Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.158.852ON35735717100.0
YML119W8.852ON35735812951e-179
Skud_13.228.852ON35635911861e-163
Suva_13.248.852ON36036311051e-150
ZYRO0C14916g8.852ON3282712019e-17
Kpol_237.38.852ON3512401726e-13
CAGL0B02409g8.852ON361621664e-12
TPHA0I003408.852ON3952251593e-11
KAFR0A028808.852ON4301351532e-10
KNAG0G034908.852ON317571486e-10
NDAI0E002408.852ON519541471e-09
TDEL0B002108.852ON333831406e-09
NCAS0B002508.852ON316571381e-08
TBLA0D033108.852ON502281301e-07
KLLA0C06292g8.852ON256311272e-07
KLTH0C03652g8.852ON276491245e-07
AFR449W8.852ON2991091229e-07
SAKL0D01122g8.852ON311341175e-06
Kwal_27.102108.852ON278281166e-06
NCAS0A050602.497ON142835694.7
KAFR0C035308.33ON59593686.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.15
         (357 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W (...   663   0.0  
YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative pro...   503   e-179
Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W (...   461   e-163
Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W (...   430   e-150
ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa] ...    82   9e-17
Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON} co...    71   6e-13
CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {...    69   4e-12
TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}...    66   3e-11
KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {O...    64   2e-10
KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON...    62   6e-10
NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852...    61   1e-09
TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}...    59   6e-09
NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852 ...    58   1e-08
TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {O...    55   1e-07
KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {O...    54   2e-07
KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {O...    52   5e-07
AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic h...    52   9e-07
SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved...    50   5e-06
Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {O...    49   6e-06
NCAS0A05060 Chr1 complement(1005175..1009461) [4287 bp, 1428 aa]...    31   4.7  
KAFR0C03530 Chr3 (720258..722045) [1788 bp, 595 aa] {ON} Anc_8.3...    31   6.6  

>Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W
           (REAL)
          Length = 357

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/357 (92%), Positives = 329/357 (92%)

Query: 1   MSQSPSVSPRRTLNNKSSYISNGGGLALPPSELKLNQQPILGFQQKATFDSNQQFFYYPE 60
           MSQSPSVSPRRTLNNKSSYISNGGGLALPPSELKLNQQPILGFQQKATFDSNQQFFYYPE
Sbjct: 1   MSQSPSVSPRRTLNNKSSYISNGGGLALPPSELKLNQQPILGFQQKATFDSNQQFFYYPE 60

Query: 61  SPTKNLRPRFNSTSQINKGFNENRYAGCNNNGNRSSRYANTTGAANVGASSHPHHQSVSH 120
           SPTKNLRPRFNSTSQINKGFNENRYAGCNNNGNRSSRYANTTGAANVGASSHPHHQSVSH
Sbjct: 61  SPTKNLRPRFNSTSQINKGFNENRYAGCNNNGNRSSRYANTTGAANVGASSHPHHQSVSH 120

Query: 121 LNTKSLKFNQTKEVNSIKDITFPPRTCTIKRYFTSPIDLSGARKNTSTAPALTNSPIKSK 180
           LNTKSLKFNQTKEVNSIKDITFPPRTCTIKRYFTSPIDLSGARKNTSTAPALTNSPIKSK
Sbjct: 121 LNTKSLKFNQTKEVNSIKDITFPPRTCTIKRYFTSPIDLSGARKNTSTAPALTNSPIKSK 180

Query: 181 ANFNIRKYILPRSVITTYKLSSPVYETXXXXXXXXXXXXXXXXFEKNYHFWQPIQLSVNK 240
           ANFNIRKYILPRSVITTYKLSSPVYET                FEKNYHFWQPIQLSVNK
Sbjct: 181 ANFNIRKYILPRSVITTYKLSSPVYETIDDISKKVIILLISLKFEKNYHFWQPIQLSVNK 240

