Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_13.1455.526ON77477429980.0
YML006C (GIS4)5.526ON77477824770.0
Skud_13.1485.526ON77977921740.0
Suva_13.1565.526ON77278021000.0
NCAS0H025505.526ON7433406171e-68
NDAI0C010705.526ON7571585652e-61
TDEL0A039005.526ON6713535411e-58
CAGL0K07271g5.526ON7761435091e-53
KNAG0B037105.526ON7111324972e-52
KLTH0G03740g5.526ON6313084923e-52
SAKL0G04906g5.526ON6083194651e-48
Kwal_47.186465.526ON6353104456e-46
ZYRO0D12540g5.526ON5481424302e-44
KAFR0C053905.526ON4551334111e-42
TBLA0D016605.526ON8661403913e-38
KLLA0A01782g5.526ON5281343814e-38
Kpol_1023.995.526ON5511922422e-20
Ecym_40615.526ON663872093e-16
NCAS0F010805.526ON3791212001e-15
NDAI0H015905.526ON3711181776e-13
TPHA0K005405.526ON675871791e-12
ADR198C5.526ON5491141744e-12
KNAG0C032405.526ON32457980.003
TBLA0G009405.526ON782129990.004
Kpol_1056.112.560ON50047742.9
Ecym_8423na 1ON43282707.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_13.145
         (774 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...  1159   0.0  
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...   958   0.0  
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...   842   0.0  
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...   813   0.0  
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...   242   1e-68
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...   222   2e-61
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...   213   1e-58
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...   200   1e-53
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...   196   2e-52
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   194   3e-52
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   183   1e-48
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   176   6e-46
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   170   2e-44
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...   162   1e-42
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...   155   3e-38
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...   151   4e-38
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...    98   2e-20
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...    85   3e-16
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    82   1e-15
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               73   6e-13
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    74   1e-12
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...    72   4e-12
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      42   0.003
TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...    43   0.004
Kpol_1056.11 s1056 (27423..28925) [1503 bp, 500 aa] {ON} (27423....    33   2.9  
Ecym_8423 Chr8 (886963..888261) [1299 bp, 432 aa] {ON} similar t...    32   7.5  

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score = 1159 bits (2998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/774 (75%), Positives = 588/774 (75%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60

Query: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN
Sbjct: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 121 LNNFQDPTFLEFASTSWQVQKNSKALNNNNRSLIHPPTISSSKTSNGQLKSSTSDEQWSX 180
           LNNFQDPTFLEFASTSWQVQKNSKALNNNNRSLIHPPTISSSKTSNGQLKSSTSDEQWS 
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKALNNNNRSLIHPPTISSSKTSNGQLKSSTSDEQWSN 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXADICLTSANRQSNNYAVPQDSENRNDGEDAADDTTSS 240
                                  ADICLTSANRQSNNYAVPQDSENRNDGEDAADDTTSS
Sbjct: 181 INTQTPTGTRTNTNTRTITSPNTADICLTSANRQSNNYAVPQDSENRNDGEDAADDTTSS 240

Query: 241 IVLNFSHSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYPGQDLSLT 300
           IVLNFSHSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYPGQDLSLT
Sbjct: 241 IVLNFSHSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYPGQDLSLT 300

Query: 301 TARCEDDNDQDDVEGHYNRTSNDLNDKSTNQIRLNMEXXXXXXXXXXXXXXXXXXXXXXX 360
           TARCEDDNDQDDVEGHYNRTSNDLNDKSTNQIRLNME                       
Sbjct: 301 TARCEDDNDQDDVEGHYNRTSNDLNDKSTNQIRLNMESSVSCTSCSSSSSSSIRYSLSST 360

Query: 361 XXXXXKRESADHTNATYVSELSSITSSIDNLTTSTTPEEEDHLIHHNYDAQGYAXXXXXX 420
                KRESADHTNATYVSELSSITSSIDNLTTSTTPEEEDHLIHHNYDAQGYA      
Sbjct: 361 SRASLKRESADHTNATYVSELSSITSSIDNLTTSTTPEEEDHLIHHNYDAQGYASREDEV 420

Query: 421 XXXXXXXXXXXXXXXXXXXXPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRP 480
                               PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRP
Sbjct: 421 EEVDDDADLSSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRP 480

Query: 481 TIASVTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTESGQQIEEEPKN 540
           TIASVTDDWLLYDSNFSM              KRSFPKILFYTMVIVTESGQQIEEEPKN
Sbjct: 481 TIASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTESGQQIEEEPKN 540

Query: 541 PNYGTREDMLKEQPLNSDLLLSHDPKQYFPNAYNNXXXXXXXXXXXXXXASLSEQSGPQM 600
           PNYGTREDMLKEQPLNSDLLLSHDPKQYFPNAYNN              ASLSEQSGPQM
Sbjct: 541 PNYGTREDMLKEQPLNSDLLLSHDPKQYFPNAYNNDYDEYIDDEDDDDDASLSEQSGPQM 600

