Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.1576.20ON1090109057680.0
Skud_13.1526.20ON1090109046730.0
Suva_13.1606.20ON1090109044980.0
YML002W6.20ON73773731950.0
TDEL0G044906.20ON1093109422080.0
ZYRO0C07810g6.20ON1099107820590.0
Sklu_YGOB_Anc_6.20b6.20ON1088110319610.0
NCAS0H008206.20ON1146110216770.0
Sklu_YGOB_Anc_6.20singletonOFF84986616470.0
CAGL0L07634g6.20ON1130108616470.0
Kpol_1037.256.20ON1105108816270.0
Kwal_56.224246.20ON1089109916170.0
KLTH0C11242g6.20ON1097110915970.0
Ecym_30246.20ON1079108615700.0
ACR006C6.20ON1071108615200.0
KNAG0M011606.20ON1131114615180.0
TPHA0J003306.20ON1107110414670.0
NDAI0D008006.20ON1193117414141e-176
YML003WsingletonOFF29028913241e-175
KLLA0D01133g6.20ON1067108612871e-158
TBLA0A072606.20ON1204122611461e-137
KAFR0L004006.20ON9428468399e-96
Kpol_463.131.264ON799232800.86
TDEL0A067806.265ON20066732.9
TDEL0E055704.50ON1907145754.2
ZYRO0F09570g5.414ON835342754.2
Kwal_47.190673.523ON88191745.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.157
         (1090 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...  2226   0.0  
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...  1804   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...  1737   0.0  
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...  1235   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   855   0.0  
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   797   0.0  
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   759   0.0  
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   650   0.0  
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   639   0.0  
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   639   0.0  
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   631   0.0  
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   627   0.0  
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   619   0.0  
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   609   0.0  
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   590   0.0  
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   589   0.0  
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   569   0.0  
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   549   e-176
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   514   e-175
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   500   e-158
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   446   e-137
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   327   9e-96
Kpol_463.13 s463 complement(35514..37913) [2400 bp, 799 aa] {ON}...    35   0.86 
TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {...    33   2.9  
TDEL0E05570 Chr5 (1025692..1031415) [5724 bp, 1907 aa] {ON} Anc_...    33   4.2  
ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} simila...    33   4.2  
Kwal_47.19067 s47 complement(1083210..1085855) [2646 bp, 881 aa]...    33   5.3  

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 2226 bits (5768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1083/1090 (99%), Positives = 1083/1090 (99%)

Query: 1    MSISHLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKL 60
            MSISHLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKL
Sbjct: 1    MSISHLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKL 60

Query: 61   PLHELCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVR 120
            PLHELCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVR
Sbjct: 61   PLHELCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVR 120

Query: 121  RRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVH 180
            RRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVH
Sbjct: 121  RRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVH 180

Query: 181  NLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGM 240
            NLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGM
Sbjct: 181  NLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGM 240

Query: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLLADFYS 300
            KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLLADFYS
Sbjct: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLLADFYS 300

Query: 301  KDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLD 360
            KDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLD
Sbjct: 301  KDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLD 360

Query: 361  VPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGILGYAVSTL 420
            VPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNF       KFGILGYAVSTL
Sbjct: 361  VPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILGYAVSTL 420

Query: 421  EAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQG 480
            EAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQG
Sbjct: 421  EAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQG 480

Query: 481  QSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILI 540
            QSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILI
Sbjct: 481  QSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILI 540

Query: 541  RIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPLFSI 600
            RIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPLFSI
Sbjct: 541  RIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPLFSI 600

Query: 601  FRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTK 660
            FRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTK
Sbjct: 601  FRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTK 660

Query: 661  LDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTVLSK 720
            LDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTVLSK
Sbjct: 661  LDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTVLSK 720

Query: 721  VGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILKD 780
            VGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILKD
Sbjct: 721  VGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILKD 780

Query: 781  NPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEA 840
            NPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEA
Sbjct: 781  NPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEA 840

Query: 841  SILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILI 900
            SILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILI
Sbjct: 841  SILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILI 900

Query: 901  FISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEHVRFLEEC 960
            FISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEHVRFLEEC
Sbjct: 901  FISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEHVRFLEEC 960

Query: 961  TIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLGGFIE 1020
            TIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLGGFIE
Sbjct: 961  TIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLGGFIE 1020

Query: 1021 TKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAA 1080
            TKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAA
Sbjct: 1021 TKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAA 1080

Query: 1081 TNISVLQENI 1090
            TNISVLQENI
Sbjct: 1081 TNISVLQENI 1090

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 1804 bits (4673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 855/1090 (78%), Positives = 970/1090 (88%)

Query: 1    MSISHLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKL 60
            MS+ HLPTLLNPLINAIFNCPEPEKSPLKKLFA LKT RFILLAPP  +LLNYHDVKTKL
Sbjct: 1    MSVYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKL 60

Query: 61   PLHELCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVR 120
            PLHELCYN +FINSHILL TENS++NT  RDSHYETLDGK VVIQWKNN+IHALNGF +R
Sbjct: 61   PLHELCYNVDFINSHILLTTENSYLNTTLRDSHYETLDGKAVVIQWKNNIIHALNGFPIR 120

Query: 121  RRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVH 180
            +RLKIL TK+LPNFNDYFEGA DF I++I+QPL+CE  PNDYL+CF SY+++PK+  SV 
Sbjct: 121  QRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKCFDSYEEVPKNAQSVS 180

Query: 181  NLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGM 240
            NL ++S +QERSSF+NILHIH  RL QLG++FSNYR LAP+DDPS+K+FE IVQQ+F+GM
Sbjct: 181  NLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRRLAPNDDPSKKMFEDIVQQSFDGM 240

Query: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLLADFYS 300
            KSDSLFK F NLYDLIH+YFELNLYDDIWSRL +HFK YEV TE+YKYFS+N LLADF+S
Sbjct: 241  KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFS 300

Query: 301  KDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLD 360
            KDF+EFKL D+TFIE+RV++ASKHFQKLTLTHSY EKSKILVETLQ+LSG T++ SHQ +
Sbjct: 301  KDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQE 360

Query: 361  VPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGILGYAVSTL 420
            +P  LN+L MDADTL+SLFVLV+CRSEQKHLKSHLYYLQNF       KFGILGYA+STL
Sbjct: 361  LPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTL 420

Query: 421  EAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQG 480
            EAVVCYFEDF KN++N+AKANV  QKT+ L++ LS EN TN++ENLATY+D L YRN QG
Sbjct: 421  EAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLSSENPTNEIENLATYEDNLQYRNEQG 480

Query: 481  QSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILI 540
            QSILSICI+N KN ILLD+L+EY+ +FP+ED+LEDET+DGSTLLIESIK+GN+EAAKILI
Sbjct: 481  QSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILI 540

Query: 541  RIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPLFSI 600
             IM+LNC+E EL+SY+N+ DKY+RTVAHYLTHE+DILKSIG+YVDWKRKNS GQTPLFSI
Sbjct: 541  GIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSIGSYVDWKRKNSSGQTPLFSI 600

Query: 601  FRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTK 660
            FR+YDQPNYE MVKIAFNIAN+WY+K N SFDY DHTD+KGN LLH+LK+D SILLQL+K
Sbjct: 601  FRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQLSK 660

Query: 661  LDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTVLSK 720
            LDING NYKGLTPLM+YVKYKR++NI+AI KD RL+LEK+Q STFFTCFDYAKDH+VLSK
Sbjct: 661  LDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKDHSVLSK 720

Query: 721  VGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILKD 780
            +GERGA+DSLFGL+Y HSLRYHNLNA  NIT AS+T+KPF  TVINMKTIQGLLRSILKD
Sbjct: 721  IGERGARDSLFGLVYLHSLRYHNLNATTNITTASNTDKPFLTTVINMKTIQGLLRSILKD 780

Query: 781  NPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEA 840
            N FTFLPLN YIDEIS L+RSD+TIIGKADV SLLHKL+NCFNVLLFLKKVP++LFTDEA
Sbjct: 781  NQFTFLPLNSYIDEISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840

Query: 841  SILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILI 900
            S+LYWMRINTSKRNQK PSK+N KTMEPEEINMIQSFLRFNFDEISSFKASL+ILRKILI
Sbjct: 841  SVLYWMRINTSKRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILI 900

Query: 901  FISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEHVRFLEEC 960
            F+SLKSNDF+D  D+L EMG+ I N +AADAFA   TNHNMF+D +LA+LLEHV FLE+C
Sbjct: 901  FLSLKSNDFEDTYDSLREMGRKIINGEAADAFARIFTNHNMFSDLALAELLEHVSFLEQC 960

Query: 961  TIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLGGFIE 1020
            TIQLS  VQ IL +KI  WWKHYGE + L KNYRKAFPSVVKPKS TDT  HI LG FIE
Sbjct: 961  TIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPLGSFIE 1020

Query: 1021 TKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAA 1080
            TKREQSEQRLAVQIK SSK LKELGSEIF AHEKLAEELSNYMEFRKACL+QR IVAFA 
Sbjct: 1021 TKREQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKACLDQRTIVAFAT 1080

Query: 1081 TNISVLQENI 1090
            TNI + QE I
Sbjct: 1081 TNIGIFQEYI 1090

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score = 1737 bits (4498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 843/1090 (77%), Positives = 954/1090 (87%)

Query: 1    MSISHLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKL 60
            MSI HLPTLLNPLINAIFNCPEPEKSPLKKLFA L+T RFILLAPPS  LLNYHDVKTKL
Sbjct: 1    MSIYHLPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKL 60

Query: 61   PLHELCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVR 120
            PLHELCYNA+FINSHILL TENS+INT  RD HYETLDGKTVV+QWKNNVIH LNGF +R
Sbjct: 61   PLHELCYNADFINSHILLTTENSYINTTLRDDHYETLDGKTVVVQWKNNVIHTLNGFPLR 120

Query: 121  RRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVH 180
            RRLKIL TKILPNFNDYF+GA  F I+YI+QPL CE VPNDYL CF+SY++  K+  +  
Sbjct: 121  RRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPNDYLHCFNSYEETSKTARNAP 180

Query: 181  NLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGM 240
            NL +D+SQ ERSSFENILHIHP  LTQLG++FSNYR  A +DDPS+K+FE +V+QAF+GM
Sbjct: 181  NLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKMFEELVEQAFDGM 240

Query: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLLADFYS 300
            KSDSLFK F NLYDLIH+YFELNLY+DIWSRLT HFK YEV TE  +YFS+N LL D+YS
Sbjct: 241  KSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDYYS 300

Query: 301  KDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLD 360
            KDF  FKL D+TFIE+RV +ASKHFQKL L+HSY EKSKILVETLQ LSGTTDMGSH+ D
Sbjct: 301  KDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPD 360

Query: 361  VPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGILGYAVSTL 420
            +    NNL MDADTLISLFVLV+CRSEQKH++SHLYYLQNF       KFGILGYA+STL
Sbjct: 361  LSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFGILGYAISTL 420

Query: 421  EAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQG 480
            EAVVCYFE+F KN++N+AKAN+L  KT+ L++ LSCEN TN+V +LATYKDIL YRN QG
Sbjct: 421  EAVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQG 480

Query: 481  QSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILI 540
            QSILS+CI+NNKN ILLD+LSEY+++FP+ED+LEDETIDGSTLLIESIK GNLEA KILI
Sbjct: 481  QSILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILI 540

Query: 541  RIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPLFSI 600
            RIM+ NCT+EEL++Y+N+TDKY+R+VAHYLTHE+DILKSIG+Y++WK+KNS GQTPLFSI
Sbjct: 541  RIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEMDILKSIGSYINWKQKNSSGQTPLFSI 600

Query: 601  FRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTK 660
            FRSYDQPNYE MVK+AFNIA++WY++ N SF Y DHTDNKGN LLHVLKTD SILLQLTK
Sbjct: 601  FRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLTK 660

Query: 661  LDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTVLSK 720
            L+INGENYKGLTPLMVYVKYKRL+NI+AI KD RL+LEK+Q STFFTCFDYAKD  VLSK
Sbjct: 661  LNINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDRLVLSK 720

Query: 721  VGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILKD 780
            +GERGA DS+FGLIY HSLRYHNLNA VN+T  S TE+PF   VINMKTIQGLLRSI+KD
Sbjct: 721  IGERGANDSIFGLIYLHSLRYHNLNATVNVTSVSKTEEPFVTAVINMKTIQGLLRSIVKD 780

Query: 781  NPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEA 840
            NPFTFLP++ YID IS L+RSD+TIIGKADV SLLHKL+NCFNVLLFLKKVP++LFTDEA
Sbjct: 781  NPFTFLPIDNYIDGISHLNRSDLTIIGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEA 840

Query: 841  SILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILI 900
            S+LYWMRINTS+RNQK PSK+N KTMEPEEINMIQSFLRFNFDEI SFKASL+ILRKILI
Sbjct: 841  SVLYWMRINTSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKILI 900

Query: 901  FISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEHVRFLEEC 960
            F+SLKS+DF+D   +L +MG  + N KAADAF   + NH MF+D SL +LLEHV+FLEEC
Sbjct: 901  FLSLKSSDFEDAYASLLKMGTKVTNGKAADAFTTIIKNHKMFSDLSLDELLEHVQFLEEC 960

Query: 961  TIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLGGFIE 1020
            TIQL N +Q IL ++IPNWWKHYGE +TLHKNYRKAFPS VKPKST  TS HI LGGFIE
Sbjct: 961  TIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTSSHIPLGGFIE 1020

Query: 1021 TKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAA 1080
            TKREQSEQRL+VQIK SSK LKELGSEIF AHE LAEELSNYMEFRKACL+QR IVAFA 
Sbjct: 1021 TKREQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKACLDQRTIVAFAI 1080

