYVTKL----QQSRAAQFLGLPEEDAVRME 230

Query: 886 KLEER 890
           +L +R
Sbjct: 231 QLRDR 235

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  171 bits (434), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 130/218 (59%), Gaps = 32/218 (14%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRTIY+GN+    + E+ICN VRGG+LQ IK + ++ +CFVTFI+  +A QFYA S 
Sbjct: 338 NLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSS 397

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +  + +H    ++GWG +SGPLP  ++LAV+ GASRN+Y+   +FA  +K  H P + + 
Sbjct: 398 LHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFAADKKSQH-PIFTE- 455

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
                      LR  F  +G++EQIN+L + +CC+INF NISSAI  ++++    T    
Sbjct: 456 ---------AALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT---- 502

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLV 864
                            ++ L IN+GKDRCGN+ +   
Sbjct: 503 -----------------FKDLKINFGKDRCGNVPRQFC 523

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 106/214 (49%), Gaps = 29/214 (13%)

Query: 650 NRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDP 709
           +RT+Y+GN+ P    +++ + VR G+++ +K +PEK   F++F+E  SA+ F++++ +  
Sbjct: 102 SRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKR 161

Query: 710 IVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL--PEFAFKEKFIHDPQYKKLH 767
           + +    +++GWG  +   P   +     GA+RNVY+           ++  DP  + + 
Sbjct: 162 LNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIGKLNTNKDICAQWGVDPNEEVIT 221

Query: 768 ETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNED 827
           E       E+LR D S +G++E +  + +    +++F +I +AI +V  +          
Sbjct: 222 E-------EKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANL---------- 264

Query: 828 GEMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
             +    A +K F          YGKDRC  I K
Sbjct: 265 ANINPYYAQKKIF----------YGKDRCAFITK 288

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  174 bits (442), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 89/214 (41%), Positives = 130/214 (60%), Gaps = 31/214 (14%)

Query: 646 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANS 705
           +++GNRT+Y+GN+    + ++ICN VRGG+LQ IK + ++ +CFVTFI+  +A QFYA S
Sbjct: 523 NNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMS 582

Query: 706 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 765
            +  + +     +VGWG +SGPLP  I+LAV+ GASRNVY+   +F    K  + P + +
Sbjct: 583 SLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIFTE 642

Query: 766 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHN 825
           L           LR  F  YGD+EQIN+L + +CC+INF NIS+AI  +E++      +N
Sbjct: 643 L----------SLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKI-----KNN 687

Query: 826 EDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
            D                ++ L IN+GKDRCGNI
Sbjct: 688 PD----------------FKDLKINFGKDRCGNI 705

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 106/226 (46%), Gaps = 35/226 (15%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GNI      +D+ + VR G++++IK +P+K   F++F++  SA+ F++++ +  +
Sbjct: 268 RTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDAILKRL 327

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVS---------------LPEFAFKE 755
            + G  +++GWG  +   P   +  VT GA+RNVY+                    +   
Sbjct: 328 NIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTSPSSPS 387

Query: 756 KFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVE 815
               D   KK +   S    E+LRED   YG+I+ +  + D    +++  +I SAI +V 
Sbjct: 388 NNTSDDLEKKKNIDDSPLTEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILSAIKVVN 447

Query: 816 EMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
            + + +                      Y+   I YGKDRC  I K
Sbjct: 448 NLAQTNP--------------------YYQNKRIFYGKDRCAFITK 473

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  170 bits (431), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 129/214 (60%), Gaps = 34/214 (15%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRT+Y+GN+    + E+ICN VRGG+LQS+K + ++ +CFVTFI+  +A QFYA S 
Sbjct: 397 NLGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSS 456

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +  + +H    ++GWG +SG LP +++LAV+ GASRN+YV   +F              +
Sbjct: 457 LHGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDF------------NAI 504

Query: 767 HETLSLPDAEQ-LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHN 825
            ET      EQ LRE F  +G++EQIN+L + +CC+INF NIS+AI  ++++        
Sbjct: 505 DETGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKI-------- 556

Query: 826 EDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                        K    ++ L +N+GKDRCGN+
Sbjct: 557 -------------KCNPYFKNLKVNFGKDRCGNV 577

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 133/279 (47%), Gaps = 54/279 (19%)

Query: 593 NHSNGSIVPQQLMATPSPVSS---TIQMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVG 649
           NHS    V QQ + TPS  S             P P TQ L+ N       A S      
Sbjct: 112 NHS----VSQQTIGTPSSTSKFAVAAVAAAANAPLP-TQQLQLNNPRDFISAPS------ 160

Query: 650 NRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDP 709
            RT+Y+GNI P   A+ + + VR G+++ +K +P++   F++F++  SA+ F++++ +  
Sbjct: 161 -RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKR 219

Query: 710 IVLHGNMLRVGWGHYSGPLPKSISLAVTI---GASRNVYVSL----PEFAFKEKFIHDPQ 762
           + + G  ++VGWG    P P    +A  I   GA+RNVY+      P+ A   +F  DP 
Sbjct: 220 LNIEGRDIKVGWGK---PTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPN 274

Query: 763 YKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKEST 822
            + + E       E+LR+D + +G+IE I  + D    +++F +I SAI +V  +   + 
Sbjct: 275 EEIVSE-------EKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNLASVNP 327

Query: 823 AHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
            +           T KK         I YGKDRC  I K
Sbjct: 328 YY-----------TNKK---------IFYGKDRCAFITK 346

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  169 bits (428), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 131/214 (61%), Gaps = 36/214 (16%)

Query: 646 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANS 705
           +++GNRTIY+GN+    + E+ICNVVRGG+LQ+IK + ++  CF+TFI+  +A QFYA S
Sbjct: 351 NNLGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMS 410

Query: 706 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 765
            +  + +  N  +VGWG +SGPL  +++LA++ GASRN+Y+   +F  K ++ ++     
Sbjct: 411 SLHGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIGNVDFEKKNEYFNE----- 465

Query: 766 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHN 825
                     E LRE F  +G++EQIN+L +  CC++NF NI+ AI  ++++        
Sbjct: 466 ----------EHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKI-------- 507

Query: 826 EDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                  K+  E      +E L IN+GKDRCGNI
Sbjct: 508 -------KSLPE------FEDLKINFGKDRCGNI 528

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 120/241 (49%), Gaps = 47/241 (19%)

Query: 623 PNPIT-QSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKY 681
           PNPIT Q    N  ++   A S       RT+Y+GNI      +++ + VR G+++S+K 
Sbjct: 106 PNPITMQPFMANDPLNFTNAPS-------RTVYLGNIPQGLTIKELLDHVRSGVVESVKI 158

Query: 682 MPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVT-IGA 740
           +P K   F++FI+   A+ F++++ +  + + G  +++GWG  S  +   ++  +T  GA
Sbjct: 159 LPTKLCAFISFIDERGALLFHSDAILKRLNIRGKDIKIGWGK-SNHIDSIVAARITNDGA 217

Query: 741 SRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCC 800
           +RNVY+                  +L++  ++   ++L +D   +G+I+ I +LS+    
Sbjct: 218 TRNVYIG-----------------QLNDDPTITTEQELEKDMQKFGEIDCIKFLSNKGIA 260

Query: 801 WINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNIN 860
           +++F +IS AI +V+ ++                    K   +Y+   I YGKDRC  I 
Sbjct: 261 FVHFASISVAIYVVQNLS--------------------KLNEKYKNKRIFYGKDRCAFIT 300