Query: 241 KTRISKTLDELCEEQLASTFQQQSQLQNNVKSLKNPSNTNAKQRTGASVALAANESFELS 300
           KTRISKTLDELCEEQLASTFQQQSQLQNNVKSLKNPSNTNAKQRTGASVALAANESFELS
Sbjct: 241 KTRISKTLDELCEEQLASTFQQQSQLQNNVKSLKNPSNTNAKQRTGASVALAANESFELS 300

Query: 301 FDGKAMDRSDIFRMVDSFSIAISXXXXXXXXXXXXFQQRSESNRILPAEILSNEPLE 357
           FDGKAMDRSDIFRMVDSFSIAIS            FQQRSESNRILPAEILSNEPLE
Sbjct: 301 FDGKAMDRSDIFRMVDSFSIAISDDDDDDDDEEDDFQQRSESNRILPAEILSNEPLE 357

>YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative
           protein of unknown function; YML119W is not an essential
           gene; potential Cdc28p substrate
          Length = 357

 Score =  503 bits (1295), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 257/358 (71%), Positives = 280/358 (78%), Gaps = 2/358 (0%)

Query: 1   MSQSPSVSPRRTLNNKSSYISNGGGLALPPSELKLNQQPILGFQQKATFDSNQQFFYYPE 60
           MS SPSVSPRRTLNNKSSYI+N GGL LPP++  LNQQP+L FQQKATFDSNQQFFYYPE
Sbjct: 1   MSPSPSVSPRRTLNNKSSYINNSGGLVLPPTQFNLNQQPVLSFQQKATFDSNQQFFYYPE 60

Query: 61  SPTKNLRPRFNSTSQINKGFNENRY-AGCNNNGNRSSRYANTTGAANVGASSHPHHQSVS 119
           SPTKNLRPRFNS SQ+NKG NE+ Y  G ++N NR SRY NT GAAN   +SHPHHQSVS
Sbjct: 61  SPTKNLRPRFNSISQVNKGVNEDHYTGGGSSNNNRPSRYTNTMGAANTNVNSHPHHQSVS 120

Query: 120 HLNTKSLKFNQTKEVNSIKDITFPPRTCTIKRYFTSPIDLSGARKNTSTAPALTNSPIKS 179
           HLN+KSLKFNQTKEV+SI +I FP RTCT KRYFT PIDL G R +TS AP LTNSP KS
Sbjct: 121 HLNSKSLKFNQTKEVSSINEIIFPSRTCTKKRYFTKPIDLYGTRSSTSVAPKLTNSPTKS 180

Query: 180 KANFNIRKYILPRSVITTYKLSSPVYETXXXXXXXXXXXXXXXXFEKNYHFWQPIQLSVN 239
           K NFNI+K ILPRSV+TTYKL SPV+ET                FEKNYHF QPIQLS N
Sbjct: 181 KTNFNIKKCILPRSVVTTYKLPSPVHETIDDISKKIIILLISLKFEKNYHFLQPIQLSTN 240

Query: 240 KKTRISKTLDELCEEQLASTFQQQSQLQNNVKSLKNPSNTNAKQRTGASVALAANESFEL 299
            KTRISK+LDELC  QL ST +QQ QLQ N K +KN  N+NAKQR GASV+  ANESFEL
Sbjct: 241 SKTRISKSLDELCGVQLTSTLRQQKQLQGNSKPVKNLPNSNAKQRAGASVSTNANESFEL 300

Query: 300 SFDGKAMDRSDIFRMVDSFSIAISXXXXXXXXXXXXFQQRSESNRILPAEILSNEPLE 357
           SFDGKAMDRSDIFRMVDSFSIAIS            FQQRS +NRILPAEILSNEPL+
Sbjct: 301 SFDGKAMDRSDIFRMVDSFSIAIS-DEDEEDEEEDSFQQRSANNRILPAEILSNEPLK 357

>Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W
           (REAL)
          Length = 356

 Score =  461 bits (1186), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 248/359 (69%), Positives = 276/359 (76%), Gaps = 5/359 (1%)