Query: 1081 TNISVLQENI 1090
             NISVLQE I
Sbjct: 1081 KNISVLQECI 1090

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score = 1235 bits (3195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/737 (80%), Positives = 663/737 (89%)

Query: 354  MGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGIL 413
            M SHQL++P  LNN+ MDADTLISLFVLV+CRSEQKHLKSHLYYLQNF       KFGIL
Sbjct: 1    MDSHQLELPDGLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGIL 60

Query: 414  GYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDIL 473
            GYAVSTLEAVVCYFEDF KN+ N+AKAN L +KTK L++ LSCEN TN+VE+LATYKDIL
Sbjct: 61   GYAVSTLEAVVCYFEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDIL 120

Query: 474  PYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNL 533
             YRN QGQSILSICI+N+KN+ILLDILSEY++ FP+EDLLEDETIDGSTLLIESIK+GNL
Sbjct: 121  TYRNEQGQSILSICITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNL 180

Query: 534  EAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGG 593
            EAAK+LI+IM+ NCTEEEL+SYIN+TDKY+RTVAHYLTHE+DILKSIGNY+DWKRKNS G
Sbjct: 181  EAAKVLIKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSG 240

Query: 594  QTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDAS 653
            QTPLFSIFRSYDQPNYE MVK AF+IANTWYRK N  FDY DHTDNKGN LLHVLKT+  
Sbjct: 241  QTPLFSIFRSYDQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIP 300

Query: 654  ILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAK 713
            ILLQLTKLDIN ENYKGLTPLMVYVKYKRL+NI+AI KD+RL+LEK+Q STFFTCFDYAK
Sbjct: 301  ILLQLTKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAK 360

Query: 714  DHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGL 773
            DH+VLSK+GERG KDSLFGLIYFHSLRYHNLNA  NIT  S+ EKPF+ TVINMKTIQGL
Sbjct: 361  DHSVLSKIGERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKTIQGL 420

Query: 774  LRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPK 833
            LRSILKDNPFTFLPLN YIDEIS L+RSD+TIIGK DV SLLH+L+NCFNVLLFLKK+P+
Sbjct: 421  LRSILKDNPFTFLPLNTYIDEISHLNRSDLTIIGKTDVTSLLHQLTNCFNVLLFLKKIPE 480

Query: 834  SLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLS 893
            +LFTDEASILYWMRINTSKRNQK   KEN KTMEPEEINMIQSFLRFNFDEISSFKASL+
Sbjct: 481  NLFTDEASILYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEISSFKASLN 540

Query: 894  ILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEH 953
            ILRK+LIFI+LKS+DF+D    LNEMG+ + N++A+ AF G +TNHNMF++ SLA LLE+
Sbjct: 541  ILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMFSELSLAALLEN 600

Query: 954  VRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHI 1013
            VRFLE+CTIQLS+ VQ+IL EKIPNWWKHYGE + LHK+YRKAFP++VKPKS +DTS   
Sbjct: 601  VRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRA 660

Query: 1014 QLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQR 1073
             LGGFIETKREQSEQRLAVQIK SSK LKELGSEIFVAHE+LAEELSNYMEFRKACL+QR
Sbjct: 661  PLGGFIETKREQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQR 720

Query: 1074 NIVAFAATNISVLQENI 1090
            ++VAFA TNISVLQE +
Sbjct: 721  SLVAFATTNISVLQECV 737

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/1094 (41%), Positives = 687/1094 (62%), Gaps = 29/1094 (2%)

Query: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64
            HLP LLNPL+NA+FNCP P  S LKKLF+ LK  +FILL PP + LL+ +D  +  PL E
Sbjct: 4    HLPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQE 63

Query: 65   LCYNAEFINSHILLMTE-NSFINTNSRDSH--YETLDGKTVVIQWKNNVIHALNGFQVRR 121
            LCY+ EF+ SH+LL+ E N+   T +  S   ++TL+GK V+++ +N +I   +GFQV++
Sbjct: 64   LCYSYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILTSDGFQVKK 123

Query: 122  RLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHN 181
            R  I  T +  NFN+Y      F I+ I++P+  ESV    +Q   +     +      +
Sbjct: 124  RCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRTQRVQISQTLGSGKRETKDGSS 183

Query: 182  LSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGMK 241
             +LDSSQ  +SSF+NIL IHP    +  E+F+ YR+    DDP  ++F  I+++A+  M+
Sbjct: 184  PTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYRSTPEGDDPHIELFHDIIRRAYSAMR 243

Query: 242  SDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLLADFYSK 301
            SD+LF   P+L DLI++Y ELNLYDDIW R+T HFK  EV +   +Y S++ L    Y  
Sbjct: 244  SDALFASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLETGLYPD 303

Query: 302  DFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLDV 361
             F EF L+ V  +E  + LA   F +L L H++ +K+  L++TL+ LS   D    ++  
Sbjct: 304  KFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLS-RVDKSIQEV-- 360

Query: 362  PGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGILGYAVSTLE 421
                + +A+ ADTL+SLFVLVICR++ ++LK  L+YLQNF        FG+LGYA+STLE
Sbjct: 361  ----SPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLE 416

Query: 422  AVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQGQ 481
            A VCYF++ K  S  M++     +  + LV+ LS E+ +    NL  Y+  L YR  QG+
Sbjct: 417  AAVCYFDELK-GSKKMSRLESECENARSLVDKLSSESSS---VNLIHYQKTLSYRTEQGE 472

Query: 482  SILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILIR 541
            S+LSICI+N KN IL ++LS+  S FPLED+LED+T +G TLL++S+K GN +AA +++ 
Sbjct: 473  SLLSICIANGKNDILQELLSDERS-FPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVD 531

Query: 542  IMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPLFSIF 601
            ++  +CT+EE+ +Y NR+DK  RT AHYLTHEI+IL+ IGN+ DW  K+S G T LF+IF
Sbjct: 532  LIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINILEQIGNFFDWDVKDSSGHTALFTIF 591

Query: 602  RSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTKL 661
            RSYDQPNY+ M++ +F  A  WY  + R F +  H D K N LLH+LK   SILL+   +
Sbjct: 592  RSYDQPNYDDMIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEYESV 651

Query: 662  DINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTVLSKV 721
            D+N  N KGLTPLMVY KY RL+N ++I+ D+R++L KIQ        DYAK+  +L ++
Sbjct: 652  DVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEI 711

Query: 722  GERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILKDN 781
             ++ A D+ FG  + H+L+Y + +  VNIT  +D +  F     ++KT+Q   R++L+  
Sbjct: 712  AKQSAMDTAFGKCFVHTLKYESSSWLVNITVQADRKGNFETVEFHLKTVQNFFRTVLRTC 771

Query: 782  PFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEAS 841
            P TFLPL+  +++++ L ++ ++ IGK + +  L  L+NCFNVL+  +++PK +  +E+ 
Sbjct: 772  PMTFLPLDSTLNQLASLGKARLSSIGKLETVCYLRSLTNCFNVLINSQELPKDILANESK 831

Query: 842  ILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILIF 901
            +L W+++   K  +   +    K +EPEE+++IQ FLRFN  E+S+ ++ L +++K+ IF
Sbjct: 832  LLSWIKVQY-KAFRNGTTHIFSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIF 890

Query: 902  ISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNH-----NMFNDYSLAKLLEHVRF 956
            + LKS+D +   + L  +G    +    D +   LT+H      ++ + S+  L+E +  
Sbjct: 891  LRLKSSDVEQSVELLLPLG----SEGMGDLYP--LTDHKFSCTTVYGNDSMILLVEDIDL 944

Query: 957  LEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLG 1016
            + +CTI+L + +  +L  KIP WWK YGEL+   K Y + FP +VK   T+  +G I  G
Sbjct: 945  MLKCTIRLYDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHLVKNGETSTDAGII--G 1002

Query: 1017 GFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIV 1076
              +E K+E+ E+RL+  I  + +S+ + G+ I   HE LAE+LS +MEF+ A + +  I 
Sbjct: 1003 KILEGKKEKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIK 1062

Query: 1077 AFAATNISVLQENI 1090
             +   NI  L+E +
Sbjct: 1063 RWVRENIKELKERL 1076

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/1078 (40%), Positives = 657/1078 (60%), Gaps = 40/1078 (3%)

Query: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64
            H+P LLNPL+N++FNC  P  S  KKLF  LKT RFILL PP+E LL + D ++   +++
Sbjct: 4    HIPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSMND 63

Query: 65   LCYNAEFINSHILLMTENSF----INTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVR 120
            LC N +F+ SHILL+ ++++     N ++  + Y+TL+ K V ++  +  I    GF +R
Sbjct: 64   LCQNYDFVASHILLLQQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEGFPLR 123

Query: 121  RRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCE-----SVPNDYLQCFHSYKKIPKS 175
            RR +I   +++ NFNDY  G+  F +++I+ PL         +P    Q   +       
Sbjct: 124  RRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGTLIRKIDIPRGLAQGNFN------G 177

Query: 176  VYSVHNLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQ 235
            V +  +L  D +Q+  SSFENIL +HP     L   F+ YR+   ++ P E++F  IV+Q
Sbjct: 178  VDAKGSLVRDLTQKSWSSFENILRLHPDWSNILNGYFNRYRSTPLTEGPYEELFRMIVKQ 237

Query: 236  AFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLL 295
                M +D LF+K P+LYDLI +Y ELNL+DD+W R+ + ++  E+ TE  K+ SIN L 
Sbjct: 238  VHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVNSYRKDEIDTEPLKFLSINELE 297

Query: 296  ADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMG 355
             + Y K + +F+LQDVT +EK + LA   F  L LTH++ EK+  L+ TLQ LS T +  
Sbjct: 298  TELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTLQSLSNTREQD 357

Query: 356  SHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGILGY 415
                 +P     + MDADTLIS FVLV+CR++ K++KSHL+YL+ F       KFGILGY
Sbjct: 358  MDIQTLP-----ITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKFGILGY 412

Query: 416  AVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPY 475
            A+STLEAVV YF+  K  +  + K      K K L  ++S ++    V +++ ++  L +
Sbjct: 413  AISTLEAVVFYFDGLK-GTKKLQKLQDDSNKAKELYILISDKSTGQAVLDISQFRSNLEF 471

Query: 476  RNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEA 535
            R  QG+S+LS CI N+KN +L ++L  Y+ IFPLED+L+DET+DGSTLLI+++K  N EA
Sbjct: 472  RTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLLIQALKCDNSEA 531

Query: 536  AKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQT 595
            A++++ ++  +CTE+EL  Y+NR DK  RTVAHYLTHE++IL+SIG Y++WK ++S G T
Sbjct: 532  AQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKSQDSNGHT 591

Query: 596  PLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASIL 655
            PLF+IFR YDQ NYEAM+  AF  A  WY+     F + DH DNKGN LLH++K + SIL
Sbjct: 592  PLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGNTLLHIIKNNVSIL 651

Query: 656  LQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDH 715
            L    +DIN  N KGLTPLM+Y +Y R +N++ II+DQR++L+K+Q  +F   FDYA++ 
Sbjct: 652  LDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLNSFDYARNP 711

Query: 716  TVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNIT--FASDTEKPFSNTVINMKTIQGL 773
             VL ++  +  K + F L + H L+Y   +   +IT    +  ++ +    +++KT+Q L
Sbjct: 712  LVLKELVSQAIKTTAFELAFVHHLKYEAPSWFFHITVKIGAGADEEYKTVKLHIKTLQNL 771

Query: 774  LRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPK 833
             + +LK +  +FLPL   ++++S L +S +  I K + +   + L++CF+VLL    + K
Sbjct: 772  FQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLYFFYMLTDCFDVLLRHDNLNK 831

Query: 834  SLFTDEASILYWMR-----INTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSF 888
             L   E+ ++ W+R      N SK+ QKQ      K +EPEEI ++ SFLRFN  E+S+ 
Sbjct: 832  -LVLRESRLVSWIRSQDKKCNNSKKLQKQ------KNVEPEEIGIMASFLRFNRGELSAV 884

Query: 889  KASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLA 948
            K  L  ++K+LIF+ LK+ D       L+  G     A+    F     N   F + +  
Sbjct: 885  KLKLMTMKKLLIFLKLKNTDLTHSYQFLSLFGTEYNLAQDRLLFKDLEINCCAFGEEATM 944

Query: 949  KLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTD 1008
              +  + FLE CT +L + V+ +L   IP WWK YG+++ +HK Y++ FP++ +  S T 
Sbjct: 945  TFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQKFPNISRNDSGTG 1004

Query: 1009 TSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFR 1066
                  +  F E KRE+ E +L+  +    K ++ +G  I   HE LAEELS YMEF+
Sbjct: 1005 I-----IASFFEGKREKMESKLSSDLADCKKRMRRVGDRISSTHEILAEELSKYMEFK 1057

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1103 (38%), Positives = 653/1103 (59%), Gaps = 51/1103 (4%)

Query: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64
            HLP LLNPL+N++FNCP P  SPLKK+FA+L+  RFIL+ P    LL+Y D+ T   L +
Sbjct: 4    HLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQD 63

Query: 65   LCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLK 124
            LCY  EF+ +HI+++ ++S       D  ++TL+GKTV+I+ +N ++   +GF  +RR K
Sbjct: 64   LCYTYEFVANHIIILKKDS----KYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCK 119

Query: 125  ILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLSL 184
            I  T++  NFNDY +G+  F +I+I++PL  ++V ND LQ F     +  +  S   LS 
Sbjct: 120  ITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF----GVRSTNTSSLPLST 175

