Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.168.850ON50250224560.0
YML118W (NGL3)8.850ON50549719000.0
Skud_13.238.850ON49846718550.0
Suva_13.258.850ON50246518030.0
KLTH0C03608g8.850ON49547010201e-133
TBLA0B029008.850ON52047110091e-131
NCAS0B002708.850ON4764689871e-129
SAKL0D01166g8.850ON5054839841e-128
TDEL0B001908.850ON4924789811e-127
YMR285C (NGL2)8.850ON5154759761e-126
Kpol_237.18.850ON5034539711e-126
Suva_13.4758.850ON5154759711e-126
ZYRO0C14872g8.850ON4964709691e-126
NCAS0C003108.850ON5564569741e-126
Smik_13.5018.850ON5154769701e-125
Skud_13.4588.850ON5144769621e-124
NDAI0E002608.850ON4984759571e-124
KAFR0L019608.850ON5114739541e-123
Kwal_27.102048.850ON4944729521e-123
TPHA0I003208.850ON5294549541e-123
KLLA0C06248g8.850ON5164789361e-120
NDAI0K003708.850ON5684429331e-119
CAGL0I02684g8.850ON4934739231e-119
KNAG0K006508.850ON4824509051e-116
TBLA0D033008.850ON4804558881e-114
ABL118W8.850ON5044388841e-113
KAFR0A028608.850ON4784838561e-109
KNAG0G034708.850ON4664348371e-106
CAGL0B02387g8.850ON4714498241e-104
Ecym_46198.850ON4874508121e-102
KNAG0D048407.78ON7792191332e-07
SAKL0B10032g7.78ON7312711242e-06
KAFR0K006707.78ON7952651232e-06
Ecym_73547.78ON7852691197e-06
KLTH0D02310g7.78ON7392751198e-06
Kwal_26.71127.78ON7422851181e-05
ACR288W7.78ON7362201181e-05
ZYRO0D05302g7.78ON8572651143e-05
Suva_1.457.78ON8312481118e-05
TDEL0H037307.78ON7972211109e-05
KLLA0F07733g7.90ON3712581081e-04
Skud_1.407.78ON8692691072e-04
YAL021C (CCR4)7.78ON8372681054e-04
Ecym_26367.90ON3672181044e-04
TPHA0H026807.78ON8722321045e-04
Kwal_26.71707.90ON3722551027e-04
SAKL0B09768g7.90ON3682251000.001
CAGL0H06149g7.78ON8732621000.002
Kpol_1044.67.90ON372208980.002
KLTH0D02574g7.90ON368253970.003
NDAI0H025207.78ON898168980.003
KLLA0F15884g7.78ON790247970.003
CAGL0F01001g7.90ON359210960.004
Smik_1.457.78ON839251960.005
Kpol_1040.147.78ON784168930.011
Smik_15.1257.90ON363213900.016
TPHA0L005307.90ON391208900.016
TBLA0A046607.78ON896270900.024
NCAS0I005007.90ON389212890.025
TDEL0H036007.90ON366209870.048
Suva_15.1277.90ON363211850.071
KAFR0D012507.90ON356231810.20
NCAS0F016407.78ON855168810.28
Suva_7.4133.485ON103730705.5
Smik_6.2213.485ON103630706.0
YGR125W3.485ON103630697.1
TBLA0A002703.188ON95739697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.16
         (502 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   950   0.0  
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   736   0.0  
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   719   0.0  
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   699   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   397   e-133
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   393   e-131
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      384   e-129
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   383   e-128
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   382   e-127
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   380   e-126
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   378   e-126
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   378   e-126
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   377   e-126
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      379   e-126
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   378   e-125
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   375   e-124
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   373   e-124
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   372   e-123
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   371   e-123
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   372   e-123
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   365   e-120
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   363   e-119
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   360   e-119
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   353   e-116
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   346   e-114
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   345   e-113
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   334   e-109
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   327   e-106
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   322   e-104
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   317   e-102
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    56   2e-07
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    52   2e-06
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    52   2e-06
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    50   7e-06
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    50   8e-06
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    50   1e-05
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    50   1e-05
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    49   3e-05
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    47   8e-05
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    47   9e-05
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    46   1e-04
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    46   2e-04
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    45   4e-04
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    45   4e-04
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    45   5e-04
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    44   7e-04
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    43   0.001
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    43   0.002
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    42   0.002
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    42   0.003
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      42   0.003
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    42   0.003
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    42   0.004
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    42   0.005
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    40   0.011
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    39   0.016
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    39   0.016
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    39   0.024
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    39   0.025
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    38   0.048
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    37   0.071
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    36   0.20 
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      36   0.28 
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...    32   5.5  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...    32   6.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...    31   7.1  
TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}...    31   7.4  

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/502 (91%), Positives = 461/502 (91%)

Query: 1   MNGQIEHATSTAHKXXXXXXXXXXXXXXXXXHKKIPADQSTIDHIKKIXXXXXXXXXXXX 60
           MNGQIEHATSTAHK                 HKKIPADQSTIDHIKKI            
Sbjct: 1   MNGQIEHATSTAHKEFFSTSNISSSSEDDITHKKIPADQSTIDHIKKIREERAERRQRCR 60

Query: 61  NSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQ 120
           NSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQ
Sbjct: 61  NSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQ 120

Query: 121 TLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELKFWRENFHKLGFDL 180
           TLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELKFWRENFHKLGFDL
Sbjct: 121 TLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELKFWRENFHKLGFDL 180

Query: 181 SFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT 240
           SFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT
Sbjct: 181 SFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT 240

Query: 241 RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIKDFPKYHGWHSLLMGDFNTEP 300
           RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIKDFPKYHGWHSLLMGDFNTEP
Sbjct: 241 RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIKDFPKYHGWHSLLMGDFNTEP 300

Query: 301 EEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQP 360
           EEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNG            NSRGERNLNQP
Sbjct: 301 EEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDEDYDENSRGERNLNQP 360

Query: 361 KNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENANEGHGEPELSNW 420
           KNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENANEGHGEPELSNW
Sbjct: 361 KNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENANEGHGEPELSNW 420

Query: 421 ANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEG 480
           ANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEG
Sbjct: 421 ANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEG 480

Query: 481 EYASDHISLMCQIRLFWREDHT 502
           EYASDHISLMCQIRLFWREDHT
Sbjct: 481 EYASDHISLMCQIRLFWREDHT 502

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/497 (71%), Positives = 392/497 (78%), Gaps = 1/497 (0%)

Query: 1   MNGQIEHATSTAHKXXXXXXXXXXXXXXXXXHKKIPADQSTIDHIKKIXXXXXXXXXXXX 60
           M+ Q+E   S + K                 H+KI  DQ ++D IKKI            
Sbjct: 1   MDSQVEGKISPSQKESSSTSGLVSPSEDGPAHQKIHRDQLSVDQIKKIREERAQKRQVRR 60

Query: 61  NSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQ 120
           NSLISQGKDPDFPTPDLQFIERP L I+ + N+     + IQ T  SLD+KIMTYNTLAQ
Sbjct: 61  NSLISQGKDPDFPTPDLQFIERPFLPINHD-NSKGLTPATIQVTQDSLDVKIMTYNTLAQ 119

Query: 121 TLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELKFWRENFHKLGFDL 180
           TLIRRDFFP+SG ALKWHKRSKVLVHELK Y PD+VSLQEVDYNEL FW+ENFHKLGFD+
Sbjct: 120 TLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNELNFWQENFHKLGFDV 179

Query: 181 SFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT 240
            F+R+ GKTHGLLVAWNN+KFQLDN+WMLDYD ILAGNVISARTRTKNIALI+SL FK  
Sbjct: 180 IFKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKGI 239

Query: 241 RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIKDFPKYHGWHSLLMGDFNTEP 300
            ++S+ GI+VANTHLFWHPFGVFERLRQSYLVLQKIQEIK   KY+GWHSLLMGDFNTEP
Sbjct: 240 TDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEIKACSKYNGWHSLLMGDFNTEP 299

Query: 301 EEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQP 360
           EEPPYLAIT +PL L G  RAMVECSLAYRYSKKRNG             SRGE + +QP
Sbjct: 300 EEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESDQDDEECDEKSRGEGHSDQP 359

Query: 361 KNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENANEGHGEPELSNW 420
           +NPKP+ F ATKEEK LVNQL+ LHNSLHVKG+SLYG+GYGKVHPENAN  HGEP LSNW
Sbjct: 360 QNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENANGSHGEPGLSNW 419

Query: 421 ANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEG 480
           ANTWCGLLDYIFYIE D N   +Q++ LN FE NN V +IGYLRMPC QEMPKHSQPFEG
Sbjct: 420 ANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQEMPKHSQPFEG 479

Query: 481 EYASDHISLMCQIRLFW 497
           EYASDHISLMCQIRLF+
Sbjct: 480 EYASDHISLMCQIRLFF 496

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/467 (73%), Positives = 384/467 (82%), Gaps = 2/467 (0%)

Query: 32  HKKIPADQSTIDHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEK 91
           H+KI       DHIKKI            NSLISQGKDPDFPTPDLQFIERP LH+  E 
Sbjct: 34  HQKIFRCPLADDHIKKIREERAQRRQSRRNSLISQGKDPDFPTPDLQFIERPFLHVYREV 93

Query: 92  NANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTY 151
            + D K+S +Q   SSLD++IMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTY
Sbjct: 94  -SQDSKTSGMQVPPSSLDVQIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTY 152

Query: 152 TPDIVSLQEVDYNELKFWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDY 211
            PDIVSLQEVDYNEL FW ENFHKLGF  +FRR+ GKTHGL+VAWNNEKFQ DNEWMLDY
Sbjct: 153 KPDIVSLQEVDYNELGFWHENFHKLGFGSTFRRHEGKTHGLMVAWNNEKFQQDNEWMLDY 212

Query: 212 DQILAGNVISARTRTKNIALIVSLRFKDTRNASTNGIVVANTHLFWHPFGVFERLRQSYL 271
           D ILAGN ISARTRTKNIALIVSL  K+  N ST+G++VANTHLFWHPFGVFERLRQS+L
Sbjct: 213 DTILAGNAISARTRTKNIALIVSLSVKNMTNLSTSGVIVANTHLFWHPFGVFERLRQSFL 272

Query: 272 VLQKIQEIKDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRY 331
           VL+KI+EIK  PKY+GWHSLLMGDFNTEPEEPPY+AIT +PLTLTGS RAM ECSLAYRY
Sbjct: 273 VLKKIEEIKTCPKYYGWHSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMTECSLAYRY 332

Query: 332 SKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVK 391
           SK RNG             S GE   +QP+NPKPK+F ATKE+K+LVNQL+ LHNSLHVK
Sbjct: 333 SKMRNG-EESDQDEECDEESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVALHNSLHVK 391

Query: 392 GISLYGLGYGKVHPENANEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVF 451
           GISLYGL YGKVHP+N+ E HGEPELSNWANTWCGLLDYIFYIE +DN S+ +++ +  F
Sbjct: 392 GISLYGLSYGKVHPDNSKENHGEPELSNWANTWCGLLDYIFYIERNDNVSSSKDEPVKNF 451

Query: 452 EENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRLFWR 498
           E+ N V +IGYLRMP  +EMPKHSQPFEGEYASDHISLMCQ+RLFW+
Sbjct: 452 EDQNNVKIIGYLRMPRAEEMPKHSQPFEGEYASDHISLMCQLRLFWQ 498

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/465 (70%), Positives = 374/465 (80%), Gaps = 5/465 (1%)

Query: 32  HKKIPADQSTIDHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEK 91
           H+KIP  Q T + +KKI            NSLISQGKDPDFPTPDLQFI+RP LH+  E 
Sbjct: 34  HQKIPRHQLTKEQVKKIREERAQKRQSRRNSLISQGKDPDFPTPDLQFIKRPFLHLHHE- 92

Query: 92  NANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTY 151
                     ++T +SLD+KIMTYNTLAQTLIRR+FFPQSGSALKWHKRSKVLVHELKTY
Sbjct: 93  ----IAQGSTESTPNSLDVKIMTYNTLAQTLIRRNFFPQSGSALKWHKRSKVLVHELKTY 148

Query: 152 TPDIVSLQEVDYNELKFWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDY 211
            PDIVSLQEVDYNELKFW+ENF KLGFDL+F+R+ GKTHGLL+AWN+ KFQL+NEWMLDY
Sbjct: 149 KPDIVSLQEVDYNELKFWQENFRKLGFDLTFKRHDGKTHGLLIAWNSGKFQLENEWMLDY 208

Query: 212 DQILAGNVISARTRTKNIALIVSLRFKDTRNASTNGIVVANTHLFWHPFGVFERLRQSYL 271
           D ILAGN I ARTRTKNIALI SLR K+  + ST+G++VANTHLFWHPFGVFERLRQSYL
Sbjct: 209 DNILAGNAIPARTRTKNIALIASLRLKNISDPSTDGVIVANTHLFWHPFGVFERLRQSYL 268

Query: 272 VLQKIQEIKDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRY 331
           VL KIQEIK  PKY+GWHS+LMGDFNTEPEEPPYLAIT KP+ LTGS R M ECSLAYRY
Sbjct: 269 VLAKIQEIKACPKYNGWHSVLMGDFNTEPEEPPYLAITRKPVALTGSARVMAECSLAYRY 328

Query: 332 SKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVK 391
           SKKRNG             SRGE   NQP+NPKPK F AT E+K LV+QL+ LHNSLHV+
Sbjct: 329 SKKRNGEEGGQDDEECDEQSRGEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVR 388

Query: 392 GISLYGLGYGKVHPENANEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVF 451
           G+SLYGLGYGKV PEN++E +GEPELSNWAN+WCGLLDYIFYIE  D +SA  +  ++ F
Sbjct: 389 GVSLYGLGYGKVQPENSHESNGEPELSNWANSWCGLLDYIFYIEHSDEHSAHDQNPVDDF 448