Query: 861 K 861
           K
Sbjct: 301 K 301

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  171 bits (433), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 132/213 (61%), Gaps = 32/213 (15%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRTIY+GN+    R E+ICNVVRGG+LQS+K + ++ +CFVTFI+  +A QF+A S 
Sbjct: 495 NLGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSS 554

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +  + +     +VGWG +SGPL  +++LAV+ GASRN+Y+   +FA  +K   +P + + 
Sbjct: 555 LHGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFATDKKR-DNPIFTE- 612

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
                    + LR+ FS YG++EQIN+L + +CC+INF NIS+AI  ++++         
Sbjct: 613 ---------DSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSNPV---- 659

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                            ++ L IN+GKDRCGNI
Sbjct: 660 -----------------FKDLKINFGKDRCGNI 675

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 125/264 (47%), Gaps = 61/264 (23%)

Query: 639 KVASSMGSDVGN---------RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICF 689
           ++ S+MGS + +         RT+Y+GNI      +++ + VR G+++ +K +PEK   F
Sbjct: 201 RMQSTMGSRLNDPLDFTTAPSRTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAF 260

Query: 690 VTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVS-L 748
           ++F++  SA+ F++++ +  + ++G  +++GWG  +   P   +  +  GA+RNV++  L
Sbjct: 261 ISFLDENSALLFHSDAILKRLNINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQL 320

Query: 749 PEFAF---KEKFIHDPQYKK--LHETLSLPDAE--------------------------Q 777
              +F   K K    P  +   ++ T+S  + E                          +
Sbjct: 321 KTKSFDPNKAKVTKMPPSRNHDINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAK 380

Query: 778 LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATE 837
           LR+D + +GDI+ I  + D    +I+F +I+SAI  V  +N           M    +T+
Sbjct: 381 LRKDLADFGDIDCIKIVEDKGIAFIHFASITSAIKCVHNLN----------SMNDYYSTK 430

Query: 838 KKFGGRYEGLLINYGKDRCGNINK 861
           K F          YGKDRC  I K
Sbjct: 431 KIF----------YGKDRCAFITK 444

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  168 bits (425), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 84/218 (38%), Positives = 128/218 (58%), Gaps = 32/218 (14%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRTIY+GN+    + E+ICN VRGG+LQ IK + ++ +CFVTFI+  +A QFYA S 
Sbjct: 391 NLGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSS 450

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +  + +H    ++GWG +SGPLP  ++LAV+ GASRN+Y+   +F    K +  P + + 
Sbjct: 451 LHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFEDDRK-LEQPIFTE- 508

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
                      LR  F  +G++EQIN+L + +CC+INF NISSAI  ++++    T    
Sbjct: 509 ---------TSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKIKSIPT---- 555

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLV 864
                            ++ L IN+GKDRCGN+ +   
Sbjct: 556 -----------------FKDLKINFGKDRCGNVPRQFC 576

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 107/215 (49%), Gaps = 33/215 (15%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GN+ P     ++ + VR G+++ +K +PEK   F++F++  SA+ F++++ +  +
Sbjct: 156 RTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKRL 215

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL----PEFAFKEKFIHDPQYKKL 766
            +    +++GWG  +   P   +     GA+RNVY+      P+     ++  DP  + +
Sbjct: 216 NIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADPNEETI 273

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
            E       E+LR D + +G++E +  +++    +++F +I SAI +V  +         
Sbjct: 274 TE-------EKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANL--------- 317

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
              +    A +K F          YGKDRC  I K
Sbjct: 318 -ANVNPYYAQKKIF----------YGKDRCAFITK 341

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  168 bits (426), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 87/213 (40%), Positives = 129/213 (60%), Gaps = 32/213 (15%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRT+Y+GN+    + E+ICN VR G+LQS+K + ++ +CFVTFI+  +A QFYA S 
Sbjct: 405 NLGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSS 464

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +  ++L     +VGWG +SGPLP  I+LAV+ GASRNVY+   +F          +  K 
Sbjct: 465 LHGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDFE---------EDSKR 515

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
           +E +   D   LR+ F  YG++EQIN+L   +CC+IN+ NIS+AIS ++++         
Sbjct: 516 NERVFTED--NLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKI--------- 564

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                       K    ++ L IN+GKDRCGNI
Sbjct: 565 ------------KSNPYFKDLKINFGKDRCGNI 585

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 108/217 (49%), Gaps = 37/217 (17%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GNI      +++ + VR G+++ +K +PEK   F++F++  SA+ F++++ +  +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 770
            + G  +++GWG  +   P   +   T GA+RNVY+         +   D +   + E+L
Sbjct: 229 NIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIG--------QLYTDAE---VAESL 277

Query: 771 SLPD------AEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAH 824
           ++P        E+L  D   YGDI+ +  + +    +I+F +I SAI +V  +       
Sbjct: 278 NIPKESEIVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVVNNL------- 330

Query: 825 NEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
                     A   ++   Y+   I YGKDRC  I K
Sbjct: 331 ----------AASNRY---YQNRKIFYGKDRCAFITK 354

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  168 bits (426), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 95/262 (36%), Positives = 145/262 (55%), Gaps = 43/262 (16%)

Query: 603 QLMATPSPVSSTI-QMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPR 661
           Q +  P+  ++++ Q N  +L N + Q       ++     S  +++GNRT+Y+GN+   
Sbjct: 368 QFLGIPTSKANSLEQTNSGLLANALLQQSAAAAAIATSAGGS--NNLGNRTVYLGNLPND 425

Query: 662 SRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 721
            R EDICN +R G+LQ+IK + ++ +CFVTFI+  SA QFYA S I   VL     +VGW
Sbjct: 426 IRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSIYGFVLQKKRCKVGW 485

Query: 722 GHYSGPLPKSISLAVTIGASRNVYVSLPEFAF----KEKFIHDPQYKKLHETLSLPDAEQ 777
           G +SGPL   ++LAV+ GASRNVY+   +F      +E++  D                 
Sbjct: 486 GKHSGPLSNPLTLAVSNGASRNVYIGNIDFTADGTKRERYFTD---------------SN 530

Query: 778 LREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTATE 837
           LR  FS YG++EQIN+L   +CC++N+ NI++AIS ++++    T               
Sbjct: 531 LRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKNNPT--------------- 575

Query: 838 KKFGGRYEGLLINYGKDRCGNI 859
                 ++ L IN+GKDRCGNI
Sbjct: 576 ------FKNLKINFGKDRCGNI 591

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 111/215 (51%), Gaps = 26/215 (12%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GNI P   A D+ + VR G+++ +K +PEK   F++F++  S++ F++++ +  +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAV-TIGASRNVYVSLPEFAFKEKFIHDPQYKKLHET 769
            + G  +++GWG  S PL   I+ +V T GA+RN+++         K   D      H +
Sbjct: 228 NIDGKDIKIGWGKPS-PLSPIIATSVATDGATRNIFIGQLNTTDHNK-QKDNDATIYHGS 285

Query: 770 LSLPD---AEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
               D    E+LR+D   YGDI+ I    +    +++F +I SAI +V  ++  +  +  
Sbjct: 286 DDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSNPYY-- 343

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
                    ++KK         I YGKDRC  I K
Sbjct: 344 ---------SKKK---------IYYGKDRCAFITK 360