Query: 185  DSSQQERSSFENILHIHPTRLTQLGEMFS------------NYRTLAPSDDPSEKIFECI 232
            D +Q+E SSFE +  +HP    QLG+ FS            N++ L    D     F+  
Sbjct: 176  DLTQREVSSFEQLFRLHP----QLGDRFSGLFKEQRQEINANFKGL----DSLVDFFDKF 227

Query: 233  VQQAFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEV-GTEEY---KY 288
              +AFE ++ +  F+    L+  +H Y ELNLYDDIW ++T  ++  E+  T +Y   KY
Sbjct: 228  NYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKY 287

Query: 289  FSINHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQEL 348
             +I+ +   FY +   +F L+ VT  EK +  A+  F++L  + S++EK+KI+++TLQ L
Sbjct: 288  IAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTL 347

Query: 349  SGTTDMGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXX 408
            +  ++     ++      ++ +DADTLI L VLV+CRS+ K+LKSHL+YLQNF       
Sbjct: 348  TDYSEFPDADIE------DVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTI 401

Query: 409  KFGILGYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLAT 468
            KFG++ YA+STLEAV+CYFED  +NS  +       ++ K+  + LSC+ V+   ++L +
Sbjct: 402  KFGVVAYALSTLEAVLCYFED-AENSGKIRSLEFNCRRNKQFWDHLSCKAVS--FDSLKS 458

Query: 469  YKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESI 528
            Y+DIL  R   G+S LS+CI       +  +L  ++   PLED+L+D+TI+GSTLL++++
Sbjct: 459  YRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTL 518

Query: 529  KSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKR 588
            ++GN   A +L+ I+  +CT  EL  Y+NR +++ RT AHYLT ++ +   IG + DW+ 
Sbjct: 519  ETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEA 578

Query: 589  KNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVL 648
            K+  G TPLF+IFRSYD P+Y  MV  AF  A+ WY  +  +F++  H D KGN LLHV+
Sbjct: 579  KDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVM 638

Query: 649  KTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTC 708
            KT+  ILL+   +D+N  N KGLTPLMVYVKY RL+N++ I++D RL++EK QKS F  C
Sbjct: 639  KTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNC 698

Query: 709  FDYAKDHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITF-ASDTEKPFSNTVINM 767
            FDY K+  + +++G   A+ + FG +  H+ R+ N    + IT    D E  F     N+
Sbjct: 699  FDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNI 758

Query: 768  KTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLF 827
            + IQGLL+  L+ NP +FLP++  ++++ ++ ++ +  +GK +V   L +L+    ++  
Sbjct: 759  RAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQ 818

Query: 828  LKKVPKSLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISS 887
             ++  K+L+   + ++ W+R +  KR          + +EPEEIN IQSFLRFN  E+S 
Sbjct: 819  KEEFKKALYLPASDLVNWIRESGRKRTNVS------RRIEPEEINSIQSFLRFNLSELSL 872

Query: 888  FKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSL 947
             +  +SIL+K+ IF  LK+ D       L      + +   + AF  +  +     D S 
Sbjct: 873  IRDKISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQAFGISGLSEKDSEDLSA 932

Query: 948  AKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTT 1007
              L  ++ FL+ECT +L   +  +L  K+  WWK Y EL+     Y K FP+ VKP    
Sbjct: 933  TILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKP-HLD 991

Query: 1008 DTSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRK 1067
            D  G    G ++E KR + E++L+ QIK   + L+ L  E+   HE LAEELS Y+EF+ 
Sbjct: 992  DNKG--LFGTYVEGKRSKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKT 1049

Query: 1068 ACLNQRNIVAFAATNISVLQENI 1090
              L    I  F    I+ L++ +
Sbjct: 1050 NYLRTGIIQDFTVGKINTLKDTM 1072

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1102 (36%), Positives = 647/1102 (58%), Gaps = 64/1102 (5%)

Query: 16   AIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHELCY-NAEFINS 74
            +IFNCP P  SPLKKL+A+LK   FILL PP+E LLNY D KTK+ L +LCY N +FI +
Sbjct: 16   SIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLEDLCYHNVDFIGA 75

Query: 75   HILLMTENSFINTNSRD----------SHYETLDGKTVVIQWKNNVIHALNGFQVRRRLK 124
            HILL  ++S  +++S              ++TL+G  ++++W+NN +  L+G   R+++K
Sbjct: 76   HILLPPKDSISSSSSTIDDGYTRLASIEQFDTLNGDNILVKWRNNFLVLLSGSPNRQKIK 135

Query: 125  ILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVP-NDYLQCFHS---YKKIPKSVYSVH 180
            I   ++LPNFNDY +G+T F++++I++PL  + +  ND L+CF +   +     S     
Sbjct: 136  IERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFDTLTLHDNDGDSSPDAR 195

Query: 181  NLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGM 240
             L  D SQ ERS FENI++ + T   +  +  + Y+    +++P+E +F+ IV  A+  +
Sbjct: 196  PLIQDMSQHERSQFENIINTNDTWNKRFKDWMNEYKDSTTAEEPNETLFKQIVAVAYNEL 255

Query: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFK-SYEVGTEEYKYFSINHLLADFY 299
            KS+ +FK F +L  LIHEY E+NLYD +W ++T+      E      K  SI  +   FY
Sbjct: 256  KSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGTRIKNISIEEIDDKFY 315

Query: 300  SKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTD-MGSHQ 358
                  F L  +T +EK +  ++    KL   +S+ EKS+ L+ TLQ L+   + +G   
Sbjct: 316  EM----FPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIATLQILTNMDNPIGELN 371

Query: 359  LDVPGRLNNLAMDADTLISLFVLVICRSEQK--HLKSHLYYLQNFXXXXXXXKFGILGYA 416
             +     NNL +DADTLI+L +L+ICRSE     LK +++YL+ F        FGIL Y 
Sbjct: 372  QENEKGANNL-IDADTLINLLILIICRSEINIVDLKRNIFYLKKFNYDENLINFGILSYT 430

Query: 417  VSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYR 476
            +ST E V+  FE       N+ + + L   ++ +  ++  +++  KV     ++  L +R
Sbjct: 431  ISTFEIVIYSFE-------NIVEYDKLKSYSEIIEKLIKVDDLK-KVPKTIKWEQFLTFR 482

Query: 477  NGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAA 536
            +  G+SIL  CI+NN+    LD+L +Y+ IF ++++L+D  ++G+TLL++++   N + +
Sbjct: 483  SDTGESILFSCITNNQTEKFLDLLVDYEEIFSMDNILDDANVEGTTLLMQALIYRNFKIS 542

Query: 537  KILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTP 596
             +LI +++ NC+ ++++ YIN+ DK++R V HYL +E++ILK IG YV+WK+++  G+TP
Sbjct: 543  MVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEILKIIGKYVNWKQRDLVGRTP 602

Query: 597  LFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILL 656
            LF+IFR YDQPNY+ ++   F+I   WY +    F   DH D K N +LH+L+++  IL 
Sbjct: 603  LFTIFRGYDQPNYDEVISTVFDITLNWYAENGLKFQMSDHYDLKDNSILHILRSNIDILF 662

Query: 657  QLTK-----LDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDY 711
              +K     +DIN  NYKG TPLM+YVKY RL+N++ I+ D RL+  + Q+  + TCFDY
Sbjct: 663  TYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILGDDRLLFNRYQRELYTTCFDY 722

Query: 712  AKDHTVLSKVGERGAK-DSLFGLIYFHSLRYH-NLNAAVNITFA-SDTEKPFSNTVINMK 768
            A D T+ +++G+   + +++FG IY HSL+   + NA  ++TF   D E       I +K
Sbjct: 723  ATDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNATFSLTFPLPDKENETGTVNIKVK 782

Query: 769  TIQGLLRSILKDNPFTFLPLNIYIDEISQLS--RSDVTIIGKADVM---SLLHKLSNCFN 823
             I  LL+ I K +  + LPL+  I  + +L+   ++  I+ K +++   SLL +L++C +
Sbjct: 783  AIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENNKIIVRKIEMLRNQSLLRRLTDCLD 842

Query: 824  VLLFLKKVPK--SLFTDEASILYWM-RINTSKRNQKQPSKENYKTMEPEEINMIQSFLRF 880
             LLF        SL TDE  +L W+   NT  ++    +    K+++PE+IN+IQSFL+F
Sbjct: 843  TLLFFDIGIDYLSLITDETKLLGWVTNENTKLKHNVNKTHGEKKSLKPEDINIIQSFLKF 902

Query: 881  NFDEISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTN-- 938
            N  E+ +   ++  L K+L FI LKS D K+       + KSI N + A A   +L    
Sbjct: 903  NVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKNDQIAQATNRSLEPII 962

Query: 939  --HNMFNDYSLAKLL-EHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRK 995
               ++ N Y    L+ + + FL+ CT+ L+  ++ IL  +IPNWWK YGEL+ L+K+Y K
Sbjct: 963  EMQSLENQYYNNTLIRDELDFLKACTLILTGNIEDILRTQIPNWWKLYGELLELNKHYNK 1022

Query: 996  AFPS-------VVKPKSTTDTSGHIQ----LGGFIETKREQSEQRLAVQIKVSSKSLKEL 1044
             FP            + + + S  +      GG IE +R ++ ++L   I     SL+ L
Sbjct: 1023 LFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLEIL 1082

Query: 1045 GSEIFVAHEKLAEELSNYMEFR 1066
            G+EIF  HE LAEEL+ YMEF+
Sbjct: 1083 GNEIFRKHEMLAEELNKYMEFK 1104

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/866 (39%), Positives = 534/866 (61%), Gaps = 42/866 (4%)

Query: 5   HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64
           HLP LLNPL+N++FNCP P  SPLKK+FA+L+  RFIL+ P    LL+Y D+ T   L +
Sbjct: 4   HLPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQD 63

Query: 65  LCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLK 124
           LCY  EF+ +HI+++ ++S       D  ++TL+GKTV+I+ +N ++   +GF  +RR K
Sbjct: 64  LCYTYEFVANHIIILKKDS----KYSDQEFKTLNGKTVLIRSQNGIVLTGDGFPSKRRCK 119

Query: 125 ILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLSL 184
           I  T++  NFNDY +G+  F +I+I++PL  ++V ND LQ F     +  +  S   LS 
Sbjct: 120 ITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF----GVRSTNTSSLPLST 175

Query: 185 DSSQQERSSFENILHIHPTRLTQLGEMFS------------NYRTLAPSDDPSEKIFECI 232
           D +Q+E SSFE +  +HP    QLG+ FS            N++ L    D     F+  
Sbjct: 176 DLTQREVSSFEQLFRLHP----QLGDRFSGLFKEQRQEINANFKGL----DSLVDFFDKF 227

Query: 233 VQQAFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEV-GTEEY---KY 288
             +AFE ++ +  F+    L+  +H Y ELNLYDDIW ++T  ++  E+  T +Y   KY
Sbjct: 228 NYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKY 287

Query: 289 FSINHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQEL 348
            +I+ +   FY +   +F L+ VT  EK +  A+  F++L  + S++EK+KI+++TLQ L
Sbjct: 288 IAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTL 347

Query: 349 SGTTDMGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXX 408
           +  ++     ++      ++ +DADTLI L VLV+CRS+ K+LKSHL+YLQNF       
Sbjct: 348 TDYSEFPDADIE------DVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTI 401

Query: 409 KFGILGYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLAT 468
           KFG++ YA+STLEAV+CYFED  +NS  +       ++ K+  + LSC+ V+   ++L +
Sbjct: 402 KFGVVAYALSTLEAVLCYFED-AENSGKIRSLEFNCRRNKQFWDHLSCKAVS--FDSLKS 458

Query: 469 YKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESI 528
           Y+DIL  R   G+S LS+CI       +  +L  ++   PLED+L+D+TI+GSTLL++++
Sbjct: 459 YRDILRIRTAGGESCLSVCIQKGNFSGIECLLQNFEHELPLEDILDDQTINGSTLLMQTL 518

Query: 529 KSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKR 588
           ++GN   A +L+ I+  +CT  EL  Y+NR +++ RT AHYLT ++ +   IG + DW+ 
Sbjct: 519 ETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIFFDWEA 578

Query: 589 KNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVL 648
           K+  G TPLF+IFRSYD P+Y  MV  AF  A+ WY  +  +F++  H D KGN LLHV+
Sbjct: 579 KDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVM 638

Query: 649 KTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTC 708
           KT+  ILL+   +D+N  N KGLTPLMVYVKY RL+N++ I++D RL++EK QKS F  C
Sbjct: 639 KTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNC 698

Query: 709 FDYAKDHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITF-ASDTEKPFSNTVINM 767
           FDY K+  + +++G   A+ + FG +  H+ R+ N    + IT    D E  F     N+
Sbjct: 699 FDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFENNRWFLWITLKGKDRETDFQTVKHNI 758

Query: 768 KTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLF 827
           + IQGLL+  L+ NP +FLP++  ++++ ++ ++ +  +GK +V   L +L+    ++  
Sbjct: 759 RAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFLCELTLVLKLICQ 818

Query: 828 LKKVPKSLFTDEASILYWMRINTSKR 853
            ++  K+L+   + ++ W+R +  KR
Sbjct: 819 KEEFKKALYLPASDLVNWIRESGRKR 844

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/1086 (35%), Positives = 617/1086 (56%), Gaps = 48/1086 (4%)

Query: 16   AIFNCPEPEKSPLKKLFATL-KTCRFILLAPPSEYLLNYHDVKTKLPLHELCYNAEFINS 74
            AI NC EP  SPLKKL+  L K  ++++L PP+E LL Y D ++   LH+LCY   F ++
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 75   HILLM-TENSFINTNSR-----------DSHY-ETLDGKTVVIQWKNNVIHALN--GFQV 119
            HILL+   ++ +N               D H+ + +D     I WKN VI+  N  G Q+
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQI 138