Query: 601 YIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIXXXXXXXXXXXXXXXXXXXXXXP 660
           YIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKI                      P
Sbjct: 601 YIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSNSNESDDSENNDDRLSSDEP 660

Query: 661 YPMTQIXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXXXXXXXXXXXXXAMSAVERXXX 720
           YPMTQI                  T                         AMSAVER   
Sbjct: 661 YPMTQISNFNTSSSNFSHSLKKKNTSKVNSKINNESNSKSELKKIKNSINAMSAVERSKS 720

Query: 721 XXXXXXXXXXXXIDNNTHGTNKDRKRWKFQMNRFRNHKNSGSASMDKSQRCVMM 774
                       IDNNTHGTNKDRKRWKFQMNRFRNHKNSGSASMDKSQRCVMM
Sbjct: 721 LPLPTLLKSLSSIDNNTHGTNKDRKRWKFQMNRFRNHKNSGSASMDKSQRCVMM 774

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/778 (64%), Positives = 540/778 (69%), Gaps = 8/778 (1%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDN+IS 
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISA 60

Query: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           R NKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 121 LNNFQDPTFLEFASTSWQVQKNSKALNNNNRSLIHPPTISSSKTSNGQLKSSTSDEQWSX 180
           LNNFQDPTFLEFASTSWQVQKNSKALNNNNR+ I PPTISSSK SNG+L+S+ SD+QWS 
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKALNNNNRNSIPPPTISSSKASNGKLESNVSDDQWSN 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXADICLTSANRQSNNYAVPQDSENRNDGEDAADDTTSS 240
                                   DI +TS N QSNN   PQD+EN  D EDA    TSS
Sbjct: 181 INTQTSTATRTNTNTRTLTSPDTVDINVTSVNSQSNNNDTPQDNENEVDEEDA----TSS 236

Query: 241 IVLNFSHSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYPGQDLSLT 300
           IVLNFSHSR ++ K +RLPKIFP YTNE+YTPSHSEI+SIDSFAGEDVSSTYPGQDLSLT
Sbjct: 237 IVLNFSHSRTVDSKPNRLPKIFPSYTNEDYTPSHSEIMSIDSFAGEDVSSTYPGQDLSLT 296

Query: 301 TARCEDDNDQDDVEGHYNRTSNDLNDKSTNQIRLNMEXXXXXXXXXXXXXXXXXXXXXXX 360
           TAR ED++ QD+VE HY+R S+DL D+S +Q   +ME                       
Sbjct: 297 TARREDESGQDEVEDHYSRVSHDLGDESIDQASYSMESSVSYTSYSSSSNSSSAHYSLSS 356

Query: 361 XXXXX-KRESADHTNATYVSELSSITSSIDNLTTSTTPEEEDHLIHHNYDAQGYAXXXXX 419
                 KRE+ DHTNATYVSELSSITSSIDNLTTSTTPEEED+LIHHNYDAQGY      
Sbjct: 357 SSRGNPKRENIDHTNATYVSELSSITSSIDNLTTSTTPEEEDNLIHHNYDAQGYGSGEDD 416

Query: 420 XXXXXXXXXXXXXXXXXXXXXPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNR 479
                                PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNN+
Sbjct: 417 GEEVYDDEDLSSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNK 476

Query: 480 PTIASVTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTESGQQIEEEPK 539
           PT+ASVTDDWLLYDSNFSM              KRSFPKILFYTMVIVT SG+Q+EEE K
Sbjct: 477 PTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTNSGKQVEEEFK 536

Query: 540 NPNYGTREDMLKEQPLNSDLLLSHDPKQYFPNAYNNXXX---XXXXXXXXXXXASLSEQS 596
           NPNY  RE + KEQPL+S+L L++DP+QYFP AYNN                 ASLSEQS
Sbjct: 537 NPNYDNREGISKEQPLDSELSLTNDPQQYFPTAYNNGYNDYIDDEDDEDDGDDASLSEQS 596

Query: 597 GPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIXXXXXXXXXXXXXXXXXXX 656
           GPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKI                   
Sbjct: 597 GPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIDKSNSNELDNSKTGESTVL 656

Query: 657 XXXPYPMTQIXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXXXXXXXXXXXXXAMSAVE 716
              P+PMTQ+                  +                         AMSAVE
Sbjct: 657 SSEPHPMTQLSNSNTTSSNFSHSLKTKNSHKPNSKGNNESNSKNELKKIKSSINAMSAVE 716