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  167 bits (424), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 131/214 (61%), Gaps = 32/214 (14%)

Query: 646 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANS 705
           +++GNRT+Y+GN+    + E+ICNVVRGGILQ+IK + ++ +CFVTFI+  +A QFYA S
Sbjct: 398 NNLGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMS 457

Query: 706 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 765
            +  I +     RVGWG + GPLP +I+LAV+ GASRNVY+   +F +++    +P +  
Sbjct: 458 SLHGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPIFT- 515

Query: 766 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHN 825
                    A+ LR+ F  YG++EQ+N+L + +C ++N+ NIS+AIS ++++        
Sbjct: 516 ---------ADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSNPL--- 563

Query: 826 EDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                             ++ L IN+GKDRCG I
Sbjct: 564 ------------------FKNLKINFGKDRCGTI 579

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 105/213 (49%), Gaps = 29/213 (13%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           +T+Y+GNI P     ++ + VR G+++ +K +PEK   F+TF++  +A+ F++++ +  +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL--PEFAFKEKFIHDPQYKKLHE 768
            + G  +++GWG  +   P   +   + GA+RNVY+ L   +     +   DP  +K+ E
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEKITE 282

Query: 769 TLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDG 828
                  E+LR D   +G+I+ +  + +    +I+F +I SA+ +V  +           
Sbjct: 283 -------EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANL----------- 324

Query: 829 EMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
                          YE   I YGKDRC  I K
Sbjct: 325 ---------AGINPYYENKKIYYGKDRCAFITK 348

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  167 bits (424), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 129/214 (60%), Gaps = 32/214 (14%)

Query: 646 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANS 705
           +++GNRT+Y+GN+    + E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A QFYA S
Sbjct: 453 NNLGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMS 512

Query: 706 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 765
            +    +     +VGWG +SGPLP +++LAV+ GASRNVY+   +F    K     +   
Sbjct: 513 SLYGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSK----KEQPI 568

Query: 766 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHN 825
            +ET        LR  F  YG++EQIN+L +  CC+INF NI++AI  ++++  +S  H 
Sbjct: 569 FNET-------ALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKI--KSNPH- 618

Query: 826 EDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                             ++ L IN+GKDRCGN+
Sbjct: 619 ------------------FKSLKINFGKDRCGNV 634

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 109/211 (51%), Gaps = 31/211 (14%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GNI P    +++ + VR G+++  K +PEK   F++F+E  SA+ F++++ +  +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 770
            +    ++VGWG  +   P   S  +  GA+RNVY+            +D   K+  E L
Sbjct: 284 NIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGN--------NDRSSKENKEPL 335

Query: 771 SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEM 830
           +    E+LRED   YG+I+ I  + +    +++F +I++AI +V  + +++  +      
Sbjct: 336 T---EEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQKNPFYQ----- 387

Query: 831 THKTATEKKFGGRYEGLLINYGKDRCGNINK 861
                 EKK         I YGKDRC  I K
Sbjct: 388 ------EKK---------IFYGKDRCAFITK 403

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  167 bits (424), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 129/213 (60%), Gaps = 32/213 (15%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRT+Y+GN+    + E+ICN +RGG+LQ+IK + ++ +CFVTFI+  +A QFYA S 
Sbjct: 468 NLGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSS 527

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +  + +H    ++GWG +SGPLP  I+LAV+ GASRN+Y  L    F+E         K 
Sbjct: 528 LHGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIY--LGNINFEED-------AKQ 578

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
            E++   D   LR  F  +G +EQIN+L + +CC+INF NIS+AI  ++++  +S  H  
Sbjct: 579 EESVFAEDT--LRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKI--KSNPH-- 632

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                            +  L IN+GKDRCGN+
Sbjct: 633 -----------------FNNLKINFGKDRCGNV 648

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 103/213 (48%), Gaps = 29/213 (13%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GNI      + + + VR G+++ +K + EK   FV+F++   A+ F++++ +  +
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFK--EKFIHDPQYKKLHE 768
            + G  +++GWG      P   +     GA+RNVY+          EK+  DP  K++  
Sbjct: 293 NIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIGKLNTNKDSCEKWGADP--KEI-- 348

Query: 769 TLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDG 828
              L   E+L +D S +G+IE I  + D    +++F +I +AI  V  +          G
Sbjct: 349 ---LVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANI----------G 395

Query: 829 EMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
            +    + +K F          YGKDRC  I K
Sbjct: 396 SIDPYYSNKKVF----------YGKDRCAFITK 418

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  161 bits (408), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 128/213 (60%), Gaps = 32/213 (15%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRTIY+GN+    + E+ICNVVRGG+LQSIK + ++ +CFVTFI+  +A Q YA + 
Sbjct: 382 NLGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMAS 441

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +  + +H    ++GWG +SG L  +++LAV+ GASRN+Y+   +F    +  H P + + 
Sbjct: 442 LHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSETEH-PIFTE- 499

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
                    + LR  F  +G++EQIN+L + +CC++NF NIS+AI  ++++         
Sbjct: 500 ---------QNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKI--------- 541

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                       K   ++  L IN+GKDRCGN+
Sbjct: 542 ------------KNNPQFSDLKINFGKDRCGNV 562

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 109/213 (51%), Gaps = 29/213 (13%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GNI P   A  + + VR G+++ I+ + EK   F++F++  SA+ F++++ +  +
Sbjct: 146 RTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKRL 205

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSL--PEFAFKEKFIHDPQYKKLHE 768
            + G  +++GWG  +   P   S     GA+RNVY+     + +F  +   DP+ + + E
Sbjct: 206 NIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRDEVVTE 265

Query: 769 TLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDG 828
                  ++LR+D S YG+IE +  +++    +++F +I SAI +V  +           
Sbjct: 266 -------QKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSL----------A 308

Query: 829 EMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
            +    A +K F          YGKDRC  I K
Sbjct: 309 AVNPYYANKKIF----------YGKDRCAFITK 331

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  161 bits (407), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 129/214 (60%), Gaps = 32/214 (14%)

Query: 646 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANS 705
           +++GNRT+Y+G++    + E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A QFYA S
Sbjct: 410 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 469

Query: 706 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 765
            +    +     +VGWG +SGPLP +++LAV+ GASRNVYV   +FA     ++D +   
Sbjct: 470 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA--SDSLNDER--- 524

Query: 766 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHN 825
                 +     LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++        
Sbjct: 525 ------IFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI-------- 570

Query: 826 EDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                        K    ++ L IN+GKDRCGN+
Sbjct: 571 -------------KSNPYFKDLKINFGKDRCGNV 591

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 101/211 (47%), Gaps = 35/211 (16%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GN+ P    +++ + VR G+++ +K +PEK   F++F++  +A+ F++++ +  +
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 770
            +    +++GWG  +   P   +   T GA+RNVY+       +E  + +          
Sbjct: 245 NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHLSE---------- 294

Query: 771 SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEM 830
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +   +         
Sbjct: 295 -----EQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRNP-------- 341

Query: 831 THKTATEKKFGGRYEGLLINYGKDRCGNINK 861
                        Y+   I YGKDRC  I K
Sbjct: 342 ------------YYQNKRIFYGKDRCAFITK 360

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  160 bits (405), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 131/214 (61%), Gaps = 34/214 (15%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRTIY+GN+    + E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A Q YA + 
Sbjct: 384 NLGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTS 443