Query: 452 EENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRLF 496
           E  N + V+GYL+MP  +EMPKHSQPFEGEYASDH+SLMCQ+R  
Sbjct: 449 ENKNNLRVMGYLKMPRAKEMPKHSQPFEGEYASDHVSLMCQLRFL 493

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  397 bits (1020), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 199/470 (42%), Positives = 285/470 (60%), Gaps = 35/470 (7%)

Query: 43  DHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQ 102
           +HI ++              +I++G DPDFP PDLQFI RP+L ++  +NAN F      
Sbjct: 42  EHIAEVRAQREAAKKKKREDMIARGLDPDFP-PDLQFIHRPMLSLNPSENANGFV----- 95

Query: 103 ATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVD 162
                   K+MTYN LAQ LIRR  FP SG+ALKW KRS+VL++E   Y  D++ LQEVD
Sbjct: 96  -------FKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVD 148

Query: 163 YNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVIS 221
           Y + + FW+E F KLG++  F R+G K HG+ + W  + F + ++ ++DYD+  +G  + 
Sbjct: 149 YIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSG-ALE 207

Query: 222 ARTRTKNIALIVSLRFKDT-----RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKI 276
            RT TKN+ L ++L F          +S  GI+V  THLFWHPFG FER RQ Y++L K+
Sbjct: 208 PRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKM 267

Query: 277 QEI---------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSL 327
           +E          K   + + W+    GDFN++P + PYL+++SKP+T  G  + ++ECS 
Sbjct: 268 KEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECST 327

Query: 328 AYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNS 387
           +Y +SK R+G                     QP++P P+ F+AT+E+K LV  + +LHNS
Sbjct: 328 SYTFSKARDGEECDDEEGGNIEKF----GDGQPEHPVPEKFSATEEQKGLVESMASLHNS 383

Query: 388 LHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQE 445
           L ++GIS+Y +GY  VH ENA  +    EPE+SNWA TW GLLDYIF+I+  D +     
Sbjct: 384 LDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASP 443

Query: 446 KSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
           + L  F++ NG+ + G LRMP  +EMP H QP EGEY SDH+S+MC++ L
Sbjct: 444 EELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELEL 493

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  393 bits (1009), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 197/471 (41%), Positives = 289/471 (61%), Gaps = 36/471 (7%)

Query: 43  DHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQ 102
           +HI ++            ++L++QG DPD P  +LQFI+RP+L +   +    FK S   
Sbjct: 66  EHIAQVRAKREAARKAKRDALLAQGIDPDCPK-ELQFIKRPILQMHENEPVKGFKFS--- 121

Query: 103 ATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVD 162
                    +MTYN LAQ LIRR  FP+ G ALKWH+RSKVL++E K Y PDI+ LQE+D
Sbjct: 122 ---------LMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEID 172

Query: 163 YNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVIS 221
           + + + FW+E F KLG++  F +   K HG+ V W  E F++ +  ++DYD+ L+G+ I 
Sbjct: 173 HVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGD-IE 231

Query: 222 ARTRTKNIALIVSLRFKDT------RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQK 275
            RT T NIAL++SL+F         +N +  GI++  THLFWHPFG +ER RQ Y++L K
Sbjct: 232 PRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNK 291

Query: 276 IQEIKDF---------PKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECS 326
           ++E  D            +  W+    GDFN++P + PYL++TSKP+  +G ++ ++ECS
Sbjct: 292 MKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECS 351

Query: 327 LAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHN 386
            ++++SKKR+G                +   +QP++P P  + A  E+K LV ++  LHN
Sbjct: 352 TSFKFSKKRDGEEGDDEEGGNIE----KFGKDQPQHPVPDDYQANDEQKLLVTKMQELHN 407

Query: 387 SLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQ 444
           SL ++ ISLY  GY KVHPEN+  +    EPE+SNWA+ W GLLDY+FYI+S D    ++
Sbjct: 408 SLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKE 467

Query: 445 EKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
             SL  FE  N + + GYLRMP  +E+P H QPFEGEY SDH+ ++C++ L
Sbjct: 468 IDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVEL 518

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  384 bits (987), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 201/468 (42%), Positives = 285/468 (60%), Gaps = 29/468 (6%)

Query: 43  DHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQ 102
           ++I +I             S + QG DPD P P+LQF  RP L +   +  N        
Sbjct: 21  EYISEIRKQRANKWQRIRESRMQQGLDPDIP-PELQFQRRPFLTLHDNEPDNG------- 72

Query: 103 ATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVD 162
              S  +  I+TYN LAQ LI RD FP+SG+ALKW +RSK +++ELK Y PDI+ LQE+D
Sbjct: 73  --ESKHEFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEID 130

Query: 163 YNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVIS 221
           +  +K FW   F  LG+   F +   K HG+++AW +  F+  ++  +D+D++LAG+ I 
Sbjct: 131 FKYVKEFWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGD-IP 189

Query: 222 ARTRTKNIALIVSLRFKDTRN----ASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQ 277
            RT+T+NI LIV+L+F D  N      ++GIVVA THLFWHPFG FER RQ YL+L ++ 
Sbjct: 190 PRTKTRNIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFGTFERTRQCYLMLSEMN 249

Query: 278 EIKDFPKYHG----WHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSK 333
           +   F   H     W+  L GDFN++P++ PY+++T+KP+      R ++ECS +Y YSK
Sbjct: 250 KFLSFLNEHSGITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSK 309

Query: 334 KRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGI 393
           KRNG                E    QP +P+P  F  TKE+  LVN +  LHNSL  + I
Sbjct: 310 KRNGDMDVNEKEQSDSEEDEEFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAI 369

Query: 394 SLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIES----DDNNSAQQEKS 447
           SLY +GY  VHPEN+  N   GEPE S+W   W GLLDYIFYI++    D N+  +   +
Sbjct: 370 SLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVE---T 426

Query: 448 LNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
           L  FE+ N + ++G+L++P ++EM  HSQP+EGEY SDH++LMC+++L
Sbjct: 427 LETFEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQL 474

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  383 bits (984), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 205/483 (42%), Positives = 288/483 (59%), Gaps = 43/483 (8%)

Query: 34  KIPADQSTIDHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNA 93
           K P  + + +HI +              ++++ G DP+ P PDLQFI+RPLL +  E+  
Sbjct: 43  KKPPKEISPEHIAEKRAQREAARAAKREAMLAHGLDPNVP-PDLQFIKRPLLCLHEEEPV 101

Query: 94  NDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTP 153
             FK             KIMTYN LAQ LIRR  FP SG+A+KW KRSKVL++E K Y  
Sbjct: 102 KGFK------------FKIMTYNALAQALIRRKLFPSSGNAVKWFKRSKVLLNEFKHYDA 149

Query: 154 DIVSLQEVDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYD 212
           D+  LQE+D+ + + FW+E F KLG+   F R G K HG+ + W    F + +  ++DYD
Sbjct: 150 DVHCLQEIDHIQYQAFWKEEFQKLGYASQFHRIGTKNHGVAIVWRCSLFTMVDTMLVDYD 209

Query: 213 QILAGNVISARTRTKNIALIVSLRFKDT-----RNASTNGIVVANTHLFWHPFGVFERLR 267
           +  +G+ I  RT TKN  LI++L+F D           +GI++  THLFWHPFG FER R
Sbjct: 210 KEPSGD-IPPRTTTKNAGLILALKFTDKVLNQFPGTKKSGILIGTTHLFWHPFGTFERTR 268

Query: 268 QSYLVLQKIQEI------------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTL 315
           Q Y+VL K++E+            +D   Y  W+  + GDFN++P + PYL++TSKP+T 
Sbjct: 269 QCYVVLNKMKELIHRVNVLQNNQDRD---YSHWYPFICGDFNSQPFDTPYLSMTSKPVTY 325

Query: 316 TGSTRAMVECSLAYRYSKKRNGXXXXXXXXXXXXN-SRGERNLNQPKNPKPKHFAATKEE 374
            G  + ++ECS ++ +SK R+G               +G     QP++P PK F AT+E+
Sbjct: 326 RGRAKTVIECSTSFTFSKLRDGEEGEDEEGGNIEKFGKG-----QPEHPVPKEFHATEEQ 380

Query: 375 KDLVNQLITLHNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIF 432
             LV Q+ +LHNSL ++ ISLY +GY  VHPENA  +   GEPE+SNWA TW GLLDYIF
Sbjct: 381 TALVKQMESLHNSLDMRAISLYAVGYKHVHPENAGLDNDSGEPEISNWAETWRGLLDYIF 440

Query: 433 YIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQ 492
           ++++ +         ++VFE  NG+ + G LRMP  +EM KH QP EGEY SDH+S+MC+
Sbjct: 441 FVKNWNGTDRSSVDKIDVFERENGIKIRGLLRMPPGEEMTKHGQPHEGEYPSDHLSMMCE 500

Query: 493 IRL 495
           I L
Sbjct: 501 IEL 503

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  382 bits (981), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 201/478 (42%), Positives = 282/478 (58%), Gaps = 36/478 (7%)

Query: 36  PADQSTIDHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNAND 95
           P  + + +H+ K+              ++++G DPD P P+LQFI+RPLL +  ++    
Sbjct: 31  PRKEMSPEHVAKVRAEREAARKAKREEMLAKGMDPDHP-PELQFIKRPLLTLHEDEPIE- 88

Query: 96  FKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDI 155
                       L  K++TYN LAQ LIRR  FP SG +LKW +RSKVL +E K Y  D+
Sbjct: 89  -----------GLSFKLLTYNCLAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADV 137

Query: 156 VSLQEVDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQI 214
           + LQE+DY + + FW++   KLG+D  F +   K HG+ +AW    FQL +  ++DYD+ 
Sbjct: 138 LCLQEIDYIQYQQFWKDELDKLGYDTQFYKQPCKNHGVSIAWKRHLFQLTDRMLIDYDKE 197

Query: 215 LAGNVISARTRTKNIALIVSLRFKDTRNAST-----NGIVVANTHLFWHPFGVFERLRQS 269
            +G  I  RT T N  LI++L+F D    S      +GI+V  +HLFWHPFG +ER RQ 
Sbjct: 198 SSGK-IEKRTLTHNSGLILALKFTDAAKQSCPHIRKSGILVGTSHLFWHPFGTYERTRQC 256

Query: 270 YLVLQKIQEI----------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGST 319
           Y+VL+K++E            D    H W     GDFN++P + PYL++TSKP+  TG  
Sbjct: 257 YVVLKKMKEFMKRVNVLQNNNDGNLSH-WVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRA 315

Query: 320 RAMVECSLAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVN 379
           + +VECS +Y +SK RNG               G+   +QP+ P P+ F AT E++ LV 
Sbjct: 316 KTVVECSTSYTFSKLRNGEEDAEDEEGGNIEKFGK---DQPQTPVPETFDATPEQQKLVE 372

Query: 380 QLITLHNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIESD 437
           ++  LHNS+ ++ ISLY +GYG+VHPEN+  +   GEPE+SNWANTW GLLDYI  I   
Sbjct: 373 EMQELHNSIDMRAISLYAVGYGEVHPENSGIDNDRGEPEMSNWANTWRGLLDYILLITQW 432

Query: 438 DNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
           D++  ++  SL  FE+ N + + G LRMP   EM  H QP EGEYASDH+S+MC I L
Sbjct: 433 DSSDRKKVDSLETFEKENSLKLRGLLRMPPASEMSHHGQPHEGEYASDHLSMMCTIEL 490

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  380 bits (976), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 191/475 (40%), Positives = 286/475 (60%), Gaps = 37/475 (7%)

Query: 41  TIDHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSF 100
           T +HI K+            +++++QG DPD P P+L FI RP L +   +    F+   
Sbjct: 56  TPEHIAKVRAEREVMRKAKRDAMLAQGVDPDCP-PELHFIRRPFLSLHEAEPVTGFR--- 111

Query: 101 IQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQE 160
                     K+MTYN LAQ LIRR  FP SG ALKW++RSKVL++E K Y  D++ LQE
Sbjct: 112 ---------FKLMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFKYYNSDVICLQE 162

Query: 161 VDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219
           +D+ + + FW++ F KLG+D  + RN  K HG+ + W  E F   ++ ++DYD+  +   
Sbjct: 163 IDHIQFQSFWKDEFSKLGYDGQYYRNATKNHGVAIMWRRELFHQVDKMLIDYDK-ESSES 221

Query: 220 ISARTRTKNIALIVSLRFKD-------TRNASTNGIVVANTHLFWHPFGVFERLRQSYLV 272
           IS RT T N+ L+++L+F +        +++   GI++  THLFWHPFG +ER RQ Y+V
Sbjct: 222 ISTRTTTNNVGLVLALKFSEKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIV 281

Query: 273 LQKIQEI---------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMV 323
           L+K++E          ++      W     GDFN++P + PYL++TSKP+      + ++
Sbjct: 282 LKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVI 341

Query: 324 ECSLAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLIT 383
            CS +Y++SK R+G               G+   +QP++P P+ F A +E+ +LV+++  
Sbjct: 342 GCSTSYKFSKVRDGEEGADDEEGGNIEKYGK---DQPESPVPEKFHANEEQSELVDKMAQ 398

Query: 384 LHNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIES-DDNN 440
           LHNSL ++ ISLY +GY  VHPENA  +   GEPE+SNWANTW GLLDY+FY++  D  +
Sbjct: 399 LHNSLDMRAISLYSVGYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQS 458

Query: 441 SAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
           + Q+ ++L  FE+ N V   G+LRMP   EM KH QP  GEYASDH+S++C + L
Sbjct: 459 NCQEVETLGDFEKENKVKCRGFLRMPPGNEMTKHGQPHVGEYASDHLSMVCDLEL 513

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  378 bits (971), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 190/453 (41%), Positives = 275/453 (60%), Gaps = 37/453 (8%)

Query: 63  LISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTL 122
           L+++G DPD+P P+LQFI+RP+LH+  ++    F            +  +MTYN LAQ L
Sbjct: 68  LLAKGLDPDYP-PELQFIKRPMLHLHQDEPVTGF------------NFTLMTYNCLAQAL 114