Query: 1   MSQSPSVSPRRTLNNKSSYISNGGGLALPPSELKLNQQPILGFQQKATFDSNQQFFYYPE 60
           MS SPSVSPRRTLNNKSSYI NG GL LPP+++KLNQQP+L FQQK TFDSNQQFFYYPE
Sbjct: 1   MSPSPSVSPRRTLNNKSSYIGNGSGLVLPPTQVKLNQQPVLSFQQKTTFDSNQQFFYYPE 60

Query: 61  SPTKNLRPRFNSTSQINKGFNENRYAG-CNNNGNRSSRYANTTGAANVGASSHPHHQSVS 119
           SPTK+ RPRFNS SQINK  NEN YAG  N+NGNR SRY    GAANV A+ HPHHQSVS
Sbjct: 61  SPTKSQRPRFNSVSQINKDTNENYYAGAANSNGNRPSRYP-NAGAANVNANPHPHHQSVS 119

Query: 120 HLNTKSLKFNQTKEVNSIKDITFPPRTCTIKRYFTSPIDLSGARKNTS-TAPALTNSPIK 178
           H+N+K+ KFNQTKEV SIKDI+FP RTCT KRYFTSPIDL G R N+S   P LTNSP+K
Sbjct: 120 HINSKAPKFNQTKEVKSIKDISFPSRTCTAKRYFTSPIDLHGIRNNSSNITPTLTNSPMK 179

Query: 179 SKANFNIRKYILPRSVITTYKLSSPVYETXXXXXXXXXXXXXXXXFEKNYHFWQPIQLSV 238
           SKANFNI+K+ILPRSVI TYKL+SPV+ET                FEK+YH  QPIQLS 
Sbjct: 180 SKANFNIKKFILPRSVIITYKLASPVHETIDDISKKIIILQISLNFEKSYHSLQPIQLST 239

Query: 239 NKKTRISKTLDELCEEQLASTFQQQSQLQNNVKSLKNPSNTNAKQRTGASVALAANESFE 298
           ++KTRI K+LDELC E L    +QQSQ QNN+K +KN  N N KQRT  S+   ANESFE
Sbjct: 240 DRKTRILKSLDELCGEHLVLLPKQQSQPQNNIKPVKNLPNINTKQRTSTSIGTTANESFE 299

Query: 299 LSFDGKAMDRSDIFRMVDSFSIAISXXXXXXXXXXXXFQQRSESNRILPAEILSNEPLE 357
           LSFDGKAMDRSDIFRMVDSFSIAIS            FQQR++SNRILPAEILSN  L+
Sbjct: 300 LSFDGKAMDRSDIFRMVDSFSIAIS--DEDEDDDEDNFQQRNKSNRILPAEILSNGLLK 356

>Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W
           (REAL)
          Length = 360

 Score =  430 bits (1105), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 237/363 (65%), Positives = 268/363 (73%), Gaps = 9/363 (2%)

Query: 1   MSQSPSVSPRRTLNNKSSYISNGGGLALPPSELKLNQQPILGFQQKATFDSNQQFFYYPE 60
           MSQSPSVSPRRTLNNKSSYIS+ GG  LPP++L LNQQP+L FQQKATFDSNQQFFYYP+
Sbjct: 1   MSQSPSVSPRRTLNNKSSYISSNGGPLLPPAQLDLNQQPVLNFQQKATFDSNQQFFYYPD 60

Query: 61  SPTKNLRPRFNSTSQINKGFNENRYA---GCNNNGNRSSRYANTTGAANVGASSHPHHQS 117
           SPTK  RPRFNS SQ NK  NEN Y      NN  NRSSRY NTT  ANV   S+PHHQS
Sbjct: 61  SPTKKPRPRFNSASQTNKDSNENYYTSGNNGNNGNNRSSRYPNTTSTANVN--SNPHHQS 118