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEF-AFKEKFIHDPQYKK 765
           +  + +H    ++GWG +SG L  +++LAV+ GASRN+Y+   +F A  E+ +  P + +
Sbjct: 444 LHGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDFKADSERDV--PVFTE 501

Query: 766 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHN 825
                     + LR+ F  YG++EQIN+L +  CC++NF NIS+AI  ++++       N
Sbjct: 502 ----------QNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKS-----N 546

Query: 826 EDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
           E                +++ L IN+GKDRCGN+
Sbjct: 547 E----------------QFKDLKINFGKDRCGNV 564

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 109/214 (50%), Gaps = 31/214 (14%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GNI P     ++ + VR G+++ ++ + EK   F++F++  SA+ F++++ +  +
Sbjct: 148 RTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKRL 207

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVT-IGASRNVYVSL--PEFAFKEKFIHDPQYKKLH 767
            + G  ++VGWG  + P+   ++ AV+  GA+RNVY+     +     +F  DP  + L 
Sbjct: 208 NIGGRDIKVGWGKPT-PIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP--RDLI 264

Query: 768 ETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNED 827
            T      E+LR D   YG+IE +  + +    +++F +I SAI +V  +          
Sbjct: 265 AT-----EEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL---------- 309

Query: 828 GEMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
                  AT   +   Y    I YGKDRC  + K
Sbjct: 310 -------ATVNPY---YSNKKIFYGKDRCAFVTK 333

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  161 bits (407), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 124/213 (58%), Gaps = 32/213 (15%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRT+Y+GN+    + E+ICNVVRGG+LQ++K + ++ +CFVTFI+  +A QFYA S 
Sbjct: 447 NLGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSS 506

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +  I +     RVGWG + G L  +++LAV+ GASRNVYV    F    K   DP + + 
Sbjct: 507 LHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFDEDSKR-EDPIFTE- 564

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
                      LR  F  +G++EQINYL + +CC++N+ NIS+AI  ++++         
Sbjct: 565 ---------SSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKGHPV---- 611

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                            ++ L IN+GKDRCGN+
Sbjct: 612 -----------------FKDLKINFGKDRCGNV 627

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 99/214 (46%), Gaps = 30/214 (14%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           +T+Y+GN       +++ + VR G+++ ++ +P+K   FV+F++  +A+ F++++ +  +
Sbjct: 210 KTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKRL 269

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIG---ASRNVYVSLPEFAFKEKFIHDPQYKKLH 767
            + G  +++GWG    P P    +A  +    A+RNVY+   +     K     Q   + 
Sbjct: 270 HIDGRDIKIGWGK---PTPIDPVVATAVANDNATRNVYIG--QLNTGPKL--SSQVSPVD 322

Query: 768 ETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNED 827
            T  +   ++LR D   +G+I+ I  + +    +++F +I +AI  V  +          
Sbjct: 323 VTEPVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANL---------- 372

Query: 828 GEMTHKTATEKKFGGRYEGLLINYGKDRCGNINK 861
                           Y    I YGKDRC  I K
Sbjct: 373 ----------ANINPYYRNKKIFYGKDRCAFITK 396

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  160 bits (406), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 128/214 (59%), Gaps = 32/214 (14%)

Query: 646 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANS 705
           +++GNRT+Y+G++    + E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A QFYA S
Sbjct: 426 NNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMS 485

Query: 706 FIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKK 765
            +    +     +VGWG +SGPLP +++LAV+ GASRNVYV          F+ D     
Sbjct: 486 SLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVGD----S 535

Query: 766 LHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHN 825
           L +     ++  LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++        
Sbjct: 536 LRDERVFTES-NLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI-------- 586

Query: 826 EDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                        K    ++ L IN+GKDRCGN+
Sbjct: 587 -------------KSNPYFKDLKINFGKDRCGNV 607

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 101/211 (47%), Gaps = 35/211 (16%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GN+ P    +++ + VR G+++ +K +PEK   FV+FI+  +A+ F++++ +  +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 770
            +    +++GWG  +   P   +   T GA+RNVY+       +E  + +          
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHLSE---------- 310

Query: 771 SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEM 830
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +   +         
Sbjct: 311 -----EQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTNLPIRNP-------- 357

Query: 831 THKTATEKKFGGRYEGLLINYGKDRCGNINK 861
                        Y+   I YGKDRC  I K
Sbjct: 358 ------------YYQNKRIFYGKDRCAFITK 376

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  160 bits (404), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 126/213 (59%), Gaps = 32/213 (15%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRT+Y+G++    + E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A QFYA S 
Sbjct: 440 NLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSS 499

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +    +     +VGWG +SGPLP +++LAV+ GASRNVYV          F+ D    + 
Sbjct: 500 LYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSDSLRDER 553

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
             T S      LR  F  YG++EQIN+L + +CC++N+ NIS+AI  ++++         
Sbjct: 554 IFTES-----NLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKI--------- 599

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                       K    ++ L IN+GKDRCGN+
Sbjct: 600 ------------KSNPYFKDLKINFGKDRCGNV 620

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 101/211 (47%), Gaps = 35/211 (16%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GN+ P    +++ + VR G+++ +K + EK   F++F++  +A+ F++++ +  +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 770
            +    +++GWG  +   P   +   T GA+RNVY+         +   D +   L E  
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIG--------RMTIDGEESHLSE-- 323

Query: 771 SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEM 830
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +   +         
Sbjct: 324 -----EQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTNLPIRNP-------- 370

Query: 831 THKTATEKKFGGRYEGLLINYGKDRCGNINK 861
                        Y+   I YGKDRC  I K
Sbjct: 371 ------------YYQNKRIFYGKDRCAFITK 389

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  158 bits (399), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 82/213 (38%), Positives = 126/213 (59%), Gaps = 32/213 (15%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSF 706
           ++GNRT+Y+G++    + E+ICN VRGG+LQSIK + ++ +CFVTFI+  +A QFYA S 
Sbjct: 429 NLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSS 488

Query: 707 IDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           +    +     +VGWG +SGPLP +++LAV+ GASRNVYV      +    + D +    
Sbjct: 489 LYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG--NIDYVSDSVRDER---- 542

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNE 826
                +    +LR  F  YG++EQIN+L + +CC+IN+ NIS+AI  ++++         
Sbjct: 543 -----IFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI--------- 588

Query: 827 DGEMTHKTATEKKFGGRYEGLLINYGKDRCGNI 859
                       K    ++ L IN+GKDRCGN+
Sbjct: 589 ------------KSNPYFKDLKINFGKDRCGNV 609

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 100/211 (47%), Gaps = 35/211 (16%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDPI 710
           RT+Y+GN+ P    +++ + VR G+++ +K +PEK   F++F++  +A+ F++++ +  +
Sbjct: 203 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 262

Query: 711 VLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKLHETL 770
            +    +++GWG  +   P   +   T GA+RNVY+       +E  +            
Sbjct: 263 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL------------ 310

Query: 771 SLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEM 830
                EQLR D   YG+I+ I  + +    +I+F +I +AI +V  +   +         
Sbjct: 311 ---SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIRNL-------- 359

Query: 831 THKTATEKKFGGRYEGLLINYGKDRCGNINK 861
                        Y+   I YGKDRC  I K
Sbjct: 360 ------------YYQNKRIFYGKDRCAFITK 378