Query: 123 IRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLS 181
           IRR  FP SG A+KW +RSKVL++E + Y  D++ LQE+D+ + + FW+  F KLG++  
Sbjct: 115 IRRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQ 174

Query: 182 FRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT- 240
           F R   K HG+ + W  E F++ +  ++D+D+  + + I  RTRT N  LI+SL+F D  
Sbjct: 175 FHRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSD-IPPRTRTNNTGLILSLKFSDKI 233

Query: 241 -----RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI----------KDFPKY 285
                +N  T GI++  THLFWHPFG +ER RQ Y++L K++E            D    
Sbjct: 234 LSTLPKNTKTTGIIIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLS 293

Query: 286 HGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGXXXXXXXX 345
           H W     GDFN++P + PYL++TSKP+  T   + +++CS +Y++SK RNG        
Sbjct: 294 H-WVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNGEEDVDDEE 352

Query: 346 XXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHP 405
                  G+   +QP+ P P+ F A +E+  LV ++  +HN L ++  SLY +GY  VH 
Sbjct: 353 GGNIEKFGK---DQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHA 409

Query: 406 ENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYL 463
           ENA  +   GEP +SNWANTW GLLDYIF++ + D ++ Q   SL  FE  N + + G+L
Sbjct: 410 ENAGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFL 469

Query: 464 RMPCKQEMPKHSQPFEGEYASDHISLMCQIRLF 496
           RMP   EMPKH QP EGEYASDH+S++C I L 
Sbjct: 470 RMPLDSEMPKHGQPHEGEYASDHLSMICNIELL 502

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  378 bits (971), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 190/475 (40%), Positives = 291/475 (61%), Gaps = 37/475 (7%)

Query: 41  TIDHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSF 100
           T +HI K+            +S+++QG DPD P P+L FI+RP L +  E+    F+   
Sbjct: 56  TPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCP-PELHFIKRPFLSLHEEEPVTGFR--- 111

Query: 101 IQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQE 160
                     K+MTYN LAQ LIRR  FP SG ALKW++RS+VL++E + Y  D++ LQE
Sbjct: 112 ---------FKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQE 162

Query: 161 VDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219
           +D+ + + FW+E F KLG++  + RN  K HG+ + W  + FQ  ++ ++D+D+ ++GN 
Sbjct: 163 IDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGN- 221

Query: 220 ISARTRTKNIALIVSLRFKD-------TRNASTNGIVVANTHLFWHPFGVFERLRQSYLV 272
           I  RT T N+ L+++L+F +         ++  +GI++  +HLFWHPFG +ER RQ Y+V
Sbjct: 222 IPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIV 281

Query: 273 LQKIQEI---------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMV 323
           L+K++E          ++      W     GDFN++P + PYL++T KP+      + ++
Sbjct: 282 LKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVI 341

Query: 324 ECSLAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLIT 383
           ECS ++++SK R+G               G+   +QP++P PK F A +E+ +LV+++  
Sbjct: 342 ECSTSFKFSKVRDGEEGADEEEGGNIEKFGK---DQPESPVPKDFHANEEQIELVDEMAQ 398

Query: 384 LHNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIES-DDNN 440
           LHNSL ++ +SLY + Y  VHPENA  +   GEPE+SNWANTW GLLDY+FYI+  D  +
Sbjct: 399 LHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRS 458

Query: 441 SAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
           + Q+  SL+ FE++N +   G+LRMP   EM KH QP  GEYASDH+S++C I L
Sbjct: 459 NCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIEL 513

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  377 bits (969), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 194/470 (41%), Positives = 280/470 (59%), Gaps = 34/470 (7%)

Query: 43  DHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQ 102
           +HI K+             ++++QG DPDFP P+LQFI+RP+L +   +N   FK     
Sbjct: 42  EHIAKVRAEREAARAAKKEAMMAQGIDPDFP-PELQFIKRPILPLHKGENVEGFK----- 95

Query: 103 ATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVD 162
                   K+MTYN LAQ LIRR  FP SG ALKW++RSKVL++E K Y  D++ LQE+D
Sbjct: 96  -------FKLMTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEID 148

Query: 163 YNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVIS 221
           Y + + FW++   KLG+D  F R   K HG+ + W  E F + ++ ++D+D+  +G+ I 
Sbjct: 149 YIQYQSFWKDELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGD-IP 207

Query: 222 ARTRTKNIALIVSLRFKDT----RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQ 277
            RT T N  LI+SL+F D      N    GI+V  THLFWHPFG FER RQ Y+VL K++
Sbjct: 208 PRTTTNNAGLILSLKFSDKVAQEHNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVK 267

Query: 278 EIK----------DFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSL 327
           E            D    H W+    GDFN++P + PYL++T KP+  +   + ++ECS 
Sbjct: 268 EFSHRVNVLQNGNDGDHSH-WYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECST 326

Query: 328 AYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNS 387
           +Y +SK R+G              +     +QP +P P+H+ A   E++LV Q+ +LHNS
Sbjct: 327 SYTFSKMRDGEEDDAEEEEGGNIEKF--GTDQPDHPVPQHYEAKDHERELVEQMQSLHNS 384

Query: 388 LHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQE 445
           L ++ +SLY + Y KVHPENA  +   GEPE+SNWA+TW GLLDY+F+I   D +  ++ 
Sbjct: 385 LDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEI 444

Query: 446 KSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
            SL  FE  N + + G LR+P  +EM +H QP  GEY SDH+ ++C++ L
Sbjct: 445 DSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELEL 494

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  379 bits (974), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 202/456 (44%), Positives = 275/456 (60%), Gaps = 39/456 (8%)

Query: 62  SLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQT 121
           + ++QG DP+   PDLQFI+RP+LH+  E+    FK            I IMTYN LAQ 
Sbjct: 119 AALAQGLDPN-ALPDLQFIQRPILHLHEEEPVTGFK------------ISIMTYNCLAQA 165

Query: 122 LIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDL 180
           LIRR  FP SG ALKW KRSKVL +E K Y PD++ LQE+D+ + + FW+  F K+G++ 
Sbjct: 166 LIRRKLFPDSGDALKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYES 225

Query: 181 SFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRF--- 237
            F R   K HG+ + W  E F L ++ ++D+D+  +G  I  RT T N  L +SL+F   
Sbjct: 226 QFHRKQSKNHGVAIIWRKELFTLTDKMLIDFDKEPSGE-IPPRTTTNNAGLALSLKFTEK 284

Query: 238 ---KDTRNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI----------KDFPK 284
              K +   S  GI+V  THLFWHPFG +ER RQ Y+VL K++E            D   
Sbjct: 285 ALSKFSNGTSRMGIIVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDT 344

Query: 285 YHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGXXXXXXX 344
            H W+    GDFN++P + PYL++TSKP+   G  + ++ECS +Y++SKKR+G       
Sbjct: 345 SH-WYPFFCGDFNSQPFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRDGEEDADEE 403

Query: 345 XXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVH 404
                   G+   +QP+ P P HF A +E+K LV  +  LHNSL ++ ISLYG+GY KVH
Sbjct: 404 EGGNIEKFGK---DQPQTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVH 460

Query: 405 PENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGY 462
           PENA  +   GEPE+SNWA+TW GLLDYI +I+    +  Q   +L  FE+ N + V GY
Sbjct: 461 PENAGLDNDCGEPEISNWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGY 520

Query: 463 LRMPCKQEMPK--HSQPFEGEYASDHISLMCQIRLF 496
           LRMP   EM K  H QP  GEY SDH+S++C++ L 
Sbjct: 521 LRMPPSTEMSKHGHGQPHTGEYPSDHLSMICELELI 556

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  378 bits (970), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 193/476 (40%), Positives = 293/476 (61%), Gaps = 39/476 (8%)

Query: 41  TIDHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSF 100
           T +HI KI            +++++QG DPD P P+L FI+RP L +  ++    F+   
Sbjct: 56  TPEHIAKIRAERDAMRKAKRDAMLAQGVDPDCP-PELHFIKRPFLVLHEKEPVTGFR--- 111

Query: 101 IQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQE 160
                     K+MTYN LAQ LIRR  FP SG ALKW++RS+VL++E K Y  D++ LQE
Sbjct: 112 ---------FKLMTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFKYYKADVICLQE 162

Query: 161 VDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219
           +D+ + + FW++ F+KLG+D  + RN  K HG+ + W  E FQ  ++ ++DYD+  + N 
Sbjct: 163 IDHIQFQSFWKDEFNKLGYDGQYYRNSTKNHGVAIMWRREMFQQVDKMLIDYDKETSEN- 221

Query: 220 ISARTRTKNIALIVSLRFKD-------TRNASTNGIVVANTHLFWHPFGVFERLRQSYLV 272
           IS RT T N+ L+++L+F +         ++   GI++  THLFWHPFG +ER RQ Y+V
Sbjct: 222 ISTRTTTNNVGLVLALKFSEKVLSNLSKSSSKKCGILIGTTHLFWHPFGTYERTRQCYVV 281

Query: 273 LQKIQEI----------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAM 322
           L+K++E            D    H W     GDFN++P + PYL++TSKP+      + +
Sbjct: 282 LKKMKEFMHRVNVLQNENDGDLSH-WFPFFCGDFNSQPFDTPYLSMTSKPVHYKNRAKTV 340

Query: 323 VECSLAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLI 382
           +ECS ++++SK R+G               G+   +QP++P P+++ A +E+ +LV+++ 
Sbjct: 341 IECSTSFKFSKARDGDESADDEEGGNIEKYGK---DQPESPVPENYHANEEQIELVDKMA 397

Query: 383 TLHNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIES-DDN 439
            LHNSL ++ ISLY +GY  VHPENA  +   GEPE+SNWANTW GLLDY+FY++  D  
Sbjct: 398 QLHNSLDMRAISLYSVGYRNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLR 457

Query: 440 NSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
           ++ Q+ ++L  FE+ N +   G+LRMP  +EM KH QP  GEYASDH+S++C + L
Sbjct: 458 SNCQEVENLGDFEKVNEMKCRGFLRMPPGKEMTKHGQPHVGEYASDHLSMVCDLEL 513

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  375 bits (962), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 192/476 (40%), Positives = 289/476 (60%), Gaps = 39/476 (8%)

Query: 41  TIDHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSF 100
           T +HI K+            +++++ G DPD P P+L FI+RPLL +   +    F+   
Sbjct: 55  TPEHIAKVRAEREAMRKAKRDAMLAHGVDPDCP-PELHFIQRPLLSLGEGEPVTGFR--- 110

Query: 101 IQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQE 160
                     K+MTYN LAQ LIRR  FP SG ALKW +RSKVL++E K Y  D++ LQE
Sbjct: 111 ---------FKLMTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQE 161

Query: 161 VDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219
           VD+ + + FW+  F+K+G+D  + RN  K HG+ + W    FQ  ++ ++DYD+  +G++
Sbjct: 162 VDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSI 221

Query: 220 ISARTRTKNIALIVSLRFKD-------TRNASTNGIVVANTHLFWHPFGVFERLRQSYLV 272
           ++ RT T N+ L+++L+F          +++   GI++  THLFWHPFG +ER RQ Y+V
Sbjct: 222 LT-RTTTNNVGLVLALKFSKEVLSKLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYVV 280

Query: 273 LQKIQEI----------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAM 322
           L+K++E            D    H W     GDFN++P + PYL++TSKP+      + +
Sbjct: 281 LRKMKEFMHRVNVLQNDNDGDLSH-WFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTV 339

Query: 323 VECSLAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLI 382
           +ECS ++++SK R+G               G+   +QP++P P++F A  E+ ++V+ ++
Sbjct: 340 IECSTSFKFSKVRDGEEGADDEEGGNIEKFGK---DQPESPVPENFHANDEQIEIVDDMV 396

Query: 383 TLHNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNN 440
            LHNSL ++ ISLY +GY  VHPENA  +   GEPE+SNWANTW GLLDY+FYI+  D  
Sbjct: 397 QLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQ 456

Query: 441 SAQQE-KSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
           S +QE ++L+ FE+ N +   G+LRMP   EM KH QP  GEY SDH+S++C + L
Sbjct: 457 SNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLEL 512

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  373 bits (957), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 195/475 (41%), Positives = 281/475 (59%), Gaps = 35/475 (7%)

Query: 43  DHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQ 102
           ++I KI               +  G +PD P+ +LQFI+RPLL +  +   +  K + + 
Sbjct: 37  EYITKIRAEREKKRELEREYRMKHGFEPDIPS-ELQFIKRPLLTLHDD---DPVKGTML- 91

Query: 103 ATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVD 162
                   KIMTYN LAQ+LI+RD FP SG ALKW +RSKVL++ELK Y  D++SLQE+D
Sbjct: 92  --------KIMTYNCLAQSLIQRDLFPGSGQALKWVRRSKVLLNELKYYDSDLLSLQEID 143

Query: 163 YNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVIS 221
           + + K +W+    KLG+D  F +  GK HG+L+AW    F       +D+D+ L+G  I 
Sbjct: 144 FVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKRNLFAKVKSLPIDFDETLSG-TIK 202

Query: 222 ARTRTKNIALIVSLRF--KDTRNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQE- 278
            RTRTKN+ L+++L F  KD       G+++  THLFWH FG FER RQ Y+++ ++ + 
Sbjct: 203 PRTRTKNVGLVIALEFLNKDKSAIKKKGVIIGTTHLFWHLFGTFERTRQCYVMMDQMDKF 262

Query: 279 IKDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKR--- 335
           +K       W+    GDFN++P++ PY++ITSKP++    T+ ++ECS AY+YSKKR   
Sbjct: 263 MKKLGGIEKWYPFFTGDFNSQPKDAPYVSITSKPVSFQNETKIVIECSAAYKYSKKRNGE 322

Query: 336 -----------NGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITL 384
                      +               + E   NQP N +P HF  T+E+ +LV+QL  L
Sbjct: 323 EEEKNEGKEKQHEIDSSDSSDAETDEEKEEIIPNQPSNARPLHFTPTREQAELVSQLAAL 382