Query: 120  RRRLKILGTKILPNFNDYFEGATDFV-IIYIEQ-----PLSCESVPNDYLQCFHSYKKIP 173
            + R KIL  + +P FN+Y +   + + I+YI+       L C    +  L    S + IP
Sbjct: 139  KNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIP 198

Query: 174  --KSVYSVHNLSLD-SSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFE 230
              K    ++  S D  + + +++F++IL ++    ++  + F  +R LA  DD    +F 
Sbjct: 199  TAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPIDVFH 258

Query: 231  CIVQQAFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFS 290
             I+++  E M SD+LFK   +L ++I+EY ELNL+DDIW  +    K  E+    +   S
Sbjct: 259  NIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMILRMNKEVEIDLNPFGNIS 318

Query: 291  INHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSG 350
            I  + ++F S ++ +F L++V   E+ +  ASK  QK+    +Y  K+ IL+ TL+ L+G
Sbjct: 319  IYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKANILILTLRTLTG 378

Query: 351  TTDM-GSHQLDVPGRLN--NLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXX 407
              +  G    +  G L+   LA+DAD L++LFVLV CR++ K+LK HL YLQNF      
Sbjct: 379  NKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFYNNDSD 438

Query: 408  XKFGILGYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVEN-- 465
             KFGILGYA+STLEAVVCYFE  K+  +N  K        +RLV +LS    T K E   
Sbjct: 439  TKFGILGYALSTLEAVVCYFEQLKE-KENYRKLIDFCNSNERLVKVLSS---TKKYETNA 494

Query: 466  ----LATYKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGS 521
                L  Y+  L YR+  GQS+L++CI + +N  L  IL+EY+++FP+EDLL DE+IDGS
Sbjct: 495  ALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGS 554

Query: 522  TLLIESIKSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIG 581
            TLLI+++K  N  +A +L+ I+  NCTE ELI+YINR D   RT  H+LT+E+++LK +G
Sbjct: 555  TLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLMG 614

Query: 582  NYVDWKRKNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKG 641
             Y++W +K++ GQTPLF+IFRSYDQ NY+ MV  +   A  WY    ++F+Y DH D KG
Sbjct: 615  KYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKG 674

Query: 642  NDLLHVLKTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQ 701
            N LLH+LK +  ILL    +++N  N  G TPLM  ++YKR  NI  ++ D RL ++  Q
Sbjct: 675  NTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQ 734

Query: 702  KSTFFTCFDYAKDHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFS 761
            K+   T FD++KD  +   +GE    +S +  +Y H+L+Y   N+  N++     +    
Sbjct: 735  KNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKY--TNSRWNLSLTVKLKDAPK 792

Query: 762  NTVINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNC 821
             T   +KT++G+LR ++K+N   FLP+   ++++   +R   + + +  V+ +L  +S C
Sbjct: 793  TTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFC 852

Query: 822  FNVLLFLKKVPKSLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFN 881
             + L+ +K +  ++F  E + + W+++N S   +   + +    + PE+I+MIQ+FL+FN
Sbjct: 853  LSALVHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSD----ITPEDISMIQNFLKFN 908

Query: 882  FDEISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNM 941
              EI   K  L I  K+ +F  LKS D  + N+N   +   + + +       +  +  +
Sbjct: 909  ITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKL 968

Query: 942  FNDYSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVV 1001
             +  +   LL  + +L+ C  +L N +  I    I NWW  YGEL+  HK+Y +AFP + 
Sbjct: 969  LSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELA 1028

Query: 1002 KPKSTTDTSGHIQLGGFIET-KREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELS 1060
               + T  +  + L   I   KR + E+RL+ +IK  ++ L  +G +I   HE  AEE+S
Sbjct: 1029 ---NVTTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVS 1085

Query: 1061 NYMEFR 1066
             +++ +
Sbjct: 1086 RFIDLK 1091

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/1088 (35%), Positives = 620/1088 (56%), Gaps = 53/1088 (4%)

Query: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64
            H+P LLNPLINA+FNCP+P  SPL+KLF  +K   F+L+ PP+E LL+Y D +  L L E
Sbjct: 7    HMPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLKE 66

Query: 65   LCYNAEFINSHILLMTENSFINTNSR--------DSHYETLDGKTVVIQWKNNVIHALNG 116
            LCY  EF+ SHI+L T+NS  N   +        D+ Y++L+   ++I+  N +    N 
Sbjct: 67   LCYEFEFVASHIILDTDNSSNNLQVKGKNSNETLDNRYKSLNNNQLLIKNNNIIPLDFNN 126

Query: 117  FQVRRRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSV 176
               +++ KI+  KILPNFN+Y  G+  + IIY + P S   +P   ++ F+  KK   ++
Sbjct: 127  STQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPFSNSWLPKIEIESFYISKKESNNI 186

Query: 177  YSVH------NLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNY------RTLAPSDDP 224
             +         LS D +Q+ +SSF +I++IH     +   +F +Y      + L  +  P
Sbjct: 187  KAAQITNHKSPLSQDLAQKTKSSFRHIINIHK----EWNNIFDSYIIDFKNKQLNLTSLP 242

Query: 225  SEKIFECIVQQAFEGMKSDSLFKKFPN-LYDLIHEYFELNLYDDIWSRLTSHFKSYE-VG 282
                F  IV +A++ MK + +F  F N LY+LI EY E + Y+ IW  +  +    + + 
Sbjct: 243  I--YFREIVDKAYQKMKFEEIFLSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLH 300

Query: 283  TEEYKYFSINHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILV 342
            TE   + SI+ L  + Y+++F++F L +V  +E+ V  A+  F+K+  + S++EK +IL+
Sbjct: 301  TEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILI 360

Query: 343  ETLQELSGTTDMGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFX 402
            + LQ+L+   D+    L V         DADTL++LF+LVICRS+   L++HLYYLQNF 
Sbjct: 361  DALQKLTSYDDVHYEPLMV---------DADTLMNLFLLVICRSKVPFLRNHLYYLQNFS 411

Query: 403  XXXXXXKFGILGYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNK 462
                  KFG+LGY +ST EA +CY +DF+   +   K  +   + K L++ +S E   + 
Sbjct: 412  TDENNVKFGLLGYGISTFEATLCYLKDFQA-GEKFNKQVLNCIRNKELISKISSE-ADHS 469

Query: 463  VENLATYKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGST 522
               +  YKD   +RN  G+SIL++CI + KN  L +IL  ++ +FPLED+L+DE I+G+T
Sbjct: 470  TFQVKLYKDCFKFRNEMGESILALCIKHKKNETLFEILLNFEDMFPLEDILDDEDIEGTT 529

Query: 523  LLIESIKSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGN 582
            LL++++K  N   AK+++ ++  +C+E+ELI Y NRTD   R  AHY+T++ID+LK IG 
Sbjct: 530  LLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNNQRIAAHYITNQIDVLKRIGL 589

Query: 583  YVDWKRKNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGN 642
            + +WK K+  G TPL +I R+YDQ  YE M++ AF  A  WY  +N+  +++DH D+K N
Sbjct: 590  FFNWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQKWYENRNQKLNFKDHNDSKEN 649

Query: 643  DLLHVLKTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQK 702
             LLH+LK D  +LL+   ++IN  N K +TPLM YVKY R++NI+ II+D+RL+L K QK
Sbjct: 650  TLLHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYNRVSNIQEIIRDERLILGKYQK 709

Query: 703  STFFTCFDYAKDHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSN 762
             TF  C+D+ K+  +   +G R  ++S+F L   +SLR  N N  +  TF    +  +  
Sbjct: 710  HTFLDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRVENSNWVLYFTFKDTNQDSYIT 769

Query: 763  TVINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDV-TIIGKADVMSLLHKLSNC 821
              +++K +  +++   K  P  F+P    +  ++ + +++    I K    + L+ +SN 
Sbjct: 770  KSVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVKNNPNNGIQKLKNRAFLNLISNY 829

Query: 822  FNVLLFLKKVPKSLFTDEASILYWMRINTSKRNQKQPSKEN-YKTMEPEEINMIQSFLRF 880
            F  L+        LF +  S+  W++    KR  K   KEN YK M  ++INMI+SF++F
Sbjct: 830  FGTLIETDDFDTELFKNPESLTKWIK--AGKRKHK---KENYYKRMTLDDINMIKSFVQF 884

Query: 881  NFDEISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFA--GNLTN 938
            N +E+     +L+IL+K+  F++LK ND  +        G  +     ++       L  
Sbjct: 885  NINELGKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDISNQMKKIDGLIK 944

Query: 939  HNMFNDYSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFP 998
               F    L  LL+ + FLE CTI +S+    ++   IP W   +  L  L K Y++ F 
Sbjct: 945  PKYFQSIFLI-LLDQISFLEICTIHMSDNFNDLIKNDIPEWHSVHFILSNLKKQYKRDFS 1003

Query: 999  SVVKPKSTTDTSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEE 1058
                  S    + +I L  + + KRE +E+R++ +I  ++    ++ + I+ AHE LAEE
Sbjct: 1004 DF---DSRNGLNENI-LSRYTKNKREAAEKRISEEIIENTTLFDKVTAHIWYAHENLAEE 1059

Query: 1059 LSNYMEFR 1066
             + ++ F+
Sbjct: 1060 FNKFLTFK 1067

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/1099 (34%), Positives = 613/1099 (55%), Gaps = 46/1099 (4%)

Query: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64
            +LP LLNPLINA+FNCP P  S LKK+F+ ++  RF+L+APP+E LL Y D+++ LPL +
Sbjct: 4    YLPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQD 63

Query: 65   LCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLK 124
            LCY   F++ HI+L+     +    ++  Y+TL GKT++++ +  +I     F  RRR +
Sbjct: 64   LCYATGFVSDHIVLLDGREGL----QEEEYKTLSGKTILLRSQQGIIFTAAAFDTRRRCR 119

Query: 125  ILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLSL 184
            I   ++L NFN+Y +G T F II+++ PL+      D  QCF   K   +      N   
Sbjct: 120  IQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCFRVTKN-QEHTNGPKNSGK 178

Query: 185  DSSQQERSSFENILHIHPTRLTQLGEMFSNYR-TLAPSDDPSEKIFECIVQ---QAFEGM 240
             S      S E +L I+P     L ++    R +L  S   +  +    VQ   +A + +
Sbjct: 179  LSHGDNNISLEQLLRINPEYGESLNDIVKAQRISLNSSVTGTTHLASHFVQTCKKALDVV 238

Query: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEV-GTEEY---KYFSINHLLA 296
            ++   F+  PNL   +HEY ELNLYDD W++LT+  +  E+  + +Y   K+ S++ + +
Sbjct: 239  RAYPAFQVLPNLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPS 298

Query: 297  DFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGS 356
              Y  +  +F L+ +T  EK V  A + F+K+ +T+ ++ K+K+++ETLQ LS       
Sbjct: 299  FLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLS------- 351

Query: 357  HQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGILGYA 416
              L V  R   + +DADTL+SLFV+V+C ++ K L+SHL+YLQ F        FGIL Y 
Sbjct: 352  RSLLVDDRA--VTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYG 409

Query: 417  VSTLEAVVCYFEDFKKNS--DNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILP 474
            +STLEAV+CYFE  +K +  +   +AN+   K+      +S  ++    +      D+L 
Sbjct: 410  MSTLEAVLCYFESPEKVASLEKYCRANLSHWKS------ISEGSIDLNADTTVPLDDLLK 463

Query: 475  YRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLE 534
             R   GQS L++C+ + +      I +  ++ FPLEDLL DET DGS LLI  ++SG   
Sbjct: 464  IRTSDGQSCLAVCLQHRRTEEFELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDR 523

Query: 535  AAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQ 594
             A +LI  ++ NCT++ELI+++N T+KY R+  HYL H   ++  +G+ ++W++++  G 
Sbjct: 524  LAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLIDLVGDILNWEQRDCNGH 583

Query: 595  TPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASI 654
            TPLF+I R+YD+P+Y  MV  A+  A    + +N  F   +HTD+KGN LLHV+K+D SI
Sbjct: 584  TPLFAIVRAYDRPDYFDMVSAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSI 643

Query: 655  LLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKD 714
            LL    +D+N  N KGLTPLMVYV+Y R+ N+  I++DQRL++ K Q   + +CFDY K+
Sbjct: 644  LLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQSGAYLSCFDYVKN 703

Query: 715  HTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITF-ASDTEKPFSNTVINMKTIQGL 773
              VL ++G+  +       I  HS++       + IT    + + P      +++ IQ  
Sbjct: 704  PAVLKELGKYASYLPFEFSINVHSVKREGDEWVLWITVTGGEKQVPVKVFKRSLRFIQAF 763

Query: 774  LRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPK 833
            L      +P TF+P++  + E+  LS+S + I+ K D    L + S   +++       +
Sbjct: 764  LTLFSDAHPMTFVPVDELLRELRALSQSRILILNKMDTKRFLKRCSVTLSMV-----SQE 818

Query: 834  SLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLS 893
             LF D  +       ++      +   +N K MEPEE+  IQS L+FN  EIS+ K ++ 
Sbjct: 819  RLFADAFTDSNLNLSSSRGLGSSESFTQNMKMMEPEEVRSIQSILKFNLSEISALKTAML 878

Query: 894  ILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAK--AADAFAGNLTNHNMFNDYSLAKLL 951
            +++K+ +F  LK  D  +         K +   K  + D F  N+   N+F+   +A   
Sbjct: 879  LMKKLAVFEGLKGKDLSEACMTFGAKCKYVTQGKIQSFDHFL-NVQAPNLFDFEGIAN-- 935

Query: 952  EHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSG 1011
             ++   E C+  L   +  +L + IP WW  YGEL++L + Y+K+FP   +P   ++ SG
Sbjct: 936  -NIALCELCSSLLCKHIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPH-VSENSG 993