>SAKL0E07128g Chr5 complement(587416..588621) [1206 bp, 401 aa] {ON}
           some similarities with uniprot|P32588 Saccharomyces
           cerevisiae YNL016W PUB1 Poly(A) RNA-binding protein
           abundant mRNP-component protein hypothesized to bind a
           pool of non-translatable mRNAs not reported to associate
           with polyribosomes
          Length = 401

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 40/93 (43%), Gaps = 18/93 (19%)

Query: 652 TIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFV---TFIEAPSAVQFYANSFI 707
           T YIGNI   +   D+  +++  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 299 TAYIGNIPHFATEPDLIPLLQNFGFIVDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 355

Query: 708 DPIVLHGNMLRVGWG---------HYSGPLPKS 731
                 G  LR GWG         H  GP+P+ 
Sbjct: 356 --FPFQGRNLRTGWGKEKPTFIPQHQQGPVPQQ 386

>TDEL0G02360 Chr7 (454633..455841) [1209 bp, 402 aa] {ON} Anc_2.306
           YNL016W
          Length = 402

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 80/209 (38%), Gaps = 35/209 (16%)

Query: 520 EEIDILTTKLQGIQLDGTDLEINYHDYQTPTVHEHSTHLSNVKISKTVENSRQFPHDIPS 579
           EE       +QG +L+G  L IN+   +    + +  +++  + +    N+  FP     
Sbjct: 184 EEAQKAMDAMQGHELNGRPLRINWASKRENNNNNNRRNVNGPRNNGFRHNNGGFPGSRGM 243

Query: 580 PLPLNERMFMNDSNHSNGSIVPQQLMATPSPVSSTIQMNQRVLPNPITQSLEQNFNVSAK 639
           P+P    M +       G + P Q +  P         N   +P P          V+ +
Sbjct: 244 PMPPPNSMSL-----PMGVVPPPQALGNP---------NGPSVPPP----------VNPQ 279

Query: 640 VASSMGSDVGNR--TIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFV---TFI 693
              SM      R  T YIGNI   +   D+  +++  G +   K+ PEK  CF+   T  
Sbjct: 280 AVDSMIRRAPPRVTTAYIGNIPHFAIEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHE 339

Query: 694 EAPSAVQFYANSFIDPIVLHGNMLRVGWG 722
           +A   +   AN         G  LR GWG
Sbjct: 340 QAAVCIVALAN-----FPFQGRNLRTGWG 363

>TPHA0C03520 Chr3 (764414..765742) [1329 bp, 442 aa] {ON} Anc_2.306
           YNL016W
          Length = 442

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 652 TIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFV---TFIEAPSAVQFYANSFI 707
           T+YIGNI   +   D+  +++  G +   KY PEK  CF+   T  +A   +   AN   
Sbjct: 326 TVYIGNIPHFATEADLIPLLQNFGFILDFKYYPEKGNCFIKYDTHEQAAVCIVVLAN--- 382

Query: 708 DPIVLHGNMLRVGWG 722
                 G  L+ GWG
Sbjct: 383 --YPFQGRNLKTGWG 395

>ZYRO0A02398g Chr1 (188639..189871) [1233 bp, 410 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 410

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 652 TIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFV---TFIEAPSAVQFYANSFI 707
           T YIGNI   +   D+  +++  G +   K+ PEK  CFV   T  +A   +   AN F 
Sbjct: 313 TSYIGNIPHFATDSDLIPLLQNFGFILDFKHYPEKGCCFVKYDTHEQAAVCIVALANFF- 371

Query: 708 DPIVLHGNMLRVGWG 722
                 G  LR GWG
Sbjct: 372 ----FQGRNLRTGWG 382

>Ecym_3344 Chr3 (653783..655048) [1266 bp, 421 aa] {ON} similar to
           Ashbya gossypii AGR390C
          Length = 421

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 652 TIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFV---TFIEAPSAVQFYANSFI 707
           T YIGNI   ++  D+  +++  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 315 TAYIGNIPHFAQEPDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 371

Query: 708 DPIVLHGNMLRVGWG 722
                 G  LR GWG
Sbjct: 372 --FPFQGRNLRTGWG 384

>Skud_4.47 Chr4 complement(83397..84428) [1032 bp, 343 aa] {ON}
           YDL209C (REAL)
          Length = 343

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 12/77 (15%)

Query: 777 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTAT 836
           ++R  FS  GDI++I Y+ D +C ++ F   ++A     E  KES ++      T    +
Sbjct: 159 RIRFVFSRLGDIDRIRYVEDKNCAFVKFKYQANA-----EFAKESMSN-----QTLLLPS 208

Query: 837 EKKFGGRYE--GLLINY 851
           +K++ GR E  GLL+ +
Sbjct: 209 DKEWDGRREGTGLLVKW 225

>Kwal_26.8763 s26 complement(934672..935952) [1281 bp, 426 aa] {ON}
           YOR242C (SSP2) - involved in sporulation [contig 67]
           FULL
          Length = 426

 Score = 35.8 bits (81), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 16/82 (19%)

Query: 774 DAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTH 832
           D + LR+DF  +G+I +I+  +S   C  + F ++SS+I  +E   K ++  N       
Sbjct: 349 DIKDLRQDFENFGNIVEISPMISRKLCLCVTFYDVSSSIGALESFEKPNSYLN------- 401

Query: 833 KTATEKKFGGRYEGLLINYGKD 854
                KK+G  +    I YG+D
Sbjct: 402 -----KKYGRDWS---IAYGRD 415

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 81/200 (40%), Gaps = 27/200 (13%)

Query: 667 ICNVVRGGILQSI--KYMPEK---RICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 721
           + N V+GG L+ I  +Y  E    +   + F+    A  F          ++G  LR  W
Sbjct: 183 VLNQVQGGALKHITPQYKKETNQLKSVELEFLCPEDAQHFMEYGRHAVFQINGVHLRPRW 242

Query: 722 GHYSGPLPKSISLAVTIGASRNVYV-SLPEFAFKEKFIHDPQYKKLH-----ETLSLPDA 775
           G  S       SL        N+Y  S      K++   +P++   H       +   + 
Sbjct: 243 GIQSLSENFEASLNANQRDRLNLYAPSSRCLLLKKQGSKNPKHSTCHYPSPRSHICDLNV 302

Query: 776 EQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKT 834
           ++L++DFS +G+I  I+  +S   C  INF +I SA+  ++      +  N +  +  K 
Sbjct: 303 QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQ------SYKNANSPLNRKY 356

Query: 835 ATEKKFGGRYEGLLINYGKD 854
           A         E   I YGKD
Sbjct: 357 A---------ESWTIGYGKD 367

>Kpol_1043.34 s1043 complement(70168..71496) [1329 bp, 442 aa] {ON}
           complement(70168..71496) [1329 nt, 443 aa]
          Length = 442

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 9/75 (12%)

Query: 652 TIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFV---TFIEAPSAVQFYANSFI 707
           T+YIGNI   +   D+  +++  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 325 TVYIGNIPHFATEADLIPLLQNFGFILDFKHYPEKGNCFIKYDTHEQAAVCIVVLAN--- 381

Query: 708 DPIVLHGNMLRVGWG 722
                 G  L+ GWG
Sbjct: 382 --FPFQGRNLKTGWG 394

>NDAI0E01190 Chr5 (237093..238169) [1077 bp, 358 aa] {ON} Anc_8.670
           YOR242C
          Length = 358