Query: 118 VSHLNTKSLKFNQTKEVNSIKDITFPPRTCTIKRYFTSPIDLSGARKNTSTA-PALTNSP 176
           VSH+N+KSL+F+QTKE +SI+DI FP RTCT KRYFT PIDL G R N ST  P L +SP
Sbjct: 119 VSHINSKSLRFHQTKEADSIQDIPFPSRTCTAKRYFTKPIDLYGTRNNCSTVMPGLMSSP 178

Query: 177 IKSKANFNIRKYILPRSVITTYKLSSPVYETXXXXXXXXXXXXXXXXFEKNYHFWQPIQL 236
            KSKANF I+K ILPR VITTYKL SPVY+T                FEK+YHF QPIQL
Sbjct: 179 TKSKANFTIKKSILPRCVITTYKLPSPVYKTIDDISKKIIILQISLNFEKSYHFLQPIQL 238

Query: 237 SVNKKTRISKTLDELCEEQLA--STFQQQSQLQNNVKSLKNPSNTNAKQRTGASVALAAN 294
           S NKKTR+SK+++ELC + L+     + Q QLQ+N+K +KN  NTN KQRT  +    AN
Sbjct: 239 STNKKTRVSKSIEELCRDLLSPPPPSKSQHQLQSNIKPMKNAQNTNTKQRTSINAGTNAN 298

Query: 295 ESFELSFDGKAMDRSDIFRMVDSFSIAISXXXXXXXXXXXXFQQRSESNRILPAEILSNE 354
           ESFELSFDGKAMDRSDIFRMVDSFSIAIS            FQQR+ ++RILPAEILSN 
Sbjct: 299 ESFELSFDGKAMDRSDIFRMVDSFSIAIS-DDDDDDDDEDSFQQRNRNSRILPAEILSNG 357

Query: 355 PLE 357
           PL+
Sbjct: 358 PLK 360

>ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa]
           {ON} some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 328

 Score = 82.0 bits (201), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 84/271 (30%), Positives = 118/271 (43%), Gaps = 44/271 (16%)

Query: 91  NGNRSSRYANTTGAANVGAS--SHPHHQSVSHLNTKSLKFNQTKEVNSIKDITFPPRTCT 148
           N NR  R     GA N  +S    PH +     N ++    + KE++SI ++    +   
Sbjct: 86  NENRLRRSPQRMGAKNTKSSLTGSPHRKGPRSSNLQARGPPKYKEISSIYELE---KVDP 142

Query: 149 IK-------RYFTSPIDLSGARKNTSTAPALTNSPIKSKANFNIRKYILPRSVITTYKLS 201
           +K       RYF+ P+DL  AR +          PI + A+ N + Y  P + I  YKLS
Sbjct: 143 VKQENNFTNRYFSDPVDLDSARSDDGRL-----KPIINTASKNGKSY--PGNKI--YKLS 193

Query: 202 SPVYETXXXXXXXXXXXXXXXXFEKNYHFWQPIQLSVNKKTRISKTLDELCEEQLASTFQ 261
            P+                   +   YH +QP+ L  +   R  +       E L S F 
Sbjct: 194 IPLL--VCQDTHRALKNQIERVYRSKYHSYQPLSLFGDMSIRYYRL------EDLQSRF- 244

Query: 262 QQSQLQNNVKSLKNPSNTNAKQRTGASV--ALAANESFELSFDGKAMDRSDIFRMVDSFS 319
                   ++ L+ P       +   S+    A N+SFELSFDGKA+DRSDIFRMVDSFS
Sbjct: 245 --------IEFLQKPRKPQPPLQVARSLNGTGALNDSFELSFDGKALDRSDIFRMVDSFS 296

Query: 320 IAISXXXXXXXXXXXXFQQRSESNRILPAEI 350
           +A+S            F   S  N ILPAE+
Sbjct: 297 VALS---DDDAEDESSFVNSSGRN-ILPAEM 323

>Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON}
           complement(3052..4107) [1056 nt, 352 aa]
          Length = 351

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 107/240 (44%), Gaps = 35/240 (14%)

Query: 122 NTKSLKFNQTKEVNSIKDITFPPRTCTIK-RYFTSPIDLSGARKNTSTAPALTNSPIKSK 180
           N K    N  +++  + +     +T  IK RYF+S  +L+  R        L N+     
Sbjct: 135 NLKYTIINSERDLLKVDNNELMRKTGAIKNRYFSSITNLNDFRGEDGKLKPLINT----- 189

Query: 181 ANFNIRKYILPRSV----ITTYKLSSPVYETXXXXXXXXXXXXXXXXFEKNYHFWQPIQL 236
                    LP++V       YKL+ PV +                 + K Y+  QP + 
Sbjct: 190 ---------LPKNVQLNRKKNYKLNKPVMQ--EKTSYKVVVELIDQVYNKYYNKLQPYR- 237

Query: 237 SVNKKT----RISKTLDELCEEQLASTFQQQSQLQNNVKSLKNPSNTNAKQRTGASVALA 292
           S++        I   +++LCE +L ++     +  NNV  +   SN+    RT  +  + 
Sbjct: 238 SISDDNIDLGSIENAIEKLCE-RLENSTATNKRTPNNVHDIAKISNS----RTLLTSTIG 292

Query: 293 ANESFELSFDGKAMDRSDIFRMVDSFSIAISXXXXXXXXXXXXFQQRSESNRILPAEILS 352
            N+SFELSFDGKA+DRSDI RMVDSFS+A S                S SN+ LPAEI S
Sbjct: 293 -NDSFELSFDGKALDRSDILRMVDSFSVAFSDDDDENDNGEFI---ASLSNKFLPAEITS 348

>CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119w
          Length = 361

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (67%), Gaps = 3/62 (4%)

Query: 292 AANESFELSFDGKAMDRSDIFRMVDSFSIAISXXXXXXXXXXXXFQQRSESNRILPAEIL 351
           A N+SF+LSFDGKA+DRSDIFRMVDSFSIA S            F  R  +N ILPA++ 
Sbjct: 302 ATNDSFDLSFDGKALDRSDIFRMVDSFSIAFS---DDEDNEESSFISRRNNNDILPADMT 358

Query: 352 SN 353
           +N
Sbjct: 359 NN 360

>TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}
           Anc_8.852 YML119W
          Length = 395

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 96/225 (42%), Gaps = 38/225 (16%)

Query: 151 RYFTSPIDLSGARKNTSTAPALTNSPIKSKANFNIRKYILPRSVITTYKLSSPVYETXXX 210
           +YF+ P+DL+  +          +S  K K   N+      +S+   YKLS P+      
Sbjct: 179 KYFSEPVDLNYYK----------DSDGKIKPVINLVSKKTQQSIKKVYKLSVPI--NYKD 226

Query: 211 XXXXXXXXXXXXXFEKNYHFWQPIQLSVNKKTRISKTLDELCE-----------EQLAST 259
                        +   Y   Q  +        + KTLD + E           E  A+T
Sbjct: 227 TTYSGVSSLIETEYRPLYSKDQSFKFYNKDSVLLFKTLDAIVEKIKASNRKETKENDANT 286

Query: 260 FQQQSQLQNNVKSLKNPSNTNAKQRTGASVALAANESFELSFDGKAMDRSDIFRMVDSFS 319
             ++ +L  + + LK+ +  +    TG  +  + N+SFELSFDGKA+DRSDI RMVDSFS
Sbjct: 287 TLEKIKLNKSSRVLKSINERSFINNTGLKLT-SNNDSFELSFDGKALDRSDILRMVDSFS 345

Query: 320 IAISXXXXXX----XXXXXXFQQ----------RSESNRILPAEI 350
           +A S                F +          R+ +N+ILPAEI
Sbjct: 346 VAFSDDDGDNDDYNEQAESTFDEEFGSKENKYLRTLTNKILPAEI 390

>KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {ON}
           Anc_8.852 YML119W
          Length = 430

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 71/135 (52%), Gaps = 12/135 (8%)

Query: 195 ITTYKLSSPVYETXXXXXXXXXXXXXXXXFEKNYHFWQPIQLSVNKKTRISKTLDELCEE 254
           I TYKLS+P+  +                +       QP+ ++ NK  +I    DEL E 
Sbjct: 250 IQTYKLSTPILSSIKYGSTLSKKIDSH--YNDQNISAQPLFIAGNKNFKI----DELNEA 303

Query: 255 QLASTFQQQSQLQNNVKS---LKNPS-NTNAKQRTGASVALAAN--ESFELSFDGKAMDR 308
            +    +  SQL  +      +KN S N++  QR    +   +N  +SF+LSFDGKA+DR
Sbjct: 304 SVELIDKYLSQLDKSSTGRTLIKNSSLNSSKMQRQRRPLINVSNYNDSFDLSFDGKALDR 363

Query: 309 SDIFRMVDSFSIAIS 323
           +DIFRMVDSFSIA+S
Sbjct: 364 NDIFRMVDSFSIAVS 378

>KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON}
           Anc_8.852 YML119W
          Length = 317

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 35/57 (61%), Gaps = 4/57 (7%)

Query: 294 NESFELSFDGKAMDRSDIFRMVDSFSIAISXXXXXXXXXXXXFQQRSESNRILPAEI 350
           N+SF+LSFDGKAMDRSDIFRMVDSFSIA                 R     ILPAEI
Sbjct: 260 NDSFDLSFDGKAMDRSDIFRMVDSFSIAPDEDDDEDPSPTG----RQVPRNILPAEI 312

>NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852
           YML119W
          Length = 519

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 3/54 (5%)

Query: 273 LKNPSNTNAKQRTGASVALA---ANESFELSFDGKAMDRSDIFRMVDSFSIAIS 323
           LKN ++     R   +V  A    N+SF+LSFDGKAMDRSDIFRMVDSF++A+S
Sbjct: 407 LKNTTSLRKSNRHLINVITANSNPNDSFDLSFDGKAMDRSDIFRMVDSFTMALS 460

>TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}
           Anc_8.852 YML119W
          Length = 333

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/83 (44%), Positives = 46/83 (55%), Gaps = 4/83 (4%)

Query: 270 VKSLKNPSNTNAKQRTGASVALAANESFELSFDGKAMDRSDIFRMVDSFSIAISXXXXXX 329
           V +L+N   T A  R       + N+SF+LSFDGKA+DRSDIFRMVDSFS+A S      
Sbjct: 252 VPNLRNTKKT-ATLRRPLLAGSSLNDSFDLSFDGKALDRSDIFRMVDSFSVAQSDDEPEE 310

Query: 330 XXXXXXFQQRSESNRILPAEILS 352
                       S  +LPAE+ S
Sbjct: 311 DNNNSS---NLHSKNVLPAEMTS 330

>NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852
           YML119W
          Length = 316

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (66%), Gaps = 8/57 (14%)

Query: 296 SFELSFDGKAMDRSDIFRMVDSFSIAISXXXXXXXXXXXXFQQRSESNRILPAEILS 352
           SFELSFDGKA+D+SDI R+VDSF++A S                +E+N ILPA++L+
Sbjct: 263 SFELSFDGKALDKSDILRIVDSFTMAFSDEEIDT--------NENENNNILPADLLN 311

>TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {ON}
           Anc_8.852 YML119W
          Length = 502

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (92%)

Query: 296 SFELSFDGKAMDRSDIFRMVDSFSIAIS 323
           SF+LSFDGKA+DRSDI RMVDSFS+A S
Sbjct: 422 SFDLSFDGKALDRSDILRMVDSFSVAFS 449

>KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 256

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/31 (70%), Positives = 29/31 (93%)