Query: 1012 HIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLN 1071
                G +IETKR + EQ  A +I  +S  L E+ ++I   +E+LA EL+N++ F+   L 
Sbjct: 994  --LFGSYIETKRTKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFL- 1050

Query: 1072 QRNIVAFAATNISVLQENI 1090
            +  I   A TNI  L+E +
Sbjct: 1051 KSAIKEHADTNIKRLREQL 1069

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] {ON}
            similar to uniprot|Q04263 Saccharomyces cerevisiae
            YML002W Hypothetical ORF
          Length = 1097

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/1109 (33%), Positives = 607/1109 (54%), Gaps = 64/1109 (5%)

Query: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64
            +LP LLNPLINA+FNCP P+ SPL+K+F  ++  RF L+ P  E LL Y D+++   L +
Sbjct: 4    YLPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQD 63

Query: 65   LCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLK 124
            LCY+A F++ HILL+         S +  Y+TL GKT+ ++ +   +    GF  RRR +
Sbjct: 64   LCYSASFVSDHILLLGGGGC----SHEEEYKTLSGKTITLRNQQKALFTGEGFDARRRCQ 119

Query: 125  ILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLSL 184
            +L T++L NFN+YF+G++ + II+++ PL+      D    F +Y+       S  N SL
Sbjct: 120  VLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGFKAYRFASTDTTSA-NSSL 178

Query: 185  DSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSD----DPSEKIFECIVQQAFEGM 240
             +S + ++S E +L  HP+   +L  +    R    S     D     F    ++A   +
Sbjct: 179  AASTEPKASLEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAHFMQTCEKALAAI 238

Query: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEE----YKYFSINHLLA 296
            + D  F+ FPNL   IHEY E+NLYDD W++LT+  K  E+  +      +  SI+ + +
Sbjct: 239  QEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPS 298

Query: 297  DFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGS 356
              Y  D ++F ++ VT +EK +  A +  ++L +T+S++ K+K++VETLQ +S + ++  
Sbjct: 299  FLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEIND 358

Query: 357  HQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGILGYA 416
              + V         DADTL+SL V+V+C++E K LKSHL+YLQ F        FGIL Y 
Sbjct: 359  KVISV---------DADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYG 409

Query: 417  VSTLEAVVCYFEDFKK-------NSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATY 469
            +STLEAV+ YFE  +K        S N +    L      L ++           N +  
Sbjct: 410  MSTLEAVLSYFESREKLKLLEKHCSSNASYWEALADGKLPLGSL-----------NPSEV 458

Query: 470  KDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIK 529
            KDIL  R   G S LSIC+ N + ++ L + ++++  FPLEDLL DET++GS LLI+ + 
Sbjct: 459  KDILRTRTPAGLSCLSICLQNRQPNLFLHLATKFEHCFPLEDLLNDETVEGSNLLIQMLD 518

Query: 530  SGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRK 589
            +G    +   I ++  +CT+ EL S++N  ++Y R+  HYL H +D++  +G +++W+++
Sbjct: 519  NGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQR 578

Query: 590  NSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLK 649
            +  G TPLF+I R+YD  +Y+AMV  A+  A  W   + + F    H DNKGN LLHV+K
Sbjct: 579  DCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIK 638

Query: 650  TDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCF 709
            ++ S++L    +++N  N KGLTP+MVY +Y RL+NI++I++D+RL+++K Q  ++ TCF
Sbjct: 639  SNVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLTCF 698

Query: 710  DYAKDHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVN------ITFASDTEKPFSNT 763
            DY K+  VL ++G+       F L   + +R HN+    +          S    P    
Sbjct: 699  DYIKNPVVLGELGKHA-----FFLPQSYQIRAHNIKFEGDEWVLWMTLVGSVPNAPAKVI 753

Query: 764  VINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFN 823
              ++K IQ  L S  K N  TF+P     +E+S L++  +  I + +    L + S   +
Sbjct: 754  QRSLKFIQSFLISFSKTNSMTFIPAESLAEELSLLAKMKIISINRLETKHFLRRASVVLS 813

Query: 824  VLLFLKKVPKSLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFD 883
            ++   ++  + +F + +  L    +N ++  Q+Q +   Y  +EPEE+  IQ  ++FN  
Sbjct: 814  LICRQEEF-EHIFNNPSGSL----VNAAEHVQEQEANSTYGMIEPEEVASIQKIMKFNRT 868

Query: 884  EISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYN--AKAADAFAGNLTNHNM 941
            EI + K+   +L+K+ IF  LK  D +  +      G +      ++ + F G+L  H++
Sbjct: 869  EILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFTKIIGRSTNVF-GSL-KHSL 926

Query: 942  FNDYSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVV 1001
                    L  +   LE  +  L   +  IL   IP+WWK YGEL++L   Y K FP  V
Sbjct: 927  -PQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYGELVSLRHEYNKNFPDDV 985

Query: 1002 KPKSTTDTSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSN 1061
            +P+   +T G I    +IETKR + EQ L  +I  SSK+L      +  ++E LA EL+N
Sbjct: 986  RPRVAENT-GFI--SSYIETKRVRLEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNN 1042

Query: 1062 YMEFRKACLNQRNIVAFAATNISVLQENI 1090
            ++ F+        I   AA NI  LQE +
Sbjct: 1043 FINFKAEFWVSATIKEHAAMNIKWLQEQL 1071

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
            Ashbya gossypii ACR006C
          Length = 1079

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/1086 (34%), Positives = 594/1086 (54%), Gaps = 74/1086 (6%)

Query: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64
            HLP LLNPL+NA+FNCP P  SPLKKLF  +K  RFILL P ++ LL Y D+ + LPL E
Sbjct: 4    HLPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLSE 63

Query: 65   LCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLK 124
            LCYN +F+ SHIL+  + S +     +  Y TL+G +V+I+ +  ++ +       R+ +
Sbjct: 64   LCYNYDFVASHILIQLQESKVT----EQEYRTLNGNSVIIRSQAGIVMSKPEL---RKCR 116

Query: 125  ILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLS- 183
            +   ++L NFNDY      F +++I++PL    V ND LQ F SY+        +HN S 
Sbjct: 117  VKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDELQVFGSYE--------MHNPSK 168

Query: 184  ---LDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSD----DPSEKIFECIVQQA 236
               +++  +    FE  + ++P    QL   F   R    ++    D   KIF+ +V   
Sbjct: 169  SKTINTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDKLIKIFKDLVIDV 228

Query: 237  FEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYE----VGTEEYKYFSIN 292
            +  +K D  F+ +  L ++  EY ELN+Y+DIW +L     S E     G    KY S+N
Sbjct: 229  YGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLN 288

Query: 293  HLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTT 352
            ++    Y +    F L+ VT +EKRV  A+  F KL+LT+S+ EK+KI+V T Q L  TT
Sbjct: 289  NVATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQIL--TT 346

Query: 353  DMGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGI 412
             M    +D         +DADTLI L ++V+CRS+ K+LKSHL YL+ F       KFG+
Sbjct: 347  KMEYTSIDP-------TIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGL 399

Query: 413  LGYAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENV------TNKVENL 466
             GY++ST+EAV+ YFE           A    +K K+L+++     V      +    +L
Sbjct: 400  TGYSLSTIEAVLAYFE-----------AGDGTEKLKKLISLSEANRVFWDLIRSGVAVSL 448

Query: 467  ATYKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIE 526
            ++YK+ L  R+   +S LSICI   +  ++ +IL  Y     LEDLL D     STLLI+
Sbjct: 449  SSYKNSLISRSSNCESSLSICIHAGRLDLIKEILLNYQEQIKLEDLLFDVNQANSTLLIQ 508

Query: 527  SIKSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDW 586
            ++++G+ E A++LI +M+ NCT  E   Y+NR++   RTVAHYL     I++ IG Y+DW
Sbjct: 509  ALETGHDEIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDW 568

Query: 587  KRKNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLH 646
            ++K+    TPLF I R+YDQ +Y  M+  +F     + R++   F + DH D  GN LLH
Sbjct: 569  RKKDVNMHTPLFIICRAYDQLHYSEMLSRSFEYVFEYCRRRGEDFSFTDHEDPMGNSLLH 628

Query: 647  VLKTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFF 706
            ++K     +L    +++N  N KG+TPLM+Y KY R+ NI  I++D+RL++ KIQ     
Sbjct: 629  IMKGGIQSILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTL 688

Query: 707  TCFDYAKDHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVIN 766
               DY K+  +L+ +G   AK+SL+GL+    +++ +    + IT    ++  +S    +
Sbjct: 689  KAIDYVKNPMILNLIGTHIAKNSLYGLLSADGIKFEDNCWYLWIT-VKFSDNSYSTLRQS 747

Query: 767  MKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLL 826
            +K IQGLL+   K +P  FLP++  +  +  + +  +  +   +    L  L+   +V+ 
Sbjct: 748  VKNIQGLLQFYNKKHPMNFLPIDHILSILKNIGKPGILPVINLENSIFLGLLTQLLSVIG 807

Query: 827  FLKKVPKSLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEIS 886
               +    L  +E+ +  W+R N  K     P     + +EPEE++ IQSFL+FN  E S
Sbjct: 808  QRNEYMAVLRYNESDLSTWLRTNNFK-----PRANKDERIEPEEVSSIQSFLKFNLSEFS 862

Query: 887  SFKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADA---FAGNLTNHNMFN 943
              K   +ILRK+++F SLK+ D +     + +  + + N+        F G  +N N   
Sbjct: 863  EIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQMEIVSNSVGPSVEKTFIG--SNEN--- 917

Query: 944  DYSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKP 1003
             YSL    + + F+  C   LS+ +Q +L  K+  WW+ YGEL +L + Y++ FPS  K 
Sbjct: 918  -YSLDSFQQAIEFIAMCLETLSSKIQYVLDSKVTLWWRLYGELSSLRREYQRNFPSDFK- 975

Query: 1004 KSTTDTSGHIQLGGF---IETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELS 1060
              ++D SG    G F   IE KR+++E +L  +++V    L+ L  E+   HE LAEE+S
Sbjct: 976  --SSDVSGEESKGFFESYIEGKRQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEIS 1033

Query: 1061 NYMEFR 1066
             ++ F+
Sbjct: 1034 FFVTFK 1039

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/1086 (33%), Positives = 593/1086 (54%), Gaps = 52/1086 (4%)

Query: 5    HLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHE 64
            HLP LLNPL+NA+FNCP P  SPLKKLF   K  +FIL+ P +E LL Y D  T +PL E
Sbjct: 4    HLPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLTE 63

Query: 65   LCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLK 124
            LCYN EF+ SH L+  + + +     +  ++T++GK+VVI+ ++ +I A       ++ +
Sbjct: 64   LCYNYEFVASHTLVQLQEARVT----ELEFQTINGKSVVIRPQSGIITAQPS---AKKCR 116

Query: 125  ILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHNLSL 184
            I   ++L +FNDY  G T F ++YI++PL  E      L+ F   ++       +    +
Sbjct: 117  IQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLRVFGPQEQ------PLQYQRI 170

Query: 185  DSSQQERSSFENILHIHPTRLTQLGEMFSN----YRTLAPSDDPSEKIFECIVQQAFEGM 240
              +       E  L +HP    QL E+F +     R +A S     ++F  +V++ +  +
Sbjct: 171  TQTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLFHELVEKVYCLI 230

Query: 241  KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEV----GTEEYKYFSINHLLA 296
            K D  F+ + NL +++  Y ELN+Y+D+W +L       E     G    +  S+N L  
Sbjct: 231  KLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLST 290

Query: 297  DFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGS 356
              Y ++  +F L  VT IEKRV  A++ F KLTLT+S+ EK++IL+ T Q+L+  T   +
Sbjct: 291  SIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQAT 350

Query: 357  HQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGILGYA 416
              LD         +DADTL+ L V+V+CR++ K+LKSHL YL+ F       KFG+LGY+
Sbjct: 351  --LDP-------MIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYS 401

Query: 417  VSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYR 476
            +STLEAVV YF D   +S  + +     Q+ K   N++          NL  ++++L  R
Sbjct: 402  LSTLEAVVGYF-DIGGSSIKLERLITQCQRNKIFWNLIE----QGIPINLKEHEEVLISR 456

Query: 477  NGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAA 536
                +S+LS+CI   +  +  DI++ Y S F LED+L+D      +LLI+++++GN +  
Sbjct: 457  TPSCESVLSLCIQYGRQDVFYDIIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDIT 516

Query: 537  KILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTP 596
            + +I +++ NCT  E+ +YIN+ D   RTV HYL    +I+  +G +VDWKRK+    TP
Sbjct: 517  EAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKFVDWKRKDLNMHTP 576

Query: 597  LFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILL 656
            LF++ R+YD P+Y  ++   F     +Y  + + F + DH D  GN LLH++K    + L
Sbjct: 577  LFTVCRAYDHPSYLELLSKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLAL 636

Query: 657  QLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHT 716
                 ++N  N +G+TPLMVY KY R+ NI  I+ D+RL+L K+Q        DY K+  
Sbjct: 637  STPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPI 696

Query: 717  VLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRS 776
            +L+ +G   AK+SL+G +  H+++Y   NA      +S + + +  +   +K IQ LL+ 
Sbjct: 697  ILNLIGTAMAKNSLYGCLSVHNIKYEE-NAWYLWITSSLSPESYKTSSYALKDIQSLLQI 755

Query: 777  ILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLF 836
              K +P +FLP++ +++ +  L +S +  +   +   LL  L+   +++   +       
Sbjct: 756  YNKKHPMSFLPIDHHLETLKTLGKSGIISVINLENSMLLEALTFSLSIIQQREDYKNVFS 815