 Score = 35.8 bits (81), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 88/221 (39%), Gaps = 40/221 (18%)

Query: 646 SDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKR------ICFVTFIEAPSAV 699
           +D   R I I NI   +    I   + GG +++  +  + +      +  + FI +  A 
Sbjct: 157 TDKQRRMIIIRNIPKETGIHSIVAQISGGPIENFNFYQQHKLSSPSNVLKIAFIASEGAQ 216

Query: 700 QFYANSFIDPIVLHGNMLRVGWGHYSG-PLPKSISLAVTI----GASRNVYVSLPEFAFK 754
           QF      +   ++G  L+  W   S   +P     + T+    G  R ++  + +   K
Sbjct: 217 QFMKYGNTNLFKVNGIHLKPEWFVDSNLCIPSKTVPSKTLLNYNGKCRCLF--MKQLPLK 274

Query: 755 EKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISL 813
           +  + +  Y K           ++R DF  +G+I  I+  +S   C +I F +I SA+ +
Sbjct: 275 DHLVLNSLYLK-----------RIRSDFECFGEIVDISPLISRRPCLYIQFYDIYSAVRV 323

Query: 814 VEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKD 854
           +E       A+ +     H+   EK          I YGKD
Sbjct: 324 LE-------AYEDRHSRIHQQYFEK--------WSIYYGKD 349

>KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|Q96US5 Saccharomyces
           cerevisiae YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 422

 Score = 35.8 bits (81), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 44/84 (52%), Gaps = 8/84 (9%)

Query: 761 PQYKKLH---ETLSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEE 816
           P+ ++LH   + L   D + LR+DF  +G+I +I+  +S   C  ++F ++ SAI+ +E 
Sbjct: 330 PRSRQLHSNRQNLCSFDYKDLRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALES 389

Query: 817 MNKEST----AHNEDGEMTHKTAT 836
             +  +     +N D  M +   T
Sbjct: 390 FGEPDSFMHKKYNRDWTMAYGRDT 413

>TBLA0B07170 Chr2 complement(1698573..1699985) [1413 bp, 470 aa]
           {ON} Anc_2.306 YNL016W
          Length = 470

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 38/76 (50%), Gaps = 11/76 (14%)

Query: 652 TIYIGNINPRSRAE-DICNVVRG-GILQSIKYMPEKRICFV---TFIEAPSAVQFYANSF 706
           T YIGN+ PR   E D+  +++  G +   K+ P++ ICF+   T  +A   +   AN  
Sbjct: 340 TAYIGNL-PRFATEADLIPLLQNFGFILDFKHYPDRGICFIKYDTHEQAAVCIVALAN-- 396

Query: 707 IDPIVLHGNMLRVGWG 722
                L G  L+ GWG
Sbjct: 397 ---FPLQGRNLKTGWG 409

>KAFR0H01620 Chr8 complement(303924..304916) [993 bp, 330 aa] {ON}
           Anc_8.466 YDL209C
          Length = 330

 Score = 35.4 bits (80), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 8/78 (10%)

Query: 777 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTAT 836
           +LR  F+  G I++I Y+++ +C ++ F N  +A    E M  ++     D E  ++T +
Sbjct: 151 RLRFMFNKLGPIDKIRYVANKNCAFVKFRNARNAEFAKEAMTNQTMLLPNDDEWENRTES 210

Query: 837 EKKFGGRYEGLLINYGKD 854
                    GLL+ +  D
Sbjct: 211 --------TGLLVKWAND 220

>KLLA0E08779g Chr5 (782800..784227) [1428 bp, 475 aa] {ON} similar
           to uniprot|P32588 Saccharomyces cerevisiae YNL016W PUB1
           Poly(A) RNA-binding protein abundant mRNP- component
           protein hypothesized to bind a pool of non- translatable
           mRNAs not reported to associate with polyribosomes
          Length = 475

 Score = 35.4 bits (80), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 652 TIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFVTF-IEAPSAVQFYANSFIDP 709
           T YIGNI   ++  D+  +++  G +   K+ PEK  CF+ +     +A+   A   +  
Sbjct: 360 TAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPEKGCCFIKYDTHEQAALCIVA---LTN 416

Query: 710 IVLHGNMLRVGWG 722
               G  LR GWG
Sbjct: 417 FPFQGRNLRTGWG 429

>YNL016W Chr14 (602907..604268) [1362 bp, 453 aa] {ON}  PUB1Poly
           (A)+ RNA-binding protein, abundant mRNP-component
           protein that binds mRNA and is required for stability of
           many mRNAs; component of glucose deprivation induced
           stress granules, involved in P-body-dependent granule
           assembly
          Length = 453

 Score = 35.4 bits (80), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 652 TIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFV---TFIEAPSAVQFYANSFI 707
           T YIGNI   +   D+  + +  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 342 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 398

Query: 708 DPIVLHGNMLRVGWG 722
                 G  LR GWG
Sbjct: 399 --FPFQGRNLRTGWG 411

>Suva_14.330 Chr14 (582310..583040,583082..583721) [1371 bp, 457 aa]
           {ON} YNL016W (REAL)
          Length = 457

 Score = 35.4 bits (80), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 652 TIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFV---TFIEAPSAVQFYANSFI 707
           T YIGNI   +   D+  + +  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 344 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 400

Query: 708 DPIVLHGNMLRVGWG 722
                 G  LR GWG
Sbjct: 401 --FPFQGRNLRTGWG 413

>Skud_14.312 Chr14 (569627..571006) [1380 bp, 459 aa] {ON} YNL016W
           (REAL)
          Length = 459

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 652 TIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFV---TFIEAPSAVQFYANSFI 707
           T YIGNI   +   D+  + +  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 348 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 404

Query: 708 DPIVLHGNMLRVGWG 722
                 G  LR GWG
Sbjct: 405 --FPFQGRNLRTGWG 417

>Suva_4.39 Chr4 complement(74438..75484) [1047 bp, 348 aa] {ON}
           YDL209C (REAL)
          Length = 348

 Score = 35.0 bits (79), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 777 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTAT 836
           ++R  FS  GDI++I Y+ D  C ++ F + +SA    E M+ ++   + D E       
Sbjct: 159 RVRFVFSRLGDIDRIRYVEDKSCAFVKFKHQASAEFAKEAMSNQTLLLHSDKEW-----D 213

Query: 837 EKKFGGRYEGLLINY 851
           ++K G    GLL+ +
Sbjct: 214 DRKEG---TGLLVKW 225

>Smik_14.313 Chr14 (561320..562675) [1356 bp, 451 aa] {ON} YNL016W
           (REAL)
          Length = 451

 Score = 35.0 bits (79), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 9/75 (12%)

Query: 652 TIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFV---TFIEAPSAVQFYANSFI 707
           T YIGNI   +   D+  + +  G +   K+ PEK  CF+   T  +A   +   AN   
Sbjct: 342 TAYIGNIPHFATEADLIPLFQNFGFILDFKHYPEKGCCFIKYDTHEQAAVCIVALAN--- 398

Query: 708 DPIVLHGNMLRVGWG 722
                 G  LR GWG
Sbjct: 399 --FPFQGRNLRTGWG 411

>NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {ON} 
          Length = 474

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 53/111 (47%), Gaps = 13/111 (11%)