Query: 291 LAANESFELSFDGKAMDRSDIFRMVDSFSIA 321
            +AN+S ELSFDGKAM+++DIFR+VDSFS+A
Sbjct: 196 FSANDSIELSFDGKAMNKNDIFRIVDSFSVA 226

>KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {ON}
           conserved hypothetical protein
          Length = 276

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 272 SLKNPSNTNAKQRTGASVALAANESFELSFDGKAMDRSDIFRMVDSFSI 320
           +LKN S  N   R     +   NES +LSFDGKAM++SDIF+MVDSFS+
Sbjct: 197 TLKN-SKANPLARLALQESAEVNESVDLSFDGKAMNKSDIFKMVDSFSL 244

>AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML119W
          Length = 299

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 54/109 (49%), Gaps = 30/109 (27%)

Query: 228 YHFWQPIQLSVNKKTRISKTLDELCE--------------EQLASTFQQQSQLQNNVKSL 273
           YH  QPI+L       ++ +LD+L E                LAS+    +  Q+ V  L
Sbjct: 180 YHRMQPIRLGSMDGYDVT-SLDQLGEIIERYQVEKPVVKRRSLASS-NYSTVFQDRVDYL 237

Query: 274 KNPSNTNAKQRTGASVALAANESFELSFDGKAMDRSDIFRMVDSFSIAI 322
             P+N              AN+S +LSFDGKA+++SD  RM+DSFS+A+
Sbjct: 238 IVPTN--------------ANDSIDLSFDGKAINKSDFLRMMDSFSLAL 272

>SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved
           hypothetical protein
          Length = 311

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 27/34 (79%)

Query: 288 SVALAANESFELSFDGKAMDRSDIFRMVDSFSIA 321
           S +   N+S +LSFDGKA+D+SDI R+VDSFS+ 
Sbjct: 249 SYSTCQNDSIDLSFDGKALDKSDILRIVDSFSVG 282

>Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {ON}
           YML119W - Hypothetical ORF [contig 39] FULL
          Length = 278

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 27/28 (96%)

Query: 293 ANESFELSFDGKAMDRSDIFRMVDSFSI 320
           AN++ +LSFDGKAM+RSDIF++VDSFS+
Sbjct: 218 ANDTADLSFDGKAMNRSDIFKIVDSFSL 245

>NCAS0A05060 Chr1 complement(1005175..1009461) [4287 bp, 1428 aa]
           {ON} Anc_2.497
          Length = 1428

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 276 PSNTNAKQRTGASVALAANESFELSFDGKAMDRSD 310
           P+ TN ++ T      A N +FE +FDGK++D +D
Sbjct: 835 PAETNEEESTMLHDDDAKNWTFEFTFDGKSIDMND 869

>KAFR0C03530 Chr3 (720258..722045) [1788 bp, 595 aa] {ON} Anc_8.33
           YLR060W
          Length = 595

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 9/93 (9%)

Query: 58  YPESPTKNLRPRFNSTSQINKGFNENRYAG-------CNNNGNRSSRYANTTGAANVGAS 110
           Y +  T+ +RP   +    N  FNE  YA         ++N  R +R     G  N+ A+
Sbjct: 95  YVDQATEQIRPYAAAAILRNISFNEKSYASFISLQDKLHSNLCR-NRTLVAMGTHNLDAT 153

Query: 111 SHP-HHQSVSHLNTKSLKFNQTKEVNSIKDITF 142
           + P H++++   + K +  NQTKE ++ + + F
Sbjct: 154 TGPFHYRALPPKDIKFVPLNQTKEFDAAELMEF 186

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.125    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,492,452
Number of extensions: 1615524
Number of successful extensions: 8651
Number of sequences better than 10.0: 202
Number of HSP's gapped: 8633
Number of HSP's successfully gapped: 212
Length of query: 357
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 246
Effective length of database: 40,753,473
Effective search space: 10025354358
Effective search space used: 10025354358
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)