Query: 837  TDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILR 896
              E+ +  W+R +  K   ++P+K +   +EPEEI+ IQ+FL+F+  E +  +   ++L+
Sbjct: 816  YTESELSTWLRASMVK---QKPNKRD--KIEPEEIHSIQNFLKFSLTEFNYLREKFTVLK 870

Query: 897  KILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEHVRF 956
            K++IF   KS+D +     L   G+ I +   +     +  + N FND  +    + V F
Sbjct: 871  KLIIFEHYKSHDIECSQRILYSQGEIIASVVPSKRLRTSPFD-NEFND-GIDPFEQAVDF 928

Query: 957  LEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLG 1016
            +  C   L++ +  +L  K+  WW  YGE+  L K Y++ FP   KP S +         
Sbjct: 929  MCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFV 988

Query: 1017 GFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELS--------NYMEFR-K 1067
             ++E KR++ E +L  ++ V S++L+ L +E+   HE LAEE+S         YM F  K
Sbjct: 989  SYMEDKRQKLESKLQSRLSVCSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVK 1048

Query: 1068 ACLNQR 1073
            A +N+R
Sbjct: 1049 AYVNRR 1054

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1146 (34%), Positives = 617/1146 (53%), Gaps = 97/1146 (8%)

Query: 6    LPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHEL 65
            +P LLNPL++A+FNC + E SPL+K++++L    FILL PP+  L  Y D  TK PLHEL
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 66   CYNAEFINSHILLM---TENSFINTN------SRDSHYETLDGKTVVIQWKNNVIHALNG 116
            C++ EF++SHIL      +N  I+T+       R++ + T +GK +   +    ++  +G
Sbjct: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120

Query: 117  FQVRRRLKILGTKILPNFNDYFEGATDFVIIYIEQPL-------SCESVPNDYLQCFHSY 169
            F  R   +IL  + L +F +Y +G++ F++IYI+QPL        CE      L CF + 
Sbjct: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCED-----LDCFPNL 175

Query: 170  K-KIPKSVYSVHNLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRT-LAPSDDPSEK 227
                  S  S+ NLS      +R+   N + IH     +   +F NYR  +  S+     
Sbjct: 176  TINTTPSTRSLANLSSAEVPPQRNPLLNSM-IHAQYNWKFRAVFQNYRKEITQSESMLIP 234

Query: 228  IFECIVQQAFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEE-- 285
             F   + + ++G+  D+ F   P +  LI EY E N+YDD+W  L +  ++   G +E  
Sbjct: 235  GFRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLIN--RNNAEGEKEKQ 290

Query: 286  ------YKYFSINHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSK 339
                  +++ S++ L  DFY   F +F L+D+  +EK +  A+K F+ L++TH+Y EK +
Sbjct: 291  SESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCR 350

Query: 340  ILVETLQELSGTTD-MGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYL 398
            +LVETLQ LS     +G +Q  VP       + ADTL+SLF+L+I R++ K+++ HLYYL
Sbjct: 351  VLVETLQILSKPVKRVGGYQ--VP-------ITADTLVSLFILLIKRTKMKNIRCHLYYL 401

Query: 399  QNFXXXXXXXKFGILGYAVSTLEAVVCYFEDF---KKNSDNMAKANVLLQKTKRLVNMLS 455
            QNF       KFG+LGYA+STLEAV+CY E     K+  D + K +  L++   L+    
Sbjct: 402  QNFHQDENSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSK 461

Query: 456  CENVTNKVENLATYKDILPYRNGQGQSILSICISNNKNHILLDILSE-YDSIFPLEDLLE 514
            C  V+N+  +L+ Y     YRNG G S LS+CI N KN I  ++LSE Y+S F  EDLLE
Sbjct: 462  C--VSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLE 519

Query: 515  DETIDGSTLLIESIKSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEI 574
            D+T +G+TLL++S++  N E  + L  IM+ N TEEEL  Y  + DKY R + HY+  + 
Sbjct: 520  DQTTEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQ 579

Query: 575  DILKSIGNYVDWKRKNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRK-QNRSFDY 633
             +L+ IG Y+ W  K+  GQTPL  IFRSYDQ  Y+ MV+ +F IA  WY   +N  F +
Sbjct: 580  TLLQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCF 639

Query: 634  RDHTDNKGNDLLHVLKTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQ 693
            RDHTD+KGN LLH++K + S LLQ   +DIN  N +GL+PL     Y R  N+EA++KD 
Sbjct: 640  RDHTDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDP 699

Query: 694  RLVLEKIQKSTFFTCFDYAKDH--TVLSKVGERGAKDS---LFGLIYFH-SLRYHNLNAA 747
            RL+         F+ FD+ K +  T  + +      D+      +I  H   R  N  + 
Sbjct: 700  RLI---------FSSFDFLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKRSV 750

Query: 748  VNITFA-SDTEKPFSNTVINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSR--SDVT 804
            V  + +  D ++   +    +K ++ L R +LK +PFTF PL   +DE+S + +  S  +
Sbjct: 751  VLTSRSKEDAQELIGSEAFELKNLKALFRLLLKQHPFTFFPLEELLDELSVVEKTASSRS 810

Query: 805  IIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEASI---LYWMRINTSKRNQKQPSKE 861
            ++  +    +L KL+ C + ++ ++ +P +     A +   +   ++   +   K+ SK+
Sbjct: 811  LMKSSFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKD 870

Query: 862  NYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGK 921
              K M+PE I  I +FL++  + +   K ++  LRK  I   LKS D  +  + +  +G 
Sbjct: 871  --KKMQPESIGTITTFLKYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGA 928

Query: 922  SIYNAKAADAFAGNLTNHNMF-NDYSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWW 980
             + + K   A     T  N F  + S   L+  + F E C   + N +  +L  KIP WW
Sbjct: 929  EVSSKKIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWW 988

Query: 981  KHYGELITLHKNYRKAFPSVVKPK---------------STTD-TSGHIQLGGFIETKRE 1024
            K YG+L+ L K      PSV+  +               STTD TSG   LG FIE KR 
Sbjct: 989  KCYGQLLELSKED----PSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRI 1044

Query: 1025 QSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIVAFAATNIS 1084
            ++++R    I    + LK L +EI   +  +  E   ++ F+   ++   +  +   NI+
Sbjct: 1045 KNQERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWVKLNIN 1104

Query: 1085 VLQENI 1090
            +L++++
Sbjct: 1105 LLKKSL 1110

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
            YML002W
          Length = 1107

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/1104 (32%), Positives = 604/1104 (54%), Gaps = 37/1104 (3%)

Query: 6    LPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHEL 65
            +P L NPLINA+FNCP+P  SP KKL+  L+   F+LL P    LL Y D  + +   EL
Sbjct: 5    MPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFREL 64

Query: 66   CYNAEFINSHILLMTENSFI------NTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQV 119
            CY  +F+ +HIL++ +NS        N  + D + ++L+GK V++  + ++   + G+  
Sbjct: 65   CYTYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLL--RQSLCIPIKGYFS 122

Query: 120  RRRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSC-ESVPNDYLQCFHSYKKIPKSVYS 178
            +R+ ++    +L NFNDY  G+  F I++I+ PL   +    D L+ F   +++P     
Sbjct: 123  KRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTLIDELKGFEESRELPFHSQD 182

Query: 179  VHNLSL----DSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQ 234
                 L    + ++ +R  F  +         +L +    Y+ + P  +   ++F  IV 
Sbjct: 183  KDKPGLLQRTEENKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQNIGSELFHDIVN 242

Query: 235  QAFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHL 294
              +  +K +  F++F NLYD+ +EY E  LY DIW++L  H++   +        S++ L
Sbjct: 243  MIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSLDML 302

Query: 295  LADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDM 354
               FY++ F+ F+L D+  +E  +  A   F+ +   +SY++K  ++ +TL  ++G    
Sbjct: 303  DTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKNSD 362

Query: 355  GSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGILG 414
             + + +   +L    +DADTL+SLF L++CR+  + +  H+ YLQ+F       KFG LG
Sbjct: 363  DTIRDNTLPKLP--LIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALG 420

Query: 415  YAVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNML-SCENVTNKVENLATYKDIL 473
            Y +ST+EA + YF +   NSD   ++ + LQK   L + L    +  + +  +  +KD  
Sbjct: 421  YTLSTIEATLSYFYELS-NSD---ESRIQLQKLSLLEDFLIKIRSQHDDLIPINQFKDYF 476

Query: 474  PYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNL 533
             YR   G+SILS+ I+N KN  L + L  ++ IFPL+DLL D  + GSTLLI+ +K  NL
Sbjct: 477  RYRTQYGESILSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNL 536

Query: 534  EAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGG 593
            EAA+ILI I   +CT  EL++Y N+TDK  RT+AHY+T EI+IL+ IG Y++W  K+  G
Sbjct: 537  EAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEILEKIGKYINWTLKDLKG 596

Query: 594  QTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDAS 653
            +T LF+IFRSYDQ  Y + +KIA + A  WY+  +  F   DHTD  G+ LLH+LK+  S
Sbjct: 597  RTALFTIFRSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVS 656

Query: 654  ILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAK 713
            +LL+   LDIN  N KG+TPLM YVKY R++NI+ I++D RL+++K+QK  +  C DY K
Sbjct: 657  LLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQKDKYLNCLDYGK 716

Query: 714  DHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQGL 773
            + TV + +  + +KD +F   Y    RY   +  + I+   D +  ++  +I +K    L
Sbjct: 717  NFTVFNLLAAKLSKDVIFENAYISYARYEKSHWYLCISVQKD-DLEYTTNIIKLKKYYNL 775

Query: 774  LRSILKDNPFTFLPLNIYIDEISQLSRS-DVTIIGKADVMSLLHKLSNCFNVLLFLKKVP 832
            + ++ K     F+P +  +D + ++    ++  I +  + + L+ LS+  + LL+ +K+ 
Sbjct: 776  INAMQKIYKSDFIPYSDMLDCLKKIIEGHNILPIRRLKIKNYLNFLSHGLSALLYFEKID 835

Query: 833  KSLFTDEASILYWMRINTSKRNQKQPSKENYKTMEP---EEINMIQSFLRFNFDEISSFK 889
                 DE  I+ W+   +SK  Q++ S +++ + +P   E+IN I++F  F+F EI    
Sbjct: 836  PLTLLDENLIIKWI---SSKLQQQEKSIDDHSSFKPLSAEDINNIKAFCDFSFQEIGKTN 892

Query: 890  ASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTN-----HNMFND 944
              +    K+ IF  +K+ D     D L  +G    N + +    G+L +     H+    
Sbjct: 893  NVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTL-GDLQSISPHVHSSMVY 951

Query: 945  YSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPK 1004
            Y L+   + + F+++CT+ L++ +   + +K+  W K   +L+   K Y   F    +  
Sbjct: 952  YELS---QDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEET 1008

Query: 1005 STTDTSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYME 1064
                 +  +    +  T R++ E+RL   +    + LK+LG+EI V HE+LAEE S+Y+ 
Sbjct: 1009 GNLSENTSVFRYAWNVTYRKEEERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVR 1068

Query: 1065 FRKACLNQRNIVAFAATNISVLQE 1088
             +    +   +  F + N++ L+E
Sbjct: 1069 MKSKFNSNLLVRKFVSLNLAHLKE 1092

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  549 bits (1414), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 396/1174 (33%), Positives = 621/1174 (52%), Gaps = 112/1174 (9%)

Query: 16   AIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHELCY-NAEFINS 74
            A+FNCP+P  SP KKLF TLK  +FILL PP+  LLNY D   KL L+ELCY N++F+ S
Sbjct: 16   AVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLNELCYHNSDFLGS 75

Query: 75   HILLMT----ENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLKILGTKI 130
            HIL  +     N    T + D  ++ L+G   +I+WK+N+I     F   +R KIL    
Sbjct: 76   HILTWSNAIDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRGNFSNDQRFKILKIHP 135

Query: 131  LPNFNDYFEGATDFVIIYIEQPLSCES-VPNDYLQCFHSYKKIPKSVYSVHNLSLDSSQQ 189
            L NFNDYF G+ +F +I+I++P++  S + ND L+C     +  KS      L  D SQQ
Sbjct: 136  LTNFNDYFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQEKETPLVQDLSQQ 195

Query: 190  ERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGMKSDSLFKKF 249
             +SSFEN L+ +     + G + +NY+  +   +P+ K+F  +V +AF  + S   F+K 
Sbjct: 196  SKSSFENDLNKNEAWNLKFGILSNNYKIESSELEPNHKLFRELVNEAFIEIDSKKFFQKK 255

Query: 250  -----PNLYDLIHEYFELNLYDDIWSR----LTSHFKSY---EVGTEEYKYFSINHLLAD 297
                   L+ L H+Y E +LYD+IWSR    + +  K+Y   +      K+FSI  +  +
Sbjct: 256  KNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQKAQHLIKHFSIVEIDPN 315

Query: 298  FYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSH 357
            FY      F L+ V  +EK +  +     KL  T SYTEKS IL+E+LQ ++ +   G  
Sbjct: 316  FYDI----FPLKFVPMLEKNLKHSVTCINKLKSTKSYTEKSTILIESLQIITDSNTGGEE 371

Query: 358  QLDVPGRLNNLAMDADTLISLFVLVICRSE--QKHLKSHLYYLQNFXXXXXXXKFGILGY 415
              D     +   +DAD L++L  LVI +S      LK++LYYL+ F        FGIL Y
Sbjct: 372  SKD--KNKSGYLIDADNLLNLLTLVILQSNITLHDLKANLYYLKYFSTDESSSSFGILNY 429

Query: 416  AVSTLEAVVCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLAT-YKDILP 474
             ++T   V    E       N+   + L +K+  +  ++  ++++          K +L 
Sbjct: 430  TIATFHMVSHVLE-------NVIDWDRLKEKSDLIEELIMTDDLSTLSSTFENDKKTLLM 482