Query: 616 QMNQRVLPNPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRG-G 674
           Q  Q  L   +T +L  N N+       +GS+  N TI++G ++     +++  + R  G
Sbjct: 277 QTAQLALSTVVTGNLRSNGNIR----QGLGSNSKNSTIFVGGLSTDVSEQELNELFRPFG 332

Query: 675 ILQSIKYMPEKRICFVTF---IEAPSAVQFYANSFIDPIVLHGNMLRVGWG 722
            +  +K    K+  FVTF   I+A +A++      +   ++ G  +R+ WG
Sbjct: 333 EIMDVKIPLGKKCGFVTFKRRIDAKAAIK-----GLHGFLVRGCPIRLSWG 378

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 83/175 (47%), Gaps = 15/175 (8%)

Query: 651 RTIYIGNINPRSRAEDICNV-VRGGILQSIKYMPEKRICFVTFIEAPSAVQFYANSFIDP 709
           RT+Y+GNI+PR   ED+  + V+ G ++ I Y P  ++  +   +  + ++F  +S +D 
Sbjct: 7   RTVYVGNIDPRVNKEDLYELFVQFGRIKKINY-PRDKV--LDTHQGYAFIEFLNDSTVDY 63

Query: 710 IV-LHGNMLRVGWGHYSGPLPKSIS--LAVTIGASRNVYVSLPEFAFKEKFIHDPQYKKL 766
           ++ L GN   V     S  + KS +   A   G ++N+ V +   A   K I     K +
Sbjct: 64  VLKLFGNTNLVSLYERSLKIRKSENGKEANANGTNKNIDVDMLPIA---KII----VKNV 116

Query: 767 HETLSLPDAEQLREDFSTYGDIEQINYLSDS-HCCWINFMNISSAISLVEEMNKE 820
            E++ +    ++   F        I  +S+   C +++F +   +   ++++N E
Sbjct: 117 DESVDIMKLNKICSKFGKLARDSDIVTMSNGMRCGFVHFRDYKDSDLAIDKLNNE 171

>Ecym_2403 Chr2 (785307..786434) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ACR135C
          Length = 375

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 71/162 (43%), Gaps = 15/162 (9%)

Query: 667 ICNVVRGGILQSI--KYMPEK---RICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGW 721
           + N V+GG L+ I  +Y  E    +   + F+    A  F          ++G  LR  W
Sbjct: 183 VLNQVQGGPLKHIAPQYRKESNQLKSVELEFLSPEDAQHFMEYGRHAVFQINGVHLRPKW 242

Query: 722 GHYSGPLPKSISLAV-TIGASRNVYV-SLPEFAFKEKFIHDPQYKKLH-----ETLSLPD 774
           G  S  L ++   ++ T   S NVY  S      K++   +P++   H       +   +
Sbjct: 243 GIQS--LSENFEASLNTHKDSLNVYTPSSRCLLLKKQGSRNPKHSTCHYPSPRSHICDLN 300

Query: 775 AEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVE 815
            + L+ DF  +GDI  I+  +S   C  INF +I +A+  ++
Sbjct: 301 IQDLKNDFGQFGDILDISPMISRKLCVQINFFDIKTAVDALQ 342

>Kpol_1045.55 s1045 (135384..136286,136336..136344,136387..137484)
           [2010 bp, 669 aa] {ON}
           (135386..136288,136338..136346,136389..137486) [2010 nt,
           670 aa]
          Length = 669

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 272 DCLNFYN----NILQRLSEFKTFLKSESLNLKFVCLNYDFKCLSTFIEDDALT 320
           D L FY     ++++ L E   F  +E     F CL Y FK LS F+ DD +T
Sbjct: 120 DFLKFYEPTVLSLIRLLEEAVKFESTEVFEWGFNCLAYIFKYLSKFLSDDLVT 172

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 76/183 (41%), Gaps = 11/183 (6%)

Query: 644 MGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICF----VTFIEAPSAV 699
           + ++V  + I +GNI  R+    I   +  G L++I    +         + F+   +A 
Sbjct: 176 LENNVRPKAIVLGNIPKRTGIASILAQIHAGPLENIIVHTDDEQALKKIELDFLTHEAAY 235

Query: 700 QFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIH 759
            F      +   ++G  L   WG  S    K  +      +S +          K K+I+
Sbjct: 236 SFMKYGRTNMFKINGQHLTPEWGKSSEHKTKKGNEWDDQQSSSDDQDFCRSLIMK-KYIN 294

Query: 760 DPQYKKLHET-----LSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISL 813
             +  K  E      L   +  ++++DF T+G+I +I   +S   C  INF N+ SA+  
Sbjct: 295 CTKRTKYSEAYKESPLEPLNLSEIKQDFGTFGEILEITPVVSRKLCISINFFNMESAMKA 354

Query: 814 VEE 816
           ++E
Sbjct: 355 MKE 357

>TPHA0G01080 Chr7 complement(217639..218301) [663 bp, 220 aa] {ON}
           Anc_8.797 YOR319W
          Length = 220

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 650 NRTIYIGNINPRSRAEDICNV-VRGGILQSIKYMPEKRI------CFVTFIEAPSAVQFY 702
           N+T+Y+GNI+P+   + +  + V+   + SIKY  +K +       F+ F      VQ+ 
Sbjct: 11  NKTVYVGNIDPQVTLDILYELFVQVAPISSIKYPKDKVLQAYQGYAFIDFF-TEDDVQYV 69

Query: 703 ANSFIDPIVLHGNMLRVGWGHYS 725
                + + L+G +L+V   +Y+
Sbjct: 70  IKVMNNTVRLYGKLLKVRLSNYA 92

>Kpol_1036.37 s1036 (92633..100114) [7482 bp, 2493 aa] {ON}
           (92633..100114) [7482 nt, 2494 aa]
          Length = 2493

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 272 DCLNFYN----NILQRLSEFKTFLKSESLNLKFVCLNYDFKCLSTFIEDDALT 320
           D L FY     ++++ L E   F  +E     F CL Y FK LS F+ DD +T
Sbjct: 120 DFLKFYEPTVLSLIRLLEEAVKFESTEVFEWGFNCLAYIFKYLSKFLSDDLVT 172

>SAKL0D10098g Chr4 (844371..844835) [465 bp, 154 aa] {ON} similar to
           uniprot|P43594 Saccharomyces cerevisiae YFR011C
           Hypothetical ORF
          Length = 154

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 876 KRPSYNIRLSKLEERRRQNENDKKERAFDKALN---LESLGISLDSHKDI 922
           K  S N RLSKLEER+R N +DK+      AL    LE+ G  L+ ++++
Sbjct: 95  KVASLNERLSKLEERQRSNSSDKETNEVKSALTKCLLENKGKPLNCYEEV 144

>TDEL0B01010 Chr2 complement(189048..189680) [633 bp, 210 aa] {ON}
           Anc_8.797 YOR319W
          Length = 210

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 66/164 (40%), Gaps = 29/164 (17%)

Query: 652 TIYIGNINPRSRAEDICNV-VRGGILQSIKYMPEKRI------CFVTFIEAPSAVQFYAN 704
           T+Y+GNI+P+   E++  + V+   + +I+Y  +K +       FV F   P   Q+   
Sbjct: 11  TVYVGNIDPKVTKENLYELFVQVSPIANIRYPKDKVLQLHQGFAFVEFY-TPEDCQYVVQ 69