Query: 385 HNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIES-DDNNS 441
           HNSL+++ ISLY +GY KV PENA  N   GEPELS WA  W GLLDYIF+++  D   +
Sbjct: 383 HNSLNLRAISLYSVGYRKVDPENAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTN 442

Query: 442 AQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRLF 496
            ++  SL  FE  N V + G L+MP  +EM +H+ P++GEY SDH+ +M Q+ L 
Sbjct: 443 HEKVDSLKTFERENNVKLRGLLKMPQSKEMCEHAIPYKGEYPSDHLCMMIQLELL 497

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 198/473 (41%), Positives = 278/473 (58%), Gaps = 38/473 (8%)

Query: 43  DHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQ 102
           +HI K+             ++++QG DPD P P+LQFI RPLL +S  ++   F      
Sbjct: 55  EHIAKVRAEREAMRKSKQEAMLAQGLDPDLP-PELQFIRRPLLALSKAESTAGF------ 107

Query: 103 ATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVD 162
                 + KIMTYN LAQ LIRR  FP SG A+KW +RSKVL++E K Y  D++ LQEVD
Sbjct: 108 ------EFKIMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLNEFKYYDSDVICLQEVD 161

Query: 163 YNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVIS 221
             + + FW+E F KLG+D  F     K HG+ + W    F + ++ ++DYD+ ++GN I 
Sbjct: 162 RIQFQTFWKEEFDKLGYDSQFHAKPSKNHGISILWKRSLFTMTDKMLIDYDKEISGN-IP 220

Query: 222 ARTRTKNIALIVSLRFKDT-----RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKI 276
            RT T N+ L+++L+F         N   +GI+V  THLFWHPFG +ER RQ Y+VL K 
Sbjct: 221 PRTTTNNVGLVLALKFSPKVLERFPNTRKSGIIVGTTHLFWHPFGTYERTRQCYIVLNKT 280

Query: 277 QEI----------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECS 326
           +E            D  K H W++   GDFN++P + PYL++TSKP+  +   + ++ECS
Sbjct: 281 KEFMHRVNVLQNNNDEIKDH-WYTFFGGDFNSQPFDTPYLSMTSKPVKYSNRAKTVIECS 339

Query: 327 LAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHN 386
            +Y +SK R+G               G+   +QP  P P  F A+ E++ LV  +  LHN
Sbjct: 340 TSYTFSKSRDGEEDAEDEEGGNIEKFGK---DQPATPVPSFFDASSEQQSLVANMEKLHN 396

Query: 387 SLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQ 444
           SL ++ ISLY +GYG VH ENA  +   GEPE+SNWA+ W GLLDY+F I+S D +   Q
Sbjct: 397 SLDMRAISLYSVGYGTVHIENAGLDNTRGEPEISNWAHAWNGLLDYLFVIKSWDFSDKIQ 456

Query: 445 EKSLNVFEENNGVNVIGYLRMPCKQEMPK--HSQPFEGEYASDHISLMCQIRL 495
             SL  FE+ N + V  +L+MP K EM K  H QP  GEY SDH+S++C++ L
Sbjct: 457 VDSLKKFEDENELKVKAFLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICKLEL 509

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  371 bits (952), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 194/472 (41%), Positives = 273/472 (57%), Gaps = 40/472 (8%)

Query: 43  DHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQ 102
           +HI ++              ++++G DP+FP PDLQFI RP+L + S  +   F      
Sbjct: 42  EHIAEVRAKREAAKKAKREEMLARGLDPEFP-PDLQFISRPMLPLDSNYSPEGFV----- 95

Query: 103 ATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVD 162
                   KIMTYN LAQ LIRR  FP SG+ALKW KRS+VL++E   Y  D+  LQE+D
Sbjct: 96  -------FKIMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEID 148

Query: 163 YNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVIS 221
           Y + + FW+E F KLG+D  F R+G K HG+ + W  + F + ++ ++DYD+  +G+ + 
Sbjct: 149 YIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGS-LK 207

Query: 222 ARTRTKNIALIVSLRFKDT-----RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKI 276
            RT TKN+ L+++L F           S  GI+V  THLFWHPFG FER RQ Y++L K+
Sbjct: 208 PRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKM 267

Query: 277 QEIKDF-----------PKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVEC 325
              KDF                W+    GDFN +P + PYL+++SKP+      + ++EC
Sbjct: 268 ---KDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIEC 324

Query: 326 SLAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLH 385
           S +Y +SK R+G                     QP++P P  + A  E+K+LV  +  LH
Sbjct: 325 STSYTFSKARDGEECDDEEGGNIEKFGD----GQPEHPVPDTYEAAPEQKELVQTMAELH 380

Query: 386 NSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQ 443
           NSL ++ IS+Y + Y  VHPENA  +  H EPE+SNWA TW GLLDYIF+I+  +    +
Sbjct: 381 NSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNK 440

Query: 444 QEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
           + + L  FE+ N V ++  LRMP  +EMP H QP EGEY SDH+SLMC+I L
Sbjct: 441 RPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIEL 492

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  372 bits (954), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 189/454 (41%), Positives = 281/454 (61%), Gaps = 38/454 (8%)

Query: 63  LISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTL 122
           +++ G DPD P P+LQFI RPLL +  ++               S    +MTYN LAQ L
Sbjct: 91  MLANGLDPDCP-PELQFIRRPLLTLHDDE------------PEKSFTFTLMTYNCLAQAL 137

Query: 123 IRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLS 181
           IRR  FP SG A+KW++RS+VL++E K Y PD++ LQE+D+ + + FW+E F K+G+   
Sbjct: 138 IRRKLFPDSGEAVKWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQ 197

Query: 182 FRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT- 240
           F R   K HG+ + W N  F+L +  ++D+D+ L+G+++  RT+T N  LI+SL++ D+ 
Sbjct: 198 FHRIHSKNHGVAIVWKNNLFRLTDRMLIDFDKELSGDIL-PRTKTNNTGLILSLKYSDSV 256

Query: 241 -------RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIK----------DFP 283
                   N + +GI++  THLFWHPFG +ER RQ +++L K++E K          D  
Sbjct: 257 LAKYPELGNNNKSGIIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGN 316

Query: 284 KYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGXXXXXX 343
             H W +   GDFN++P + PYL+ITSKP+      + ++ECS +Y YSK RNG      
Sbjct: 317 MDH-WTAFFCGDFNSQPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAE 375

Query: 344 XXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKV 403
                   +  ++  QP+ P P  +  T E+ DLV+++ +LHNSL++K  SLY +GY KV
Sbjct: 376 DEEGGNIEKFGKD--QPQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKV 433

Query: 404 HPENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIG 461
           HPEN+  +   GEPE+SNWA++W GLLDYIFY++  D +  ++ +    FE+ N + + G
Sbjct: 434 HPENSGLDNKKGEPEISNWAHSWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRG 493

Query: 462 YLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
           YLRMP   EM K+ QP +GEY SDH+S+MC+I L
Sbjct: 494 YLRMPPATEMSKYGQPHQGEYPSDHLSMMCKIEL 527

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  365 bits (936), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 189/478 (39%), Positives = 282/478 (58%), Gaps = 35/478 (7%)

Query: 38  DQSTIDHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFK 97
           ++ T ++I ++             +LI+QG DP  P  DL+FI+RP+L +  + +     
Sbjct: 54  NEITPEYIAEMRAKREAAKIAKKEALIAQGIDPKLPA-DLRFIKRPMLAVPRDSSG---- 108

Query: 98  SSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVS 157
               Q+T     I IMTYN LAQ LIRR  FP SG+A+KW KRS+VL++E K Y  D++ 
Sbjct: 109 ----QSTREVCPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLC 164

Query: 158 LQEVDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILA 216
           LQE+D  + K FW+  F KLG+   F  N  K HG+L+AW  + F + ++ ++DYD+   
Sbjct: 165 LQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETT 224

Query: 217 GNVISARTRTKNIALIVSLRFKDTR-----NASTNGIVVANTHLFWHPFGVFERLRQSYL 271
           G  I  RT TKN+ +++SL+FK        +   +GI++  THLFWHPFG +ER RQ Y+
Sbjct: 225 G-AIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGIIIGTTHLFWHPFGTYERTRQCYI 283

Query: 272 VLQKIQEI----------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRA 321
           VL+K++E           KD    H W +   GDFN++P + PYL+ITSKP+  TG  + 
Sbjct: 284 VLKKVKEFQNRINVLQNEKDGDNSH-WPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKT 342

Query: 322 MVECSLAYRYSKKRNGXXXXXXXXXXXXN-SRGERNLNQPKNPKPKHFAATKEEKDLVNQ 380
           ++ECS ++ +SK R+G               +G     QP+ P P+ F+  +E+K L   
Sbjct: 343 VIECSTSFTFSKLRDGDEGEGEEGGNIEKFGKG-----QPETPVPESFSGNEEQKQLCEN 397

Query: 381 LITLHNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIESDD 438
           + TLHN + ++ ISLY + Y KVHPEN+  +    EPE+SNWA+ W GLLDY++Y+ S D
Sbjct: 398 MKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWD 457

Query: 439 NNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRLF 496
                +   L+ FE+N GV V+  LR+P  +EM +H QP EGEY SDH+ ++ ++ + 
Sbjct: 458 GCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGII 515

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  363 bits (933), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 185/442 (41%), Positives = 268/442 (60%), Gaps = 37/442 (8%)

Query: 75  PDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSA 134
           P+LQFI+RP+L++  E+    FK S            +MTYN LAQ LIRR  FP SG A
Sbjct: 144 PELQFIKRPILYLHEEEPVQGFKFS------------MMTYNCLAQALIRRKLFPDSGDA 191

Query: 135 LKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLL 193
           LKW++RSKVL++E   Y+PDI+ LQEVD+ + + FW+  F KLG+   + R G K HG+ 
Sbjct: 192 LKWYRRSKVLLNEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVS 251

Query: 194 VAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDTRNA-------STN 246
           + W    F + ++ ++++D+  +GNV   RT T N+ LI+SL+F     A       +  
Sbjct: 252 IIWRRSLFTMTDKMLIEFDKESSGNV-PPRTTTNNVGLILSLKFTPEAKAQFKNVETTKT 310

Query: 247 GIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI----------KDFPKYHGWHSLLMGDF 296
           GI++  THLFWHPFG +ER RQ Y+VL K++E            D    H W+    GDF
Sbjct: 311 GIIIGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSH-WYPFFCGDF 369

Query: 297 NTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGXXXXXXXXXXXXNSRGERN 356
           N++P + PYL++  KP+  +G  + ++ECS +Y++SKKR+G               G   
Sbjct: 370 NSQPFDSPYLSMVRKPVEYSGRAKTVIECSTSYKFSKKRDGEEDVDDEEGGNIEKFG--- 426

Query: 357 LNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENA--NEGHGE 414
           ++QP+ P P+ F A  E+  LV  +  LHNSL+++ ISLYG+GY  VHPENA  +   GE
Sbjct: 427 IDQPQTPVPEEFIANGEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNECGE 486

Query: 415 PELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKH 474
           PE+SNWA+TW GLLDY+ +++    +   + ++L  FEE+N + + G+LRMP   EM KH
Sbjct: 487 PEISNWAHTWNGLLDYLLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTKH 546

Query: 475 SQPFEGEYASDHISLMCQIRLF 496
            QP  GEY SDH+S++C I L 
Sbjct: 547 GQPHVGEYPSDHLSMLCSIELL 568

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  360 bits (923), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 187/473 (39%), Positives = 271/473 (57%), Gaps = 38/473 (8%)

Query: 43  DHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQ 102
           + I +I              ++ +G DPD P P+LQFI R +L +  E+     K     
Sbjct: 38  EEIARIRAEREAMREAKRQEMLERGVDPDCP-PELQFIRRNMLKLHEEEPVEGLK----- 91

Query: 103 ATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVD 162
                  IKIM+YN LAQ LIRR  FP SG ALKW++RS+VL++E K Y PD++ LQE+D
Sbjct: 92  -------IKIMSYNCLAQALIRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEID 144

Query: 163 YNELK-FWRENFHKLGFDLSFRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVIS 221
           Y + + FW+E F KLG+   F R   K HG+ + W +EKF++ +  ++D+D   +G+ I 
Sbjct: 145 YIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGD-IE 203

Query: 222 ARTRTKNIALIVSLRFKDTRNA-------STNGIVVANTHLFWHPFGVFERLRQSYLVLQ 274
            RT T N ALI++L+F               +GI+V  THLFWHPFG +ER RQ Y+VL 
Sbjct: 204 PRTTTNNAALILALKFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLN 263

Query: 275 KIQEI----------KDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVE 324
           K++E            D    H W+    GDFN++P + PYL++T KP+      + ++E
Sbjct: 264 KMKEFMHRVNVLQNNNDGDMSH-WYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIE 322

Query: 325 CSLAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITL 384
           CS ++++SKKR                 G+   +QP+ P P+ F A  E+  LV+Q+  L
Sbjct: 323 CSTSFKFSKKRESGEDAEDEEGGNIEKFGK---DQPQTPVPEKFVANDEQTKLVSQMEEL 379

Query: 385 HNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSA 442
           HNSL ++ +SLY + Y KVHPEN+  +   GEPE+SNWA+TW GLLDY+F I + + +  
Sbjct: 380 HNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDR 439

Query: 443 QQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
            +  +L  FE +N + + G LRMP   EM  H QP  GEY SDH+ L+ ++ L
Sbjct: 440 TEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  353 bits (905), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/450 (41%), Positives = 268/450 (59%), Gaps = 32/450 (7%)

Query: 66  QGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRR 125
           QG   D P  +L+FIERP+L +  +          I A  + L + +MTYN LAQ LIRR
Sbjct: 43  QGAKSDIPA-ELRFIERPMLSVHPD--------GAIGAEGNRLPVTLMTYNCLAQALIRR 93