Query: 475  YRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLE 534
            YRN  G+S+L++ I N +N      L EY+ I  ++ +  D+++D STLL+++I+S N E
Sbjct: 483  YRNSNGESLLALSIINKQNKKFTQYLIEYEDILNMDIISNDQSMDSSTLLLQAIRSNNFE 542

Query: 535  AAKILIRIMMLNC-TEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNSGG 593
            AA IL++++  NC  ++ELISYIN+ D ++R + HYL   + ILK IG +++WK+K+  G
Sbjct: 543  AAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLVINLTILKIIGQFINWKQKDVNG 602

Query: 594  QTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDAS 653
            +TPLF+IFRSYDQ NY+ +V   F IA  WY   N  F   DH D+ GN LLH+L+ + S
Sbjct: 603  RTPLFTIFRSYDQSNYDELVCQVFQIAIKWYAANNLKFQMNDHDDSNGNSLLHILQNNIS 662

Query: 654  ILLQLTK-----LDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTC 708
            ILL   K     +++N  N KG TPLM+Y KYKR +NI  IIK+++L+  K Q   F  C
Sbjct: 663  ILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDNIRMIIKEEKLIFNKFQSPNFIDC 722

Query: 709  FDYAKDHTVLSKVGE-RGAKDSLFGLIYFHSLRYH-----NLNAAVNITFA---SDTEKP 759
            FDY+ D ++++ +GE   +   LFG I   SL+       +L   + I +     + +K 
Sbjct: 723  FDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMSTVPSLPRGLYINYTILIDEADKS 782

Query: 760  FSNTVINMKTIQGLLRSILKDNPFTFLPLNI-------YIDEISQLSRSDVTI----IGK 808
                 +   ++   L+ + +    +FLPL+        ++D+ S+ + +  TI    I K
Sbjct: 783  TLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQSFLDKKSKNNNNLRTIPLRYIEK 842

Query: 809  ADVMSLLHKLSNCFNVLLFL--KKVPKSLFTDEASILYWMRINTSK--RNQKQPSKEN-- 862
              +   L +L+ C +VLL      +   L   E  +L W+ I  SK  R+   PS ++  
Sbjct: 843  LRIRRFLKRLNTCLDVLLHFDDSTIATPLLLSETELLEWISIEESKLRRSSTTPSAKSKL 902

Query: 863  --------YKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILIFISLKSNDFKDVND 914
                     K ++PE IN+IQ+FL+FN +E+++   +L +L K++IF++LK+ D  D   
Sbjct: 903  ENAMGEKKKKELKPENINIIQNFLKFNLNELNTISMNLKVLSKLVIFMNLKTLDIHDAQI 962

Query: 915  NLNEMGKSIYNAKAADAF--AGNLTNHNMFNDYS---LAKLLEHVRFLEECTIQLSNLVQ 969
              N + K + N +       + N+ + + ++D     L  L E + F  ECT++L + V+
Sbjct: 963  RFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDKGVLLESLHEDISFFNECTLKLIHDVE 1022

Query: 970  LILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTD--------------------- 1008
             I+  KIPNWWK YGEL+ L+K Y K FP+ V     TD                     
Sbjct: 1023 NIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGNNANTNTNTNTNTNTNS 1082

Query: 1009 ------------TSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLA 1056
                         S +      IE ++ + E++ +  I  +   L+ LGS +   HE LA
Sbjct: 1083 PQRLHHHSEHQNNSNNGVFANLIENQKNKLERKTSHHIDETISLLESLGSGLLNKHEHLA 1142

Query: 1057 EELSNYMEFRKACLNQRNIVAFAATNISVLQENI 1090
            EEL+ YMEF+     +  +  F   +I +L+E++
Sbjct: 1143 EELNRYMEFKNRFFGRNIMKNFVGEDIKLLEEHV 1176

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  514 bits (1324), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 239/289 (82%), Positives = 267/289 (92%)

Query: 1   MSISHLPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKL 60
           MS+ HLPTLLNPL+NAIFNCPEPE+SPLKKLFA LKT RFILLAPPSEYLLNYHDVK+KL
Sbjct: 1   MSVYHLPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKL 60

Query: 61  PLHELCYNAEFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFQVR 120
           PLH+LCYNAEFINS+ILLMTENS+INTNSRDSHYETLDGKTVVIQWKNNVIHALNGF +R
Sbjct: 61  PLHDLCYNAEFINSYILLMTENSYINTNSRDSHYETLDGKTVVIQWKNNVIHALNGFHIR 120

Query: 121 RRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVH 180
           RRLKIL TKILPNFNDYFEGA DF+I++I+QPL+CE VPNDYLQCFH+Y+KIPK+ +++ 
Sbjct: 121 RRLKILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYLQCFHNYEKIPKNAHAMP 180

Query: 181 NLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQAFEGM 240
           NLS+DS QQERSSFENILHIHP RLTQLG++FS+YRTLAP DDPS  IFE IVQQAF+GM
Sbjct: 181 NLSIDSFQQERSSFENILHIHPARLTQLGQLFSSYRTLAPGDDPSRSIFESIVQQAFDGM 240

Query: 241 KSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYF 289
           KSDSLFK F NLYDLIH+YFELNLYDDIWSRLT+HFK +EV TE+   F
Sbjct: 241 KSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLTTHFKGHEVDTEKINIF 289

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
            similarities with uniprot|Q04257 Saccharomyces cerevisiae
            YML002W and some similarities with uniprot|Q04257
            Saccharomyces cerevisiae YML003W Hypothetical ORF
          Length = 1067

 Score =  500 bits (1287), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 340/1086 (31%), Positives = 560/1086 (51%), Gaps = 101/1086 (9%)

Query: 16   AIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHELCYNAEFINSH 75
            AIFNCP P+ S LK++F+ L   RF +L P +E LL + D+++ L L ELCY+ +F+ SH
Sbjct: 15   AIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELAELCYHYDFVASH 74

Query: 76   ILLMTENSFINTNSR---DSHYETLDGKTVVIQWKNNVIHALNGFQVRRRLKILGTKILP 132
            I+++ + +    + R   ++ + TL+G+ + I+++N+ I   +GF  RR++ I    +LP
Sbjct: 75   IVVIKDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFTERRKITIKEINLLP 134

Query: 133  NFNDYFEGATDFVIIYIEQPLSCESVPNDYLQCFHSYKKIPKSVYSVHN---LSLDSSQQ 189
             FNDY +G+    I++I  PL  + VP D LQ F    K+  + YS      L  D  Q+
Sbjct: 135  TFNDYLKGSNYTPILHISMPLCGDLVPLDELQVF---SKVAGNKYSKQEQAPLPFDEEQK 191

Query: 190  ERSSFEN--------------ILHIHPTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQ 235
            +   FE                 H+   R+ +   +         + D   +I       
Sbjct: 192  KVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDSIRQII------ 245

Query: 236  AFEGMKSDSLFKKFPNLYDL---IHEYFELNLYDDIWSRLTSHFKSYEV----GTEEYKY 288
                    SL K+  +L DL   I++Y EL L+ DI  +L+   +  E+      +  + 
Sbjct: 246  --------SLDKRLNHLEDLDAMIYDYVELKLFTDIQQQLSEIVEDQELEHRFDFKALRS 297

Query: 289  FSINHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQEL 348
             S+N +  +FY KD + F L  V  +EK V+ A ++ + + L  +++ K ++L  T++ L
Sbjct: 298  ISLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLL 357

Query: 349  SGTTDMGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXX 408
            S               +N ++ DADTL+SLFVL+ICRS+   L   L YL NF       
Sbjct: 358  SR-------------EINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSI 404

Query: 409  KFGILGYAVSTLEAVVCYF-----EDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKV 463
            KFG+ GY +ST EA + +F     +   K   +  K    +QK  ++   L   N     
Sbjct: 405  KFGLQGYVLSTFEAALSFFHQDTVDSLTKKCASNKKIWASIQKHSKVEAELLSSN----- 459

Query: 464  ENLATYKDILPYRNGQGQSILSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTL 523
                     L  R   G+S+LSICI ++ N +L  +L+ ++S FPLED+L+D     STL
Sbjct: 460  ---------LRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTL 510

Query: 524  LIESIKSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEIDILKSIGNY 583
            LI++++  N +AA IL  I++ +CTE E+ SY+N  + ++R  AHY+  +I +L+S+G Y
Sbjct: 511  LIQALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRY 570

Query: 584  VDWKRKNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGND 643
             +W+ K+  G TPLF++FRSYD  NY+ +V    +    WY   N+ F+++ H D KGN 
Sbjct: 571  FNWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVVKWYANNNKPFNFKIHEDPKGNT 630

Query: 644  LLHVLKTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKS 703
            LLHV+K+    LL+L  +++N  + KGLTPLM+Y +Y R+ NIE I+KD+RL+ + +Q+ 
Sbjct: 631  LLHVMKSGIESLLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQP 690

Query: 704  TFFTCFDYAKDHTVLSKVGERGAKDSLFGL--IYFHSLRYHNLNAAVNITFASDTEKPFS 761
               T  D+ K+  V   +      D+ F    +  HSLR+      + I F+    K +S
Sbjct: 691  LVMTSLDFTKNPKVTKTI-----LDATFNREPVVIHSLRFEERKWKIGI-FSEGIFKKYS 744

Query: 762  NTVINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNC 821
                 +  IQ  LR +    P +F P+ +  +E+  L    V  + +        KL   
Sbjct: 745  -----LDLIQYYLRYLKIMYPCSFHPVQLLTNELRLLGIYGVPGVLRLQSYHTFKKLDML 799

Query: 822  FNVLLFLKKVPKSLFTDEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFN 881
            F+ +    K+   L  DE  +   + + T   ++     E +  +EPEEIN IQ+FL++N
Sbjct: 800  FSYVNTRGKL--WLGKDEEELKVLLDVPTPYLSE----SERFIKLEPEEINGIQTFLKYN 853

Query: 882  FDEISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNM 941
              E    +  L IL+K+ I   +K  D   + ++   +G  +     A +F    TN   
Sbjct: 854  LAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMSQKGVAKSFEN--TNCAW 911

Query: 942  FNDYSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVV 1001
              D S  +   ++ +LE   + L N  +  LL K   WWKH+GEL+ L K ++K FP+  
Sbjct: 912  SYDLSYYEFTRNLEYLEHSVVTLLNNFE-SLLAKTTLWWKHFGELMELKKEWKKNFPNDK 970

Query: 1002 KPKSTTDTSGHIQLGGFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSN 1061
             P S+ + +    +  +IE KR +   +L+ Q+K+SS +LK++G EI   HE +A  ++ 
Sbjct: 971  APPSSANRNF---IDTYIEGKRSKFRNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINL 1027

Query: 1062 YMEFRK 1067
            ++EF++
Sbjct: 1028 FIEFKE 1033

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score =  446 bits (1146), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 377/1226 (30%), Positives = 601/1226 (49%), Gaps = 190/1226 (15%)

Query: 9    LLNPLINAIFNCPEPE--KSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKT-------- 58
            +LNPLI  +F+    +    PLKKLF  LK  +F+LLAPP++ LLNY D           
Sbjct: 5    ILNPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDSSNITPRNPYN 64

Query: 59   ---KLPLHELCYNA-EFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHAL 114
                 PL +LC N+ +FI SHILL       N        E+++GKT+ I+ +     AL
Sbjct: 65   GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCV---MESINGKTITIK-RVTGNGAL 120

Query: 115  NGFQV------------RRRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDY 162
            N  ++            ++ LKI+   +  NFN Y +G  ++ I YI+ PL    + N++
Sbjct: 121  NNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEF 180

Query: 163  LQCF-------HSYKKIPKSVYSVHN--------------LSLDSSQQERSSFENILHIH 201
            L  F         Y  I + V  + N              L  D SQ +R  F  +  I 
Sbjct: 181  LTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKL--IK 238

Query: 202  PTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQA---------------FEGMKSDSL- 245
              R+     + ++YR      + +E + + I +                 FE +K +   
Sbjct: 239  DDRVIW-QPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRY 297

Query: 246  -FKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLLADFYS-KDF 303
             F    NL +LI+E+ E+ L+DDIW R++  F   +    +    S+N LL +FYS  +F
Sbjct: 298  NFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTNNF 357

Query: 304  REFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLDVPG 363
            + FKL D+  +EK++  A  +FQK     ++ EKS  L++TLQ L+              
Sbjct: 358  KNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT-------------- 403

Query: 364  RLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGILGYAVSTLEAV 423
             +N L  DADTLI L  +VICR + ++LKSHL+YLQNF       KFGILGY++STLEA+
Sbjct: 404  -INKLT-DADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAI 461

Query: 424  VCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQGQSI 483
              YF+    +     KA+ L+    +L N+   + + N +++L    DIL YR+  G+S+
Sbjct: 462  TYYFDHISHSH----KAD-LIAFCDKLHNLY--DTILNNIKSLDN--DILSYRSQNGESL 512

Query: 484  LSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILIRIM 543
            LS+CI NNK  I L++L+ Y+  FP+ED+L+D  ++GS+LL+++ K  N  A++IL+ I+
Sbjct: 513  LSLCIINNKMDIFLELLTTYEHSFPIEDILDDSDLNGSSLLMQACKYNNYVASEILVTIL 572

Query: 544  MLNCTEEELISYINRTDKYSRTVAHY--LTHEIDILKSIGNYVDWKRKNSGGQTPLFSIF 601
              +C EEEL  ++N+TDK++R+VAHY  + + I IL   GN +DW+ K+    TPL +IF
Sbjct: 573  KNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIF 632

Query: 602  RSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTKL 661
            + +     E+ +KI F +  TWY+  N+ F+ + H D  GN+LLHV+K   + L++  +L
Sbjct: 633  KVHKVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPEL 692