Query: 705 SFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYK 764
              + + L+   L+V   +       S ++ VTI     V+V                 K
Sbjct: 70  LLNNTVQLYDRFLKVRKANVQS--SGSDTIDVTIQPIAKVFV-----------------K 110

Query: 765 KLHETLSLPDAEQLREDFSTYGDIEQINYLSDSH--CCWINFMN 806
            L  ++  P   +L   F       +I YLSD    C +I F N
Sbjct: 111 NLDPSIDEPHLSRLFGKFGPLAKGPEIFYLSDGQLRCAYIYFKN 154

>KAFR0G02320 Chr7 complement(483040..484902) [1863 bp, 620 aa] {ON}
           Anc_6.104 YBR212W
          Length = 620

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 40/79 (50%), Gaps = 9/79 (11%)

Query: 647 DVGNRTIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFVTF---IEAPSAVQFY 702
           D  N T+++GN+N +   +++  V    G ++ +K  P K+  FV F   I+A +++   
Sbjct: 318 DPTNTTVFVGNLNCKITEDELQKVFEPFGAIEKVKIPPGKKCGFVKFCNKIDAEASMYGL 377

Query: 703 ANSFIDPIVLHGNMLRVGW 721
              F+      G+ +R+ W
Sbjct: 378 QGYFV-----AGSPIRISW 391

>KLLA0C05522g Chr3 (494240..495862) [1623 bp, 540 aa] {ON} some
           similarities with uniprot|P32831 Saccharomyces
           cerevisiae YBR212W NGR1 negative growth regulatory
           protein
          Length = 540

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 43/84 (51%), Gaps = 9/84 (10%)

Query: 643 SMGSDVGNRTIYIGNINPRSRAEDICNVVRG-GILQSIKYMPEKRICFVTF---IEAPSA 698
           +M + V + T+++G +NP      +  + +  G +  +K  P K+  FV +   +EA +A
Sbjct: 437 AMNAGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQCGFVKYNERLEAEAA 496

Query: 699 VQFYANSFIDPIVLHGNMLRVGWG 722
           +     + +   ++ G+ +R+ WG
Sbjct: 497 I-----NGLQGFIIMGSPIRLSWG 515

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
           SSP2Sporulation specific protein that localizes to the
           spore wall; required for sporulation at a point after
           meiosis II and during spore wall formation; SSP2
           expression is induced midway in meiosis
          Length = 371

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 768 ETLSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNKEST 822
           +TL   D ++L +DF  +G++ +I   +S   C  I F +ISSA+  +EE  ++ +
Sbjct: 290 QTLENIDIQELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGS 345

>TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.466
           YDL209C
          Length = 322

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 12/80 (15%)

Query: 777 QLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVEEMNKESTAHNEDGEMTHKTAT 836
           +LR  FS  G+IE I Y+   +C ++ +   ++A     E  KE+ ++      T  T +
Sbjct: 157 RLRFAFSRLGEIETIRYIEAKNCAFVTYRFQANA-----EFAKEAMSNQ-----TLLTPS 206

Query: 837 EKKFGGRYE--GLLINYGKD 854
           +KK+  R +  GLL+ +  D
Sbjct: 207 DKKWDERKDGTGLLVKWAND 226

>NCAS0B06140 Chr2 complement(1162144..1163475) [1332 bp, 443 aa]
           {ON} Anc_2.306
          Length = 443

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 73/172 (42%), Gaps = 15/172 (8%)

Query: 628 QSLE-QNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICN--VVRGGILQSIKYMPE 684
           QS E Q  +V    A+  G +  +R +Y+GN++ +S  ED+       GG +  +K M +
Sbjct: 59  QSAENQESSVVPASATQGGRETSDRVLYVGNLD-KSINEDLLKQYFQVGGQITDVKIMVD 117

Query: 685 KR-----ICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKS-ISLAVTI 738
           K+       F+ ++++  A    A   ++ I + G  +R+ W   S     S  +  + +
Sbjct: 118 KKNNNVNYAFIEYLKSHDAN--VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFV 175

Query: 739 GASRNVYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQ 790
           G   ++ V + +      F   P Y + H    +         F ++ D EQ
Sbjct: 176 G---DLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQ 224

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
           YOR242C (REAL)
          Length = 370

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 80/182 (43%), Gaps = 10/182 (5%)

Query: 651 RTIYIGNINPRSRAEDICNVVRGGILQSI---KY-MPEKRICFVT--FIEAPSAVQFYAN 704
           R++ I +I   +    + + VRGG L+ I   +Y  PE+ +  V   F+    A  F   
Sbjct: 163 RSVSINDIPRGTGIASVLSQVRGGSLERIVVYRYDTPERSLHKVDLFFLNYDGAQSFMKY 222

Query: 705 SFIDPIVLHGNMLRVGWGHYSGP---LPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDP 761
           +  +   ++G  LR  W         + K  S+   +   + +   L       K I + 
Sbjct: 223 ATTNIFKVNGTHLRPEWIFLESTYENIMKEQSVNRILDEEKLISRCLIVKKSSSKTIVNK 282

Query: 762 QYKKLHETLSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNKE 820
             +   ++L   D ++L +DF  +G++ +I   +S   C  I F +ISSA+  +EE  ++
Sbjct: 283 PSQDKSQSLENIDIQELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEYEQK 342

Query: 821 ST 822
            +
Sbjct: 343 GS 344

>NDAI0C05650 Chr3 (1305925..1307214) [1290 bp, 429 aa] {ON}
           Anc_8.566
          Length = 429

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 13/52 (25%)

Query: 1   MSNQNQRKPVANYAYR-------------QQQDYNGMNAMVGNPIIYHPVDF 39
           M N   R+  +N AY              Q + Y G +   GNP+IYHPV+ 
Sbjct: 79  MKNSTSRESPSNIAYHAYTNNLNMPINSFQPRRYEGQDGFYGNPVIYHPVNI 130

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
           YOR242C (REAL)
          Length = 371

 Score = 32.0 bits (71), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 768 ETLSLPDAEQLREDFSTYGDIEQIN-YLSDSHCCWINFMNISSAISLVEEMNKESTAHN 825
           + L   +  +L +DF  +G+I +I   +S   C  I F +ISSA+  +EE  ++ +  N
Sbjct: 290 QNLETINVRELEKDFQNFGEILEITPIVSRKLCVSIFFYDISSAMRAMEEYEQKGSGLN 348

>Kpol_543.17 s543 (37962..39248) [1287 bp, 428 aa] {ON}
           (37962..39248) [1287 nt, 429 aa]
          Length = 428

 Score = 32.0 bits (71), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 833 KTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRR 892
           + A EK     Y  LL   G+ + GN    L++G NS  Y K+K+      L  L+E   
Sbjct: 12  EVAEEKPLMKSYGSLLAQLGQQQSGN---GLISGNNSDVYLKLKKLEKEYELLTLQEEYI 68

Query: 893 QNENDKKERAFDKA 906
           ++E    +R   +A
Sbjct: 69  KDEQRHLKRELLRA 82

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 117,279,656
Number of extensions: 5352302
Number of successful extensions: 16441
Number of sequences better than 10.0: 155
Number of HSP's gapped: 16907
Number of HSP's successfully gapped: 218
Length of query: 1131
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1011
Effective length of database: 39,721,479
Effective search space: 40158415269
Effective search space used: 40158415269
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)