Query: 126 DFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNEL-KFWRENFHKLGFDLSFRR 184
             FP SG ALKW++RS+VL+++ K Y PD++ LQEVD  +   FWR  F KLG+   F +
Sbjct: 94  KLFPDSGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHK 153

Query: 185 NGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT---- 240
              K HG+ V W ++ F + ++ ++D+D+  +G+V   RT T N  L+++L+F +     
Sbjct: 154 KQTKNHGVAVVWRSKLFTMADKMLIDFDKEQSGDV-PPRTTTNNAGLVIALKFTEQALTG 212

Query: 241 -RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI----------KDFPKYHGWH 289
            R+   +GI+V  THLFWHPFG FER RQ Y+VL K++E            D    H W 
Sbjct: 213 HRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQH-WF 271

Query: 290 SLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGXXXXXXXXXXXX 349
               GDFN++P + PYL++TSKP++ +G  R ++ECS +Y +SK+R+             
Sbjct: 272 PFFCGDFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRD-GEDAAADEEEEG 330

Query: 350 NSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPEN-- 407
            +      +QP +P P  F    E+  LV+Q+ TLHNSL ++ +SLY +GY  VHPEN  
Sbjct: 331 GNIEIFGKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAG 390

Query: 408 ANEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPC 467
           A+   GEPE+SNWA+TW GLLDY+FY+   D        +L  FE+++GV V   LRMP 
Sbjct: 391 ADNARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPS 450

Query: 468 KQEMPK--HSQPFEGEYASDHISLMCQIRL 495
           KQEM +  H QP  GEY SDH++++C + L
Sbjct: 451 KQEMQQFGHGQPHTGEYPSDHLAMVCDLEL 480

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  346 bits (888), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 184/455 (40%), Positives = 274/455 (60%), Gaps = 43/455 (9%)

Query: 66  QGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRR 125
           QG+DPD P  +L FI+RP+L++    ++N                 +MTYN LAQ +IRR
Sbjct: 40  QGEDPDHPI-ELSFIKRPILYLPHHGHSN----------RKGFKFSLMTYNCLAQAMIRR 88

Query: 126 DFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEV-DYNELKFWRENFHK-LGFDLSFR 183
           + F  SG ALKW +RSKVL++E+  Y PDI+ LQE+ D+    FW++     L  +  + 
Sbjct: 89  EVFSDSGPALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYY 148

Query: 184 RNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKD---T 240
           +   K HG+L+AW    F+  +  ++D+D +   N I+ RT T+NIA+ V+L+F D   T
Sbjct: 149 KQKIKHHGVLIAWKKSIFKQVDHMVVDFDDVKTSN-IARRTITRNIAMYVALKFNDEFIT 207

Query: 241 RN---------ASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQE------IKDFPKY 285
           +N          +  G +++ THLFWHPFG FER RQ Y++L+K+++      +KD  K 
Sbjct: 208 KNFPNLLHSFDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNVKDHLKT 267

Query: 286 HGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGXXXXXXXX 345
           H W+  + GDFN+ P + PYL++TSKP+  TG  + ++ECS AY++SK+RNG        
Sbjct: 268 H-WYPFICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNG------EI 320

Query: 346 XXXXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHP 405
                   ++ +NQPK+  P  F  T E+  LV+QL +LHN L ++  SLYGL Y  V P
Sbjct: 321 GDSDEEEEKKLINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDP 380

Query: 406 ENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQE--KSLNVFEENNGVNVIG 461
            N   N   GEPE ++WA +W G+LDYI Y+++ D N    E  +SL  FE+NN + + G
Sbjct: 381 SNVNINNDRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKG 440

Query: 462 YLRMPCKQEMPKHSQPFEGEYASDHISLMCQIRLF 496
            L+MP  ++MP H+QPFE EY SDHIS++C++ + 
Sbjct: 441 LLKMPLNKDMPFHTQPFEREYPSDHISILCEMEIL 475

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  345 bits (884), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 178/438 (40%), Positives = 250/438 (57%), Gaps = 35/438 (7%)

Query: 76  DLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSAL 135
           D+ FI+RPLL  +      D    F+         ++MTYN LAQ LIRR  FP SG+AL
Sbjct: 84  DVGFIKRPLLVCN-----GDEAKGFV--------FRMMTYNCLAQALIRRKLFPTSGNAL 130

Query: 136 KWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLSFRRNGGKTHGLLV 194
           KW KRSKVL+ EL+ Y PD++ LQE+D+ + K FW +     G+   F R+ GK HG+ +
Sbjct: 131 KWFKRSKVLLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAI 190

Query: 195 AWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT-----RNASTNGIV 249
            W    F   +E ++D+D+  +G  I  RT TKN+ LIV+L + D        ++ +GIV
Sbjct: 191 VWRRSLFNKVDETLIDFDEEQSGE-IERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIV 249

Query: 250 VANTHLFWHPFGVFERLRQSYLVLQKIQ---------EIKDFPKYHGWHSLLMGDFNTEP 300
           V  +HLFWHPFG +ER RQ Y++L +++         E         WH    GDFN++P
Sbjct: 250 VGTSHLFWHPFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQP 309

Query: 301 EEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGXXXXXXXXXXXXNSRGERNLNQP 360
            + PYL++ SKP+   G  R ++ECS +Y++S  R+G                     QP
Sbjct: 310 FDAPYLSMCSKPIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKF----GAGQP 365

Query: 361 KNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENA--NEGHGEPELS 418
           + P P  F  T E++ LV+ + +LHN+L ++ ISLY L Y  VHPENA  +   GEPE+S
Sbjct: 366 ETPVPDSFDGTPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEIS 425

Query: 419 NWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPF 478
           NWA+ W GLLDYI Y+   D +   +   +  F++N  V V   LR+P   EMP H QP 
Sbjct: 426 NWAHAWRGLLDYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPH 485

Query: 479 EGEYASDHISLMCQIRLF 496
           EGEY SDH+SLMC++ L 
Sbjct: 486 EGEYPSDHLSLMCELELL 503

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  334 bits (856), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 181/483 (37%), Positives = 281/483 (58%), Gaps = 37/483 (7%)

Query: 32  HKKIPADQSTIDHIKKIXXXXXXXXXXXXNSLISQGKDPDFPTPDLQFIERPLLHISSEK 91
           H K+P  Q T + I KI                ++  +P+F      FI+R +L + +  
Sbjct: 12  HIKLPKSQITPEFISKIRKLREKKRAE------NEENNPEFLNSKYDFIKRAILQLPN-- 63

Query: 92  NANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTY 151
                    ++   +S+D+KIMTYNTL+Q+LIRR+ +P +  A+KWH RSKV+++E+K Y
Sbjct: 64  ---------VEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIKYY 114

Query: 152 TPDIVSLQEVDYNEL-KFWRENFHKLGFDLSFRRN--GGKTHGLLVAWNNEKFQLDNEWM 208
             DI+  QEVD  +  KFW     KLG++  F ++  G K HG+ + W +  F+  +   
Sbjct: 115 NCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQFDVIK 174

Query: 209 LDYDQILAGNVISARTRTKNIALIVSLRFKDTRNASTNGIVVANTHLFWHPFGVFERLRQ 268
           +++D I+AGN IS  TRT N+ LIV+L+FK +     +GIV+  THLFWHPFG FER RQ
Sbjct: 175 INFDDIVAGNAISKTTRTWNVGLIVALKFKSSNAKFRSGIVIGTTHLFWHPFGTFERTRQ 234

Query: 269 SYLVLQKIQEIKD---------FPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGST 319
             ++L+K +++ D             + W  +L GDFN++P + PYL+ITSKP++ +G  
Sbjct: 235 LAILLKKFRKLIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSITSKPVSASGEA 294

Query: 320 RAMVECSLAYRYSKKRNGXXXXXXXXXXXXNSRG-------ERNLNQPKNPKPKHFAATK 372
           + ++ECS AY++S++R+G             ++        E   + P +P+P HF AT 
Sbjct: 295 KTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPIDPRPSHFEATS 354

Query: 373 EEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENANEGHGEPELSNWANTWCGLLDYIF 432
           E+KDL+ +L  +HNS+++K  SL+G+ Y KVH    N    EPELS+ +  W GLLDYIF
Sbjct: 355 EQKDLIAKLEKVHNSINLKATSLFGIAYKKVHSIGLN-CKNEPELSHTSIFWTGLLDYIF 413

Query: 433 YIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGEYASDHISLMCQ 492
            +E  +        SL  FE+   + V G L+MP  +E+PK+ QP +G+Y SDH+S++C 
Sbjct: 414 ILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQGQYPSDHLSMICD 473

Query: 493 IRL 495
           + +
Sbjct: 474 LNV 476

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  327 bits (837), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 177/434 (40%), Positives = 259/434 (59%), Gaps = 29/434 (6%)

Query: 79  FIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALKWH 138
           FI+RPLL +             +      + +KIMTYNTLAQTLIRR  FP +  A+KWH
Sbjct: 43  FIKRPLLEVPYVGG--------VPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWH 94

Query: 139 KRSKVLVHELKTYTPDIVSLQEVDYNEL-KFWRENFHKLGFDLSFRRNGGKTHGLLVAWN 197
           +RS+VL+ EL+ Y  D+V LQE D  +  KFW E F +LG+   F    GK HG+ + W 
Sbjct: 95  RRSQVLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWK 154

Query: 198 NEKFQ---LDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDTRNASTNGIVVANTH 254
              F+   LD +  L  D  +AG+ I+A T T+ +AL V+LR K   + ++  I+ + TH
Sbjct: 155 TSMFEDTPLD-KLPLCLDDYVAGDDIAATTGTRTVALAVALRLK--HHKTSRPIIFSTTH 211

Query: 255 LFWHPFGVFERLRQSYLVLQK----IQEIKD--FPKYHGWHSLLMGDFNTEPEEPPYLAI 308
           LFWH FG FER RQ +++L +    I+++ D   P+    ++   GDFN++P + PYL++
Sbjct: 212 LFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQRCYTFFTGDFNSQPCDAPYLSL 271

Query: 309 TSKPLTLTGSTRAMVECSLAYRYSKKRNGXXXXXXXXXXXXNSRGER---NLNQPKNPKP 365
           T KP+ L G  ++++ECSL+YRYSK+RN              S  E      N+P++P+P
Sbjct: 272 TDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRP 331

Query: 366 KHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENANE----GHGEPELSNWA 421
             + A  E+ + V  L  LHN + ++G+SLYG+GY  VHPEN+N+     + EP+LS+ A
Sbjct: 332 YTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRA 391

Query: 422 NTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPCKQEMPKHSQPFEGE 481
             W GLLDYIF I ++ + +A +   L   E   G+ + GYLRMP K+EM  H++P E E
Sbjct: 392 LHWSGLLDYIFLI-TEWSENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENE 450

Query: 482 YASDHISLMCQIRL 495
           Y SDH+++MC I L
Sbjct: 451 YPSDHLAMMCDISL 464

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  322 bits (824), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/449 (39%), Positives = 246/449 (54%), Gaps = 37/449 (8%)

Query: 63  LISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTL 122
           L+S+G DPDFP  + QFIERP+L +    N               L + IMTYN LAQTL
Sbjct: 45  LLSRGLDPDFPA-ECQFIERPILLVPHGDNY-----------ERGLPLSIMTYNCLAQTL 92

Query: 123 IRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLS 181
           IRR+ FP+SG ALKW  RSKVL+HE+K Y  DI  LQE+D  +   FW E   K G+   
Sbjct: 93  IRREMFPESGPALKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTI 152

Query: 182 FRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDTR 241
           +     K+HG+++AW  E FQL++   +++D+  A   I  RTRT N+ L+V+L F D  
Sbjct: 153 YFHQDSKSHGVMIAWKEELFQLESHMNIEFDK-EAPAGIQPRTRTNNVGLLVALAFTDAF 211

Query: 242 NASTN-------GIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIKDFPKYHGWHSLLMG 294
            A  N       G+++   HLFWHPFG ++R RQ  ++ +KI E     K   +  +  G
Sbjct: 212 RARNNRIRTSRSGVIIGTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTVK-GDYCKMFTG 270

Query: 295 DFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRN-------GXXXXXXXXXX 347
           DFN++P   PYL +T     L    R  +E S AYRYS++RN                  
Sbjct: 271 DFNSQPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEE 330

Query: 348 XXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPEN 407
                 ++  +    P+P  F +T+E++ LVN LI   N + +   SLY +GY  V P +
Sbjct: 331 KREYEYDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTH 390

Query: 408 ANEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPC 467
             + H EPELS+W+  W GLLDYIFY+        Q+  +   FE  N + + GYL+MP 
Sbjct: 391 IAD-HHEPELSSWSTKWAGLLDYIFYVN-------QRPSTPATFETANNIAIAGYLQMPT 442

Query: 468 KQEMPKHSQPFEGEYASDHISLMCQIRLF 496
             +M  HSQP+ GEY SDHIS+MC + ++
Sbjct: 443 HAQMHNHSQPYTGEYPSDHISMMCALEIY 471

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 170/450 (37%), Positives = 245/450 (54%), Gaps = 42/450 (9%)

Query: 66  QGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRR 125
           Q   P+  + +L+FI RP+L +              Q         +MTYN LAQ+LIRR
Sbjct: 58  QQMAPNITSLNLEFIARPMLPLK-----------VTQTVHKGFSFSLMTYNCLAQSLIRR 106

Query: 126 DFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNEL-KFWRENFHKLGFDLSFRR 184
             FP SG ALKW KRS VL+ E K Y  D++ LQE+DY +   FW      LG+   F R
Sbjct: 107 SLFPTSGRALKWTKRSMVLLKEFKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHR 166

Query: 185 NGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDTRNAS 244
              K+HG+ + W  + F   ++ ++++D   +G  I  R  T N+ +I++L F D    S
Sbjct: 167 MDNKSHGVAIFWKKDLFIWMDQMLINFDNEDSGE-IEPRKTTNNVGMILALGFSDKVKQS 225