Query: 662  ----DINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTV 717
                +IN  N KGL+P MVY K  R +NI  I+K+  L+  + Q     T  +       
Sbjct: 693  CETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTNLYN---- 748

Query: 718  LSKVGERGAKDSL----FGLIYFHSLRYHNLNAAVNIT----------FASDTEKPFSNT 763
             SKV    A   L    F  I  HSLR+++ +++ + T             ++E P S+ 
Sbjct: 749  -SKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTSHP 807

Query: 764  VI------NMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTI------------ 805
             I       +KTI+ LL   ++   ++ LPL   ++  + L +S+ +I            
Sbjct: 808  SICRTKTLKLKTIKSLLHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLS 867

Query: 806  --IGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEASILYWMRINTSK----------- 852
              I K ++   L  +SNC N L        +L  DE  +  +++IN  K           
Sbjct: 868  LLIDKLEIQYNLKLISNCLNFLFITTDFDFTLLFDELKLQAFLKINNKKLKESNSSNKFS 927

Query: 853  -RNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILIFISLK------ 905
             +N    + E  K  +PE+IN IQ+F++FN  E+ +FK +++ ++ + I I  K      
Sbjct: 928  HKNNSDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNS 987

Query: 906  ------SNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYS--------LAKLL 951
                   N  K   +NL+E+ K     K       N      F DY+        L KLL
Sbjct: 988  SQFFFQKNTLKIGINNLSEILKYYSTQK---PLITNAYTSRKFYDYNSYDYKVEFLNKLL 1044

Query: 952  EHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSG 1011
            E++ F E+   +L    + +    I  WW HYG L+     Y K +P+        D + 
Sbjct: 1045 ENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPN-----RKIDINN 1099

Query: 1012 HIQLGGFIETKR------EQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEF 1065
            + +    +  KR         E+ + + IK +S  L+   ++I   HE LA EL+N+M F
Sbjct: 1100 NFESFNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNF 1159

Query: 1066 RKACLNQRNIVAFAATN-ISVLQENI 1090
            +   + +  I+ F+    I +L++NI
Sbjct: 1160 KNKFIREY-IIKFSTIEVIKILKDNI 1184

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  327 bits (839), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 273/846 (32%), Positives = 435/846 (51%), Gaps = 106/846 (12%)

Query: 260  FELNLYDDIWSRLTSHFKSYEVGTEEYK--YFSINHL-LADFYSKDFREFKLQDVTFIEK 316
            FE  LY  IW++L  H  S     +++   Y S + L + D+YS  F +F L+DV FIE 
Sbjct: 178  FEARLYSSIWNKLV-HQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIEN 236

Query: 317  RVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLDVPGRLNNLAMDADTLI 376
             V LA K F KL  + S+ EK  IL+ T   L+              +L  L +DAD L+
Sbjct: 237  VVDLACKEFVKLRESLSFDEKIDILLSTFNILTS-------------KLPQLEIDADNLL 283

Query: 377  SLFVLVICRSEQKHLKSHLYYLQNFXXXXXXXKFGILGYAVSTLEAVVCYFEDFKKNSDN 436
            +  +++I R +  +L  H +YLQNF        FGIL YA+STL AV+ Y ++       
Sbjct: 284  NFMLIIINRVKLNNLNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDNN------ 336

Query: 437  MAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQGQSILSICISNNKNHIL 496
                   L K KR          T+ +++    ++ L YRN  G+S L  CI    N  L
Sbjct: 337  -------LDKFKR---------YTDAIQDSKISEEKLKYRNENGESYLCHCIITKDNDTL 380

Query: 497  LDIL--SEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILIRIMMLNCTEEELIS 554
             ++L  SEY   FP+ED+L+D+TIDGSTLL+ ++K  N  AA ILI I++ N T +E+ +
Sbjct: 381  RELLFSSEYIKNFPMEDILDDQTIDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIRT 440

Query: 555  YINRTDKYSRTVAHYLTHEIDILKSIGNYVDWKRKNS-GGQTPLFSIFRSYDQP--NYEA 611
            Y+N  D+ +R V H++T++  +L  IG Y++W  K+   GQTPLF+IFRSYDQ   +Y+ 
Sbjct: 441  YVNSVDENNRNVGHFITNQYYLLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSIKSYKK 500

Query: 612  MVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTKLDINGENYKGL 671
            M + +F  A       +  F  + H DN  N LLH+LKT+  ++L    L IN  N  G+
Sbjct: 501  MSRRSFRFA-----MDSGDFQLKKHIDNSNNTLLHILKTNIQMILPHASLFINSPNSLGM 555

Query: 672  TPLMVYVKYKRLNNIEAII----KDQRLVLEKIQ-KSTFFTCFDYAKDHTVLSKVGERGA 726
            TPLMV+ KY+RL NI+ ++    KD+  + E  Q  + +  CF    D  +L+ +G+   
Sbjct: 556  TPLMVFCKYRRLYNIQILLSSKFKDRVSIFETQQVHNAWSNCFSLTNDDQILNLLGKFAI 615

Query: 727  KD-SLFGLIYFHSLRY------HNLNAAVNITFASDTEKPFSNTVINMKTIQGLLRSILK 779
            K+ S+FG  + HSL+       H      ++      EK +     N+KTI+ L+  +L 
Sbjct: 616  KNYSIFGNCFTHSLKQFLHKSKHGNKNQYSVKITLKFEKKYKTIRFNIKTIKALINMVLT 675

Query: 780  DNPF--TFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFT 837
             N    +FLPL    +E++ ++    ++I     +  ++ L+   + +LFL+ VP+  F 
Sbjct: 676  SNSHVSSFLPLYKVFNELNGIA----SMISTKSKILFINNLNVILDTILFLELVPREGFI 731

Query: 838  DEASILYWMRINTSKRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASL-SILR 896
             EA +  ++R   ++R  K  + ++ K ++ E+INMI +FL+FN +E+++FK  +  ILR
Sbjct: 732  LEARLKDYLR---NQRKIKTVATKS-KKLQIEDINMISNFLKFNLNELNAFKNGVKKILR 787

Query: 897  KILIFISLKSNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYSLAKLLEHVRF 956
            ++             +N  L +   S  +         +L N     +Y++  L+ + + 
Sbjct: 788  QM-----------NSINLKLFDQRISYMDLLHCPDVVVHLNNPLWNLNYNI--LISNFQI 834

Query: 957  LEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLG 1016
            LE       + +++   EKI  WWK   ELI L            K  S +D      L 
Sbjct: 835  LENSIDNTLHFLKVFQNEKIRKWWKLNNELINL-----------TKLASNSDDD---LLR 880

Query: 1017 GFIETKREQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACLNQRNIV 1076
             F   K     ++L+++I    +S+ EL  +IFV+HE LA E++N+M+F K     R +V
Sbjct: 881  SFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKF-KPLFITRTLV 934

Query: 1077 AFAATN 1082
             +A  N
Sbjct: 935  VWAHRN 940

>Kpol_463.13 s463 complement(35514..37913) [2400 bp, 799 aa] {ON}
           complement(35514..37913) [2400 nt, 800 aa]
          Length = 799

 Score = 35.4 bits (80), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 93/232 (40%), Gaps = 42/232 (18%)

Query: 440 ANVLLQKTKRLVNMLSCENVTNKVENLA---TYKDILPYRNGQGQSILSICIS---NNKN 493
           A++   KT     ML     TN++ N+    T  D LP    +G +I S  IS    N +
Sbjct: 28  AHIDAGKTTTTERMLYYSGKTNRIGNVDQGDTVTDYLPQERSRGITIQSAAISFNWQNDH 87

Query: 494 HI-LLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILIRIMMLNCTEEEL 552
            I L+D     D  F  E +   + +DG   +++++     +  K+  +   +       
Sbjct: 88  RINLIDTPGHVD--FTFEVIKSLKVLDGCVTILDAVAGVEAQTEKVWKQSYGI-----PK 140

Query: 553 ISYINRTDK----YSRTVAHYLTHEIDILKSIGNYVDWKRKNSGGQTPLFSIFRSYDQPN 608
           I YIN+ D+    YSRTV   +             +   ++      PLF +    ++  
Sbjct: 141 ICYINKMDRVGSGYSRTVKELM-------------IKMNQRVVLANMPLFKLDPVTNEQV 187

Query: 609 YEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTK 660
           +E ++ +    A  W           D TD    D+  + K D+S+L +LTK
Sbjct: 188 FEGVLDVVNMKALRW-----------DSTDVNKVDIADIDKFDSSLLDELTK 228

>TDEL0A06780 Chr1 complement(1182697..1183299) [603 bp, 200 aa] {ON}
           Anc_6.265 YPL239W
          Length = 200

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 521 STLLIESIKSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHY--LTHEIDILK 578
           ST L  +  +G+ +  K L+ ++  N T EEL  Y+N+ ++   T  H+  L  ++D++K
Sbjct: 51  STALHMACANGHTDVVKYLLTLVKENATSEELKDYVNKQNETGNTALHWASLNGKLDVVK 110

Query: 579 SI-GNY 583
            + G Y
Sbjct: 111 LMCGEY 116

>TDEL0E05570 Chr5 (1025692..1031415) [5724 bp, 1907 aa] {ON} Anc_4.50
            YLR305C
          Length = 1907

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 64/145 (44%), Gaps = 25/145 (17%)

Query: 713  KDHTVLSKVGERGAKDSLFGLIYFHSLRYHNLNAAVNITFASDTEKPFSNTVINMKTIQG 772
            K+ + L+ VG R    ++ G I  HS R  NL     I+   D  +     V N+K    
Sbjct: 1014 KELSKLTYVG-RERPSTIAGFISQHSWRSKNLVDTAIISSPQDVAQQIGKHVENIK---- 1068

Query: 773  LLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIGKADVMSLLHKLSNCFNVLLFLKKVP 832
              RSI  + P +F    I++D    LS + + ++GK    SL++ L +          +P
Sbjct: 1069 --RSIDAEEPVSFRDTTIFLD----LSTASL-LLGKFAAASLVYDLVH----------IP 1111

Query: 833  KSLFTDEA---SILYWMRINTSKRN 854
             S+FT  A   +   W+ +   +R+
Sbjct: 1112 FSIFTSPAIKTATNVWLTVIKERRD 1136

>ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} similar to
            uniprot|Q756L3 Ashbya gossypii AER241W AER241Wp and
            weakly similar to uniprot|P32380 Saccharomyces cerevisiae
            YDR356W SPC110 Inner plaque spindle pole body (SPB)
            component
          Length = 835

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 79/342 (23%), Positives = 127/342 (37%), Gaps = 58/342 (16%)

Query: 748  VNITFASDTEKPFSNTVINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTIIG 807
            V    A + ++P   T ++    Q  L  +      T L LN Y DE++ L    + I  
Sbjct: 197  VEANAAENKQEPV--TEVDHTACQRELSYVQNQLEKTTLQLNTYRDEVAHLEDKTIRIQE 254

Query: 808  KADVMSLLHKLS--------NCFNVLLFLKKVPKSLFTDEASILYWMRINTSKRNQKQPS 859
                    H+L         N  NV L  K+    L  D A I   M       NQ    
Sbjct: 255  DQRAKEEQHQLEIQMLRSDVNNLNVSLVNKES--ELEEDRAKIQRLM-------NQLHE- 304

Query: 860  KENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILIFISLKSNDFKDVNDNLNEM 919
               +     + +  ++  L    D ISS +  +  L    + +  +  D           
Sbjct: 305  ---FDHKGSQSLLDLERQLEMKRDSISSLEKEVRALTHDRVHLETRIKD----------- 350

Query: 920  GKSIYNAKAA---DAFAGNLTNHNMFN------DYSLAKLLEHVRFLEECTIQLSNLVQL 970
             + I NAK     +    N+ N+N  N       ++ A L + VR L   T +  NL Q 
Sbjct: 351  -REIENAKIQSELERLRDNVKNNNSSNFEIGELKHAKASLDDKVRNL---TEERHNLNQR 406

Query: 971  I--LLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSGHIQLGGFIETKREQSEQ 1028
            I  L ++   W   Y    +L  N+RKAF S+ +   TT T          ET++  + Q
Sbjct: 407  ISALRKECDEWKSKYQRNESLDSNHRKAFDSLRQELQTTKTQ-------LEETRK--TAQ 457

Query: 1029 RLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEFRKACL 1070
            +L  Q+  ++    E  S+     E   ++L + ++F K  L
Sbjct: 458  QLQTQVIENTTKNSERTSQRIKDKETQIQKLESELQFCKQQL 499

>Kwal_47.19067 s47 complement(1083210..1085855) [2646 bp, 881 aa]
           {ON} YER033C (ZRG8) - zinc regulated gene [contig 188]
           FULL
          Length = 881

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 9/91 (9%)

Query: 8   TLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPS--EYLLNYHDVKTKLPLHEL 65
           +L +P   A  + P+ +KS   +    + +C+  L  PP     +L YHD+ + L     
Sbjct: 646 SLCDPTTTASTSEPKIQKSSFTQDAKVVSSCQSPLALPPPAKSQVLKYHDLSSNL----- 700

Query: 66  CYNAEFINSHILLM--TENSFINTNSRDSHY 94
            Y+     S++  +  TE  + N N  D HY
Sbjct: 701 DYDVPGAMSNLFFIDETEEDYYNKNQPDDHY 731

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 119,966,606
Number of extensions: 5626781
Number of successful extensions: 19415
Number of sequences better than 10.0: 66
Number of HSP's gapped: 19868
Number of HSP's successfully gapped: 68
Length of query: 1090
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 970
Effective length of database: 39,721,479
Effective search space: 38529834630
Effective search space used: 38529834630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)