Query: 245 -----TNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI------------KDFPKYHG 287
                 +GI+V  +HLFWHPFG +ER RQ Y++L K++E              D  K   
Sbjct: 226 FPGTVKSGIIVGTSHLFWHPFGTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTK--- 282

Query: 288 WHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGXXXXXXXXXX 347
           W+    GDFN++P + PYL+ITSKP+  +G  + ++ECS AY++     G          
Sbjct: 283 WYPFFCGDFNSQPFDAPYLSITSKPVLYSGRAKTVIECSAAYKFPDLGAGARGAN----- 337

Query: 348 XXNSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPEN 407
                G    ++P +P P+ F  T E   LV ++  LHNSL ++ ISLY + Y  VHP+N
Sbjct: 338 --EDGGTVGEDRPVDPVPESFQPTAEVSSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDN 395

Query: 408 A--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRM 465
           A  +   GEPE+SNWA TW GLLDYI YI     ++  +  SL  FE+ + + V   LRM
Sbjct: 396 AGLDNERGEPEISNWAYTWRGLLDYIMYITPWQASNNVEVDSLESFEKLSHITVQEMLRM 455

Query: 466 PCKQEMPKHSQPFEGEYASDHISLMCQIRL 495
           P  +EM  H QP +GEY SDH+++MC++ +
Sbjct: 456 PPAKEMSSHGQPHDGEYPSDHLAMMCKLEV 485

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 97/219 (44%), Gaps = 20/219 (9%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FW 169
           +++YNTL Q       +  + S AL W  R   L  ++ +Y+ DI+ LQEV+    + FW
Sbjct: 437 VLSYNTLCQHYATPKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFEDFW 496

Query: 170 RENFHKLGFDLSF----------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219
                K G+  SF           R+  K  G  V +   KF+L  +  +D+      + 
Sbjct: 497 LPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMKHE 556

Query: 220 ISARTRT-KNIAL---IVSLRFKDTRNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQK 275
              RT    N A+    ++L FK    AS   I VA THL W P     +  Q  ++L  
Sbjct: 557 KFQRTEDFLNRAMNKDNIALYFKLQHIASGEHIWVATTHLHWDPKFNDVKTFQVGVLLDH 616

Query: 276 IQEI--KDFPKYHGWHS--LLMGDFNTEPEEPPYLAITS 310
           +Q +  +D P+     +  ++ GDFN+  +   Y  ++S
Sbjct: 617 LQTLIRQDNPRQDVKKAPVIICGDFNSYIDSAVYELLSS 655

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/271 (24%), Positives = 105/271 (38%), Gaps = 57/271 (21%)

Query: 73  PTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSG 132
           PT +   ++    H+S E      K SF           +++YNTL Q       +  + 
Sbjct: 376 PTEEFNSLQESTQHLSKET----LKRSFT----------LLSYNTLCQHYATPKMYRYTP 421

Query: 133 S-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLSFR------- 183
           S AL W  R   L  ++ ++  D+V LQEV+    + FW     K G+   F        
Sbjct: 422 SWALSWDYRRDKLKEQIISFQADVVCLQEVECKTFEDFWAPFLQKHGYTGVFHAKTRART 481

Query: 184 ---RNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTR--------TKNIALI 232
              ++  K  G  V + N +F+L  +  +D+  +   +    RT           N+AL 
Sbjct: 482 MQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALF 541

Query: 233 VSLRFKDTRNASTNGIVVANTHLFWHP---------FGVF----ERLRQSYLVLQKIQEI 279
           V L+   T       I V  THL W P          GV     E+L +    +   QE+
Sbjct: 542 VKLQHLKTNEQ----IWVTTTHLHWDPQFNDVKTFQVGVLLDYMEKLLRDQNGVGNNQEM 597

Query: 280 KDFPKYHGWHSLLMGDFNTEPEEPPYLAITS 310
           K  P       ++ GDFN++ +   Y   +S
Sbjct: 598 KKVPL------VICGDFNSQLDSAVYELFSS 622

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 109/265 (41%), Gaps = 50/265 (18%)

Query: 70  PDFPTP-DLQFIE-----RPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLI 123
           P+ P P D +FIE      P     S ++AN    + ++A        I++YNTL Q   
Sbjct: 424 PEVPLPADRKFIEINTDGEPTREFDSLESAN----TAVEAGLLKKSFTILSYNTLCQHYA 479

Query: 124 RRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLS 181
               +  + S AL+W  R + L  ++ +Y  DI+ LQEV+    + FW     K G+   
Sbjct: 480 TPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYEDFWAPLLEKNGYTGY 539

Query: 182 FR----------RNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTR------ 225
           F           ++  K  G  V +   KF+L  +  LD+      +    RT       
Sbjct: 540 FHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQKHKRFQRTEDYLNRA 599

Query: 226 --TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP-FGVFERLRQSYLV--LQKI---- 276
               N+A+ + L+       S   + V  THL W P F   +  +   L+  ++ I    
Sbjct: 600 MNKDNVAIYMKLQHVQ----SGEYLWVVTTHLHWDPKFNDVKTFQVGVLLDHMESIIKEE 655

Query: 277 ---QEIKDFPKYHGWHSLLMGDFNT 298
              Q++K FP       ++ GDFN+
Sbjct: 656 NPKQDVKKFP------IIITGDFNS 674

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 107/269 (39%), Gaps = 53/269 (19%)

Query: 70  PDFPTPDLQ-FIE-RPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQ---TLIR 124
           P+ P P+ + FIE      ++ E  + +  +S +   +      +++YNTL Q   T   
Sbjct: 403 PELPLPEPRHFIEINADGELTQEHVSLEESNSHVNQDTLKRSFTLLSYNTLCQHYATPKM 462

Query: 125 RDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVD---YNELKFWRENFHKLGFDLS 181
             F P    AL W  R + L  E+ +Y  D++ LQEV+   Y E  FW     K G+   
Sbjct: 463 YRFVP--SWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEE--FWLPLLEKQGYSGV 518

Query: 182 FR----------RNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTR------ 225
           F           ++  K  G  + + N +F    +  +D+  +   +    RT       
Sbjct: 519 FHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMKHKKFQRTEDYLNRA 578

Query: 226 --TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP---------FGVF----ERLRQSY 270
               NIALIV L+       S   + V  THL W P          GV     E+L +  
Sbjct: 579 MNKDNIALIVKLK----HELSGEHVWVVTTHLHWDPHFNDVKTFQVGVLLDYIEKLLKQQ 634

Query: 271 LVLQKIQEIKDFPKYHGWHSLLMGDFNTE 299
             +   QE K  P       ++ GDFN++
Sbjct: 635 SNIGNPQEKKKVPL------IICGDFNSQ 657

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 111/275 (40%), Gaps = 53/275 (19%)

Query: 70  PDFPTPDLQFIERPLLHISSEKNANDFKSSFIQ--ATSSSLDIK----IMTYNTLAQTLI 123
           P+ P P     ER  + I+ +  A    SS  +  A  S   +K    I++YNTL Q   
Sbjct: 366 PEIPLP----TERKFIDINIDGEATQECSSLQESDAHQSRETLKKSFTILSYNTLCQHYA 421

Query: 124 RRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLS 181
               +  + S AL W  R + L  ++ +Y  DIV LQEV+    + FW     + G+   
Sbjct: 422 TPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKTYEDFWAPLLREKGYSGI 481

Query: 182 F----------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTR------ 225
           F           ++  K  G    + + +F+L  +  +D+  +   +    RT       
Sbjct: 482 FHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWMKHKKFQRTEDYLNRA 541

Query: 226 --TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP-FGVFERLRQSYLV--LQKI---- 276
               N+AL+V L+       S   +  A THL W P F   +  +   L+  ++K+    
Sbjct: 542 MNKDNVALVVKLQ----HIKSGEHVWAATTHLHWDPQFNDVKTFQVGVLLDYMEKVIKEQ 597

Query: 277 ------QEIKDFPKYHGWHSLLMGDFNTEPEEPPY 305
                 QE+K  P       ++ GDFN++     Y
Sbjct: 598 NNCNNTQELKKVP------VVICGDFNSQTNSAVY 626

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 116/285 (40%), Gaps = 49/285 (17%)

Query: 70  PDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLD-------IKIMTYNTLAQTL 122
           P+ P P     ER  + I+ +       +S +Q + S L+         +++YNTL Q  
Sbjct: 368 PEIPLP----TERKFIDINVDGEVTQEYAS-LQESDSHLNRETAKKSFTLLSYNTLCQHY 422

Query: 123 IRRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDL 180
                +  + S AL W  R + L  ++  Y+ DI+ LQEV+    + FW     + G+  
Sbjct: 423 ATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFWAPLLREEGYTG 482

Query: 181 SFR----------RNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTR----- 225
            F           ++  K  G  + + + +F+L  +  +D+  +   +    RT      
Sbjct: 483 IFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHKKFQRTEDYLNR 542

Query: 226 ---TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP-FGVFERLRQSYLVLQKIQEIKD 281
                N+AL+V L+       S   +  A THL W P F   +  +   L+    + IK+
Sbjct: 543 AMNKDNVALLVKLQHL----KSGEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVIKE 598

Query: 282 FPKYHGWHSL------LMGDFNTEPEEPPYLAITSKPLTLTGSTR 320
              Y+    L      + GDFN++ +   Y  ++      TGS R
Sbjct: 599 HSGYNNSQELKKVPVIICGDFNSQVDSAVYELLS------TGSVR 637

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 89/220 (40%), Gaps = 41/220 (18%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVD---YNELK 167
           +++YNTL Q       +    S AL W  R + L  E+  Y  DI+ LQEV+   Y E  
Sbjct: 400 LLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKTYEE-- 457

Query: 168 FWRENFHKLGFDLSF----------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAG 217
           FW     K G+   F           ++  K  G  + + N +F    +  +D+  +   
Sbjct: 458 FWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWMK 517

Query: 218 NVISARTR--------TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHPFGVFERLRQS 269
           +    RT           N+ALI+ LR + T       + V  THL W P   F  ++ +
Sbjct: 518 HKKFQRTEDYLNRAMNKDNVALIIKLRHERT----GEHVWVVTTHLHWDPH--FNDVK-T 570

Query: 270 YLVLQKIQEIKDFPKYHGWHS----------LLMGDFNTE 299
           + V   +  I+   K HG             ++ GDFN++
Sbjct: 571 FQVAVMLDYIEKLLKQHGGVGSPQDKKKIPLVICGDFNSQ 610

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 106/265 (40%), Gaps = 38/265 (14%)

Query: 75  PDLQFI-ERPLLHISSEKNANDFKSSFIQATS------SSLDIKIMTYNTLAQTLIRRDF 127
           P++  I +R  + I+++   ++   S   AT       +     IM+YN L Q       
Sbjct: 482 PEVPLIKDREFIEINTDGEVSEVYDSLSNATDNLNKEVAKRSFTIMSYNILCQHYATPKM 541

Query: 128 FPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNEL-KFWRENFHKLGFDLSF--- 182
           +  + S AL W  R + L  E+ +Y  DIV LQEV+     + W     K G+   F   
Sbjct: 542 YRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEEHWAPLMLKQGYSGVFHAK 601

Query: 183 -------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISART-----RTKNIA 230
                   ++  K  G  V +   +F+L  +  +D+      +    RT     R  N  
Sbjct: 602 TRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMKHKKFQRTEDYLNRAMNKD 661

Query: 231 LIVSLRFKDTRNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIKDFPKYHGWHS 290
            +V +  K     S   + +A THL W P     +  Q  +++  ++E+    K HG  S
Sbjct: 662 NVV-IYIKLNHLKSGESVWIATTHLHWDPQFNDVKTFQVGILMDHLEELI---KEHGSPS 717

Query: 291 ----------LLMGDFNTEPEEPPY 305
                     ++ GDFN++ +   Y
Sbjct: 718 SRQDPKKSPVIICGDFNSQKDSAVY 742

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 97/248 (39%), Gaps = 49/248 (19%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FW 169
           +++YNTL Q       +  + S AL W  R   L  ++ +Y+ D++ LQEV+    + +W
Sbjct: 501 VLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFEDYW 560

Query: 170 RENFHKLGFDLSF----------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219
                K G+   F           ++  K  G  + +  ++F++ N   +D+      + 
Sbjct: 561 VPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWMKHK 620

Query: 220 ISARTR--------TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP---------FGV 262
              RT           N+AL + L+      +S + I V  THL W P          GV
Sbjct: 621 KFQRTEDYLNRAMNKDNVALFLKLQ----HVSSGDTIWVVTTHLHWDPKFNDVKTFQVGV 676

Query: 263 ----FERLRQSYLVLQKIQEIKDFPKYHGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGS 318
                E L +        Q+IK  P       L+ GDFN+      Y+      L  TG 
Sbjct: 677 LLDHLETLLKEDTTHNSRQDIKKSP------VLICGDFNS------YINSAVYELISTGR 724

Query: 319 TRAMVECS 326
            +A  E S
Sbjct: 725 VQAHQEGS 732

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 86/221 (38%), Gaps = 43/221 (19%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNEL-KFW 169
           +++YNTL Q       +  + S AL W  R + L  ++ +Y  D++ LQEV+     ++W
Sbjct: 466 VLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEEYW 525

Query: 170 RENFHKLGFDLSFR----------RNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219
                K G+   F           ++  K  G  V +   +F+L  +  +D+  +   + 
Sbjct: 526 APLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSGVWQKHK 585

Query: 220 ISARTR--------TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP---------FGV 262
              RT           N+A+ + L+       S   + +  THL W P          GV
Sbjct: 586 KFQRTEDYLNRAMNKDNVAIYLKLQ----HIKSGESVWIVTTHLHWDPQFNDVKTFQVGV 641

Query: 263 F----ERLRQSYLVLQKIQEIKDFPKYHGWHSLLMGDFNTE 299
                E L +     Q  QE K  P       +L GD N+E
Sbjct: 642 LMDHIENLLKEQSNAQSKQEAKKCP------VILCGDLNSE 676

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 114/258 (44%), Gaps = 73/258 (28%)

Query: 101 IQATSSSLD------IKIMTYNTLAQTLIRRDFFPQSGSALK-----WHKRSKVLVHEL- 148
           I+  SSS+         ++TYN L+   +    +PQ  + +K     W  R ++L HEL 
Sbjct: 19  IKTPSSSIQGPFNDRFTMLTYNMLSPYYM----WPQVYTYVKDEYKDWDYRHRLLEHELF 74

Query: 149 KTYTPDIVSLQEV---DYNELKFWRENF-HKLGFDLSFRRNGGKTH---------GLLVA 195
             Y  DI+ LQE+   DYNE  FW++   +++ +  +F       +         G+ + 
Sbjct: 75  YKYKSDIICLQELTTNDYNE--FWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIF 132

Query: 196 WNNEKFQLD-------NEWMLDYDQIL--------------AGNVIS-------ARTRTK 227
           +N +KF+         N+ +  +DQ                AG+VI        A+ R +
Sbjct: 133 YNLDKFEYLFSSSLYLNDLVGTFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQ 192

Query: 228 NIALIVSLRFKDTRNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI-------K 280
            + L V LR +++++     IVV NTHL+W    V  +L Q  ++++K+Q I        
Sbjct: 193 -VCLFVMLRHRESKSI----IVVINTHLYWKYDEV--KLVQCLIIMRKLQRIIKGLLMGI 245

Query: 281 DFPKYHGWHSLLMGDFNT 298
           +   Y     L  GDFN+
Sbjct: 246 EGVTYSNVKILFSGDFNS 263

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 106/269 (39%), Gaps = 49/269 (18%)

Query: 81  ERPLLHISSEKNANDFKSSFIQAT---SSSLDIK---IMTYNTLAQTLIRRDFFPQSGS- 133
           ER  + I+++        S  Q+T   S+ L  K   +++YNTL Q       +  + S 
Sbjct: 502 ERKFIEINTDGEPQKEYDSLQQSTEHLSADLAKKTFSVLSYNTLCQHYATPKMYRYTPSW 561

Query: 134 ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLSF---------- 182
           AL W  R   L  ++ +Y  D++ LQEV+    + +W     K G+   F          
Sbjct: 562 ALTWDYRRSKLKEQILSYDSDVLCLQEVESKTFEDYWVPLLDKHGYTGIFYAKARAKTMH 621

Query: 183 RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTR--------TKNIALIVS 234
            ++  K  G  + +  ++F+L  +  +D+      +    RT           N+AL + 
Sbjct: 622 SKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLK 681

Query: 235 LRFKDTRNASTNGIVVANTHLFWHP---------FGV----FERLRQSYLVLQKIQEIKD 281
           L+      +S + I V  THL W P          GV     E L +        Q+IK 
Sbjct: 682 LQ----HVSSGDTIWVVTTHLHWDPKFNDVKTFQVGVLLDHLESLLKEDTTHNSRQDIKK 737

Query: 282 FPKYHGWHSLLMGDFNTEPEEPPYLAITS 310
            P       L+ GDFN+      Y  I++
Sbjct: 738 SP------VLICGDFNSYINSAVYELIST 760

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 104/268 (38%), Gaps = 53/268 (19%)

Query: 70  PDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATS------SSLDIKIMTYNTLAQTLI 123
           P+ P P     ER  + I+++        S  Q+T       +     +++YNTL Q   
Sbjct: 463 PEIPLPH----ERRFIEINTDGEPQREYDSLQQSTEHLATDLAKRTFTVLSYNTLCQHYA 518

Query: 124 RRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNEL-KFWRENFHKLGFDLS 181
               +  + S AL W  R   L  ++ +Y  D++ LQEV+     ++W     K G+   
Sbjct: 519 TPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEEYWVPLLDKHGYTGI 578

Query: 182 FR----------RNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTR------ 225
           F           ++  K  G  + +  ++F+L  +  +D+      +    RT       
Sbjct: 579 FHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRA 638

Query: 226 --TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP-------FGVFERLRQSYLVLQK- 275
               N+AL + L+       S + I    THL W P       F V   L     +L++ 
Sbjct: 639 MNKDNVALFLKLQ----HIPSGDTIWAVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEE 694

Query: 276 -----IQEIKDFPKYHGWHSLLMGDFNT 298
                 Q+IK FP       L+ GDFN+
Sbjct: 695 TSHNFRQDIKKFP------VLICGDFNS 716

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/218 (24%), Positives = 94/218 (43%), Gaps = 50/218 (22%)

Query: 104 TSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHEL-KTYTPDIVSLQEV 161
            SS+  + ++TYN L+   +    +       K W+ R K+L +EL   +  DI+ LQE+
Sbjct: 24  VSSNKTLSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQEL 83

Query: 162 ---DYNELKFWRENF-HKLGFDLSFRR-------NGG--KTHGLLVAWNNEKFQL----- 203
              DYN+  FWR+    +L +  +F           G  +  G+   +N EK +      
Sbjct: 84  TTEDYNQ--FWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTV 141

Query: 204 -------------DNEWMLDY---------DQILAGNVISARTRTKNIALIVSLRFKDTR 241
                        + +WM            D +   +++S       + L V LR KDT+
Sbjct: 142 IYLNDFLSMFSKRELDWMSRRQITQTNGANDPVTTRSLLSILLDRNQVCLFVCLREKDTK 201

Query: 242 NASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI 279
           +     IVV NTHL+W    V  +L Q   +++K++++
Sbjct: 202 SL----IVVVNTHLYWKYDEV--KLSQCLTIMRKLKQV 233

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 90/232 (38%), Gaps = 43/232 (18%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FW 169
           +++YNTL Q       +  + S  L W  R + L +++     D++ LQEV+    + FW
Sbjct: 542 VLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVICLQEVEAQTYEDFW 601

Query: 170 RENFHKLGFDLSFR----------RNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219
                K G+   F           ++  K  G  + +   +F+L ++  +D+  +   + 
Sbjct: 602 LPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMKHK 661

Query: 220 ISARTR--------TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP---------FGV 262
              RT           N+AL V L   +    S   + V  THL W P          GV
Sbjct: 662 KFQRTEDYLNRAMNKDNVALFVKLEHIN----SGESVWVVTTHLHWDPQFNDVKTFQVGV 717

Query: 263 ----FERLRQSYLVLQKIQEIKDFPKYHGWHSLLMGDFNTEPEEPPYLAITS 310
                E L + Y      QEI+  P       ++ GD N+  +   Y  +++
Sbjct: 718 LLDHLESLLKDYNNASSKQEIRKCP------VIICGDLNSHLQSAVYELLST 763

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 104/255 (40%), Gaps = 63/255 (24%)

Query: 101 IQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHE-LKTYTPDIVSL 158
           I+  +S      MTYN L+   +    +       K W  R ++L  E L  Y  DI+ +
Sbjct: 25  IKNGTSRSTFTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCV 84

Query: 159 QEV---DYNELKFWRENFH-KLGFDLSF---------RRNGGKTHGLLVAWNNEKFQ--- 202
           QE+   DY+   FW+ +F  K+ +  SF         +R   +  G+ + +N +KF+   
Sbjct: 85  QELTCKDYD--GFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHIS 142

Query: 203 -----------LDNEWMLDY----------------DQILAGNVISARTRTKNIALIVSL 235
                      L N   L+Y                D+    NV+  R +   ++L VSL
Sbjct: 143 TTSIYLNDLIGLFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQ---VSLFVSL 199

Query: 236 RFKDTRNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI-------KDFPKYHGW 288
             K+TR       VV NTHL+W    V  +L Q   +++K+  +       ++   Y   
Sbjct: 200 MHKETRTL----FVVINTHLYWKYDEV--KLCQCLTIMRKLHRVIKSLLMGREGVTYSKV 253

Query: 289 HSLLMGDFNTEPEEP 303
             L  GD N+ P+ P
Sbjct: 254 KILFAGDLNSAPDSP 268

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/225 (25%), Positives = 94/225 (41%), Gaps = 58/225 (25%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHEL-KTYTPDIVSLQEV---DYNEL 166
           ++TYN L+   +    +       K W  R ++L  EL KTY  DI+ LQE+   DY+  
Sbjct: 32  LLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQELTTKDYHN- 90

Query: 167 KFWRENFHK-LGFDLSF---------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQIL- 215
            FW +   + L +  +F         +R   +  G+ + +N +KF+  +   +  + +L 
Sbjct: 91  -FWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSIYLNDVLG 149

Query: 216 --------------------AG------NVISARTRTKNIALIVSLRFKDTRNASTNGIV 249
                               AG      N+++       + L VSLR KDT        V
Sbjct: 150 IFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDTNTV----FV 205

Query: 250 VANTHLFWHPFGVFERLRQSYLVLQKIQEIKDFPKYHGWHSLLMG 294
           V NTHL+W    V  +L Q   +++K++ I          SLLMG
Sbjct: 206 VINTHLYWKYDEV--KLSQCLTIMRKLERII--------KSLLMG 240

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 104/262 (39%), Gaps = 44/262 (16%)

Query: 70  PDFPTP-DLQFIE-----RPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLI 123
           P+ P P D +FIE      P     + + A    SS +Q  S      +++YNTL Q   
Sbjct: 496 PEVPYPHDRKFIEINADGEPEKEYDTVQEAERNLSSDMQKKS----FTMLSYNTLCQHYA 551

Query: 124 RRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLS 181
               +  + S AL W  R + L  ++  +  DI+ LQEV+    + FW+    K G+   
Sbjct: 552 TPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFEDFWQPLLEKHGYTGL 611

Query: 182 F----------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTR------ 225
           F           ++  K  G    +   KF++  +  +D+  +   +    RT       
Sbjct: 612 FHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMKHKKFQRTEDYLNRA 671

Query: 226 --TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP-------FGVFERLRQSYLVLQKI 276
               N+A+++ L+       S   + +  THL W P       F V   L     +L++ 
Sbjct: 672 MNKDNVAIVMKLQHIQ----SGEIMWLVTTHLHWDPKFNDVKTFQVGVLLDHMETLLKEQ 727

Query: 277 QEIKDFPKYHGWHSLLMGDFNT 298
              +D  KY     ++ GD N+
Sbjct: 728 NPKQDVKKY---PLVICGDLNS 746

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 90/208 (43%), Gaps = 46/208 (22%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHEL-KTYTPDIVSLQEVDYNE-LKF 168
           ++TYN L+   +    +       K W  R  +L  EL +TY  D++ LQE+ + + L +
Sbjct: 39  LLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELTWEDYLSY 98

Query: 169 WRENFHK-LGFDLSF---------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQIL--- 215
           W+  F K L +   F          +   +  G  + +N +KF+  +   L  + ++   
Sbjct: 99  WKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRLFLNDVVNTF 158

Query: 216 ------------------AGNVISART-----RTKN-IALIVSLRFKDTRNASTNGIVVA 251
                             AGN +   T     + +N + L VSL+ K+T N      VV 
Sbjct: 159 EEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCLFVSLKHKETNNV----FVVI 214

Query: 252 NTHLFWHPFGVFERLRQSYLVLQKIQEI 279
           NTHL+W    V  +L Q  ++++K+ +I
Sbjct: 215 NTHLYWKYDEV--KLTQCMIIMRKLSQI 240

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 102/253 (40%), Gaps = 59/253 (23%)

Query: 101 IQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHE-LKTYTPDIVSL 158
           I+ + S     +MTYN L+   +    +       K W  R ++L  E L  Y  DI+ +
Sbjct: 21  IRNSVSRSTFTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCV 80

Query: 159 QEVDYNELK-FWRENFH-KLGFDLSF---------RRNGGKTHGLLVAWNNEKFQ----- 202
           QE+   + + FW+ +F  K+ +  S+         +R   +  G+ + +N  KF+     
Sbjct: 81  QELTCKDYEGFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTS 140

Query: 203 ---------LDNEWMLDY----------------DQILAGNVISARTRTKNIALIVSLRF 237
                    L N   L+Y                D+    NV+  R +   ++L VSL  
Sbjct: 141 SIYLNDLIGLFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQ---VSLFVSLLH 197

Query: 238 KDTRNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI-------KDFPKYHGWHS 290
           K+TR       VV NTHL+W    V  +L Q   +++K+  +        +   Y     
Sbjct: 198 KETRTL----FVVVNTHLYWKYDEV--KLCQCLTIMRKLHRVIKSLLMGMEGVTYSKVKI 251

Query: 291 LLMGDFNTEPEEP 303
           L  GD N+ P+ P
Sbjct: 252 LFAGDLNSAPDSP 264

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 66/168 (39%), Gaps = 24/168 (14%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNEL-KFW 169
           I++YNTL Q       +  + S AL W  R + L  ++ +Y  DI+ LQEV+     +FW
Sbjct: 571 ILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEEFW 630

Query: 170 RENFHKLGFDLSFR----------RNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219
                K  +   F           +   K  G  + +   KF+L  +  +D+      + 
Sbjct: 631 GPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMKHK 690

Query: 220 ISARTR--------TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP 259
              RT           N+AL + L+       S   + V  THL W P
Sbjct: 691 KFQRTEDYLNRAMNKDNVALYMKLQ----SITSGETVWVVTTHLHWDP 734

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 97/247 (39%), Gaps = 52/247 (21%)

Query: 88  SSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRRDFFPQSGS-ALKWHKRSKVLVH 146
           S ++N N   ++ ++ +       +++YNTL         +  + S AL W  R + L  
Sbjct: 437 SLQENTNHMNNTLLKNS-----FTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKE 491

Query: 147 ELKTYTPDIVSLQEVD---YNELKFWRENFHKLGFDLSFR----------RNGGKTHGLL 193
           +L  +  D++ LQEV+   Y E  +W     K  +   F           ++  K  G  
Sbjct: 492 QLLDFDTDVICLQEVETLTYEE--YWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCA 549

Query: 194 VAWNNEKFQLDNEWMLDYDQILAGNVISARTR--------TKNIALIVSLRFKDTRNAST 245
           + +  ++FQL  +  +D+      +    RT           N+ALI  L+  +T     
Sbjct: 550 IFYKKDQFQLVFQDSIDFSSAWRSHKKFHRTEDYLNRAMNKDNVALIAELKHLNTN---- 605

Query: 246 NGIVVANTHLFWHP---------FGV----FERLRQSYLVLQKIQEIKDFPKYHGWHSLL 292
             + V  THL W P          GV     E L + +  +    +IK  P       ++
Sbjct: 606 ENVWVVTTHLHWDPQFNDVKTFQVGVMLDYLETLIKQHHHVNNNNDIKKIPM------VI 659

Query: 293 MGDFNTE 299
            GDFN++
Sbjct: 660 CGDFNSQ 666

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 96/210 (45%), Gaps = 50/210 (23%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHEL-KTYTPDIVSLQEV---DYNEL 166
           +++YN L+ + +    +       K W+ R K+L  EL   Y  DI+ LQE+   DY+  
Sbjct: 24  LLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYS-- 81

Query: 167 KFWRENFH-KLGFDLSF---------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQIL- 215
            FW++     + +  ++         +R   +  G+ + +N +KF+  +   +  +Q+L 
Sbjct: 82  NFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLLG 141

Query: 216 --------------------AGNVISART-----RTKN-IALIVSLRFKDTRNASTNGIV 249
                               AGN +  ++     ++KN +AL VSL+ K+T N      V
Sbjct: 142 VFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNV----FV 197

Query: 250 VANTHLFWHPFGVFERLRQSYLVLQKIQEI 279
           V NTHL+W    V  +L Q  ++++++  I
Sbjct: 198 VINTHLYWKYDDV--KLTQCMIIMRELARI 225

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 100/251 (39%), Gaps = 37/251 (14%)

Query: 81  ERPLLHISSEKNANDFKSSFIQATSS-SLDIK-----IMTYNTLAQTLIRRDFFPQSGS- 133
           ER  + I+++        S  Q+T   S+D+      +++YNTL Q       +  + S 
Sbjct: 472 ERRFIEINTDGEPQREYDSLQQSTEHLSVDLAKRTFTVLSYNTLCQHYATPKMYRYTPSW 531

Query: 134 ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLSF---------- 182
           AL W  R   L  ++ +Y  D++ LQEV+    + +W     K G+   F          
Sbjct: 532 ALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEDYWVPLLDKHGYTGIFHAKARAKTMH 591

Query: 183 RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTR--------TKNIALIVS 234
            ++  K  G  + +  ++F+L  +  +D+      +    RT           N+AL + 
Sbjct: 592 SKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLK 651

Query: 235 LRFKDTRNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIKDFPKYHGWHS---- 290
           L+       S + I    THL W P     +  Q  ++L  ++ +      H +      
Sbjct: 652 LQ----HIPSGDTIWAVTTHLHWDPKFNDVKTFQVGVLLDHLETLLREETTHNFRQDIKK 707

Query: 291 ---LLMGDFNT 298
              L+ GDFN+
Sbjct: 708 SPVLICGDFNS 718

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 68/168 (40%), Gaps = 24/168 (14%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNEL-KFW 169
           +++YNTL Q       +  + S AL W  R + L  ++ ++  D++ LQEV+     +FW
Sbjct: 454 VLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEEFW 513

Query: 170 RENFHKLGFDLSF----------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNV 219
                K G+  +F           ++  K  G  + +   +F +  +  +D+  +   + 
Sbjct: 514 LPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMKHK 573

Query: 220 ISARTR--------TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP 259
              RT           N+AL + L        S   + V  THL W P
Sbjct: 574 KFQRTEDYLNRAMNKDNVALYMKLE----HIKSGESVWVVTTHLHWDP 617

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 94/213 (44%), Gaps = 56/213 (26%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHEL-KTYTPDIVSLQEV---DYNEL 166
           ++TYN L+ + +    +       K W  R K+L  EL  T+  DI+ LQE+   DY + 
Sbjct: 29  LLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFKADIMCLQEMTARDYED- 87

Query: 167 KFWRENFHKLGFDLSFR------------RNGGK-THGLLVAWNNEKFQLDNEWMLDYDQ 213
            +WR+    +G D+++             +N  K   G+ + +N EKF   +   +  +Q
Sbjct: 88  -YWRD---YIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGIYLNQ 143

Query: 214 IL---------------------AGNVISART-----RTKN-IALIVSLRFKDTRNASTN 246
           +L                     A N++   +     + KN + L VSL+ K+T      
Sbjct: 144 LLNVFNERELKYLFNKKVTLTDGASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGTV--- 200

Query: 247 GIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI 279
             VV NTHL+W    V  +L Q  ++++++ +I
Sbjct: 201 -FVVLNTHLYWKYDEV--KLTQCMIIMRELSKI 230

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 86/208 (41%), Gaps = 46/208 (22%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHEL-KTYTPDIVSLQEVDYNE-LKF 168
           ++TYN L+   +    +       K W  R K+L  EL + Y  DI+ LQE+ + + + +
Sbjct: 50  MLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDYISY 109

Query: 169 WRENFH-KLGFDLSF---------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQIL--- 215
           W+   + K+ +   F          +   +  G  + +N EKF+  +   L  + ++   
Sbjct: 110 WKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVVGTF 169

Query: 216 ------------------AG------NVISARTRTKNIALIVSLRFKDTRNASTNGIVVA 251
                             AG      N+ +  T    + L VSLR K    A+    VV 
Sbjct: 170 EEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLRHK----ATNTVFVVI 225

Query: 252 NTHLFWHPFGVFERLRQSYLVLQKIQEI 279
           NTHL+W    V  +L Q  ++++K+  I
Sbjct: 226 NTHLYWKYDEV--KLTQCMIIMRKLSHI 251

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 61/270 (22%), Positives = 106/270 (39%), Gaps = 57/270 (21%)

Query: 70  PDFP-TPDLQFIE-----RPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLI 123
           PD P   D +FIE      P     S ++A    S  ++  S      +++YNTL Q   
Sbjct: 522 PDIPLMKDRKFIEINTDGEPQTEYDSIEDATSHLSRDLEKRS----FTVLSYNTLCQHYA 577

Query: 124 RRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVD---YNELKFWRENFHKLGFD 179
               +  + S AL W  R   L  ++ ++  DI+ LQEV+   Y++  FW     K G+ 
Sbjct: 578 TPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDD--FWEPLLQKHGYK 635

Query: 180 LSFR----------RNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTR---- 225
             F           ++  K  G  + +   +F++  +  +D+  I   +    RT     
Sbjct: 636 GIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMKHKNFQRTEDYLN 695

Query: 226 ----TKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP---------FGV----FERLRQ 268
                 N+A  + ++ +  ++     IV   THL W P          GV     E L +
Sbjct: 696 RAMNKDNVA--IYMKLQHIKSGEVTWIVT--THLHWDPQFNDVKTFQVGVLLDHLESLLK 751

Query: 269 SYLVLQKIQEIKDFPKYHGWHSLLMGDFNT 298
            +  +   Q++K  P       ++ GD N+
Sbjct: 752 EHSNIHSKQDVKKCP------IIICGDLNS 775

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 88/212 (41%), Gaps = 50/212 (23%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHEL-KTYTPDIVSLQEV---DYNEL 166
           ++TYN L+ + +    +       K W  R K+L  EL  +Y  DI+ LQE+   DYNE 
Sbjct: 32  LLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDYNE- 90

Query: 167 KFWRENFHK-LGFDLSF---------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQIL- 215
             W+      +G+   F          R   +  G+ + +N +KF   +   +  +Q L 
Sbjct: 91  -NWKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFDFISSSGIYLNQFLN 149

Query: 216 --------------------AG------NVISARTRTKNIALIVSLRFKDTRNASTNGIV 249
                               AG      N++   +    + L VSL+ K+T        V
Sbjct: 150 VFSSTELEYLHSKRLVLTDGAGVPIGEKNLLDVISGKNQVCLFVSLKHKETGEM----FV 205

Query: 250 VANTHLFWHPFGVFERLRQSYLVLQKIQEIKD 281
           V NTHL+W    V  +L Q  ++++++ +I D
Sbjct: 206 VINTHLYWKYDEV--KLTQCMIIMRELSKIID 235

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 92/209 (44%), Gaps = 50/209 (23%)

Query: 113 MTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHE-LKTYTPDIVSLQEV---DYNELK 167
           MTYN L+   +    +       K W+ R K+L  E L +Y  DI+ LQE+   DY++  
Sbjct: 32  MTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDYHQ-- 89

Query: 168 FWRE----NFHKLGFDLS------FRRNGGKTHGLLVAWNNEKFQ--------------- 202
           +W E    +FH     ++      ++++     G+ + +N  KF                
Sbjct: 90  YWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLIGS 149

Query: 203 --LDNEWMLDYDQIL----AGNVISART-----RTKN-IALIVSLRFKDTRNASTNGIVV 250
             LD    L   Q+     AGN    +T     +++N + L V+L+ KDT        VV
Sbjct: 150 FDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALKHKDTNTI----FVV 205

Query: 251 ANTHLFWHPFGVFERLRQSYLVLQKIQEI 279
            NTHL+W    V  +L Q  ++++K+ +I
Sbjct: 206 INTHLYWKYDEV--KLTQCLIIMRKLAKI 232

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 91/211 (43%), Gaps = 52/211 (24%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHEL-KTYTPDIVSLQEVDYNELK-F 168
           ++TYN L+ + +    +       K W+ R K+L  EL  T+  DI+ LQE+   + + +
Sbjct: 29  LLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDYENY 88

Query: 169 WRENFHKLGFDLSF-------------RRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQIL 215
           W    + +G D+++              +      G+ + +N EKF   +   +  +Q+L
Sbjct: 89  WH---NSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLNQLL 145

Query: 216 ---------------------AGNVISART-----RTKN-IALIVSLRFKDTRNASTNGI 248
                                A NVI   +     + KN + L VSL+ K+T        
Sbjct: 146 NVFNERELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLKHKETNTI----F 201

Query: 249 VVANTHLFWHPFGVFERLRQSYLVLQKIQEI 279
           VV NTHL+W    V  +L Q  ++++++ +I
Sbjct: 202 VVLNTHLYWKYDEV--KLTQCMIIMRELSKI 230

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 95/231 (41%), Gaps = 50/231 (21%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGSALK-WHKRSKVLVHE-LKTYTPDIVSLQEVDYNELK-F 168
           ++TYN L+Q+ +    +    +  K W  R K+L +E LK Y  DI+ LQE+   + + +
Sbjct: 24  LLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYEYY 83

Query: 169 WRENFHKL--GFDLSFR-------RNGGKTHGLLVAWNNEKFQL-DNEWM---------- 208
           WR+   K   G D   +       +      G+ + +N + F+L D+  +          
Sbjct: 84  WRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLISDF 143

Query: 209 ----LDY-------------DQILAGNVISARTRTKNIALIVSLRFKDTRNASTNGIVVA 251
               LDY              QI   N++        + L ++L+ K T           
Sbjct: 144 EQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKNQVCLFMTLKHKRTGATVVV----V 199

Query: 252 NTHLFWHPFGVFERLRQSYLVLQKIQEI-KDFPKYHG---WHSLLMGDFNT 298
            THL+W    +  +L Q  ++++++ +I KD  K  G      L  GD N+
Sbjct: 200 TTHLYWKYDEI--KLTQCMIIMRQLSKIMKDQLKKDGSSFVKVLFAGDLNS 248

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 61/168 (36%), Gaps = 24/168 (14%)

Query: 112 IMTYNTLAQTLIRRDFFPQSGS-ALKWHKRSKVLVHELKTYTPDIVSLQEVDYNEL-KFW 169
           +++YNTL Q       +  + S AL W  R + L  ++ +Y  DI+ LQEV+     +FW
Sbjct: 528 LLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEEFW 587

Query: 170 RENFHKLGFDLSF----------RRNGGKTHGLLV--------AWNNEKFQLDNEWMLDY 211
                K  +   F           ++  K  G  +            E       WM   
Sbjct: 588 SPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDFSGTWMKHK 647

Query: 212 DQILAGNVISARTRTKNIALIVSLRFKDTRNASTNGIVVANTHLFWHP 259
                 + ++      N+AL + L+       S   + V  THL W P
Sbjct: 648 KFQRTEDYLNRAMNKDNVALYLKLQ----SLTSGESVWVVTTHLHWDP 691

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
           (REAL)
          Length = 1037

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 143 VLVHELKTYTPDIVS-LQEVDYNELKFWRE 171
           +L+  LK Y PDIVS +Q+V   E+KFW +
Sbjct: 885 ILLFALKQYRPDIVSEVQKVREKEIKFWAQ 914

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
           (REAL)
          Length = 1036

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 143 VLVHELKTYTPDIVS-LQEVDYNELKFWRE 171
           +L+  LK Y PDI+S +Q+V   E+KFW +
Sbjct: 884 ILLFALKQYRPDIISEIQKVREKEIKFWAQ 913

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
           protein of unknown function; deletion mutant has
           decreased rapamycin resistance but normal wormannin
           resistance; green fluorescent protein (GFP)-fusion
           protein localizes to the vacuole
          Length = 1036

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 143 VLVHELKTYTPDIVS-LQEVDYNELKFWRE 171
           +L+  LK Y PDI+S +Q+V   E+KFW +
Sbjct: 884 ILLFALKQYRPDIISEVQKVREKEIKFWAQ 913

>TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}
           Anc_3.188 YBR015C
          Length = 957

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 444 QEKSLNVFEEN---NGVNVIGYLRMPCKQEMPKHSQPFE 479
           ++K   + EEN   NGVNVI Y  +P  Q++PK   P E
Sbjct: 868 RKKKQELMEENKRKNGVNVIKYAPIPEGQDVPKGFNPME 906

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,940,236
Number of extensions: 2429577
Number of successful extensions: 6251
Number of sequences better than 10.0: 76
Number of HSP's gapped: 6202
Number of HSP's successfully gapped: 78
Length of query: 502
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 388
Effective length of database: 40,409,475
Effective search space: 15678876300
Effective search space used: 15678876300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)