Query: 717 RXXXXXXXXXXXXXXXIDNNTHGTNKDRKRWKFQMNRFRNHKNSGSASMDKSQRCVMM 774
           R               IDN TH TNKDRKRWKFQMNRF+NHKNSGSA  DKSQRC +M
Sbjct: 717 RSKSLPLPTLLKSLSGIDNPTHATNKDRKRWKFQMNRFKNHKNSGSAGTDKSQRCAIM 774

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/779 (61%), Positives = 517/779 (66%), Gaps = 5/779 (0%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGD + S 
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60

Query: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           R NKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 121 LNNFQDPTFLEFASTSWQVQKNSKALNNNNRSLIHPPTISSSKTSNGQLKSSTSDEQWSX 180
           LNNFQDPTFLEFASTSWQVQKNSK LNNNNR L+H  TISSSKTS GQLK +T D+QWS 
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKNSKTLNNNNRYLMHGSTISSSKTSTGQLKPNTLDDQWSN 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXADICLTSANRQSNNYAVPQDSENRNDGEDAADDTTSS 240
                                  AD+ LT  N  +NN  V Q +EN N  EDA +D TSS
Sbjct: 181 INTQTSTATRTNTNTRTLTSPDTADLSLTPTNGDNNNNDVLQSNENENAEEDAGEDATSS 240

Query: 241 IVLNFSHSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYPGQDLSLT 300
           IVLNFSHSR L  K +RLPKI P YTNE+YTPSHSEIVSIDSF GED SSTYPGQDLSLT
Sbjct: 241 IVLNFSHSRTLASKANRLPKILPSYTNEDYTPSHSEIVSIDSFTGEDASSTYPGQDLSLT 300

Query: 301 TARCEDDNDQDD---VEGHYNRTSNDLNDKSTNQIRLNMEXXXXXXXXXXXXXXXXXXXX 357
           TAR ED ND++D    E HYNR S+  +D+   Q+ L +E                    
Sbjct: 301 TARREDANDENDENESEDHYNRNSDGFHDEGNEQVSLGIESCVSYSSCSSSSIGSSVRYS 360

Query: 358 XXXXXXXXKRES-ADHTNATYVSELSSITSSIDNLTTSTTPEEEDHLIHHNYDAQGYAXX 416
                    R    DHTNATYVSELSSITSSIDNLTTSTTPEEE++L+ +NYDA+ Y   
Sbjct: 361 LSGNRRDSLRNGNVDHTNATYVSELSSITSSIDNLTTSTTPEEEENLVQNNYDAREYISG 420

Query: 417 XXXXXXXXXXXXXXXXXXXXXXXXPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS 476
                                   PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS
Sbjct: 421 EEDGEGADEDEDISSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS 480

Query: 477 NNRPTIASVTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTESG-QQIE 535
           NN+PT+ASVTDDWLLYDSNFSM              KRSFPKILFYTMVIVT+SG QQIE
Sbjct: 481 NNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTDSGHQQIE 540

Query: 536 EEPKNPNYGTREDMLKEQPLNSDLLLSHDPKQYFPNAYNNXXXXXXXXXXXXXXASLSEQ 595
           EE K+ ++    D  KE+PLNS+L LSHDP+QYFP AYN               ASLSEQ
Sbjct: 541 EEHKSSSHRGTVDTSKEEPLNSELSLSHDPQQYFPTAYNIDYDEYTDDEDEGDDASLSEQ 600

Query: 596 SGPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIXXXXXXXXXXXXXXXXXX 655
           SGPQMY+PTRM SNVTTAHRSIRTVNSIGEWAFNRHNSVTKI                  
Sbjct: 601 SGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGVNRN 660

Query: 656 XXXXPYPMTQIXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXXXXXXXXXXXXXAMSAV 715
               PYPM Q+                  +                         AMSAV
Sbjct: 661 SLGEPYPMAQLSNSSTTTSNFNHLLKKKNSYKLGSRDKNGSNSKNELKKIKTSINAMSAV 720

Query: 716 ERXXXXXXXXXXXXXXXIDNNTHGTNKDRKRWKFQMNRFRNHKNSGSASMDKSQRCVMM 774
           ER               IDN+THG NKDRKRWKFQMNRFRN+KN+ S + DKS RC +M
Sbjct: 721 ERSKSLPLPTLLKSLSGIDNHTHGANKDRKRWKFQMNRFRNNKNNNSTNTDKSPRCAIM 779

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/780 (58%), Positives = 507/780 (65%), Gaps = 14/780 (1%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDN+ S+
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60

Query: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           R NKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120

Query: 121 LNNFQDPTFLEFASTSWQVQKNSKAL-NNNNRSLIHPPTISSSKTSNGQLKSSTSDEQWS 179
           LNNFQDP+FLEFASTSWQVQKN K+L NNNNR LIH  T SSSK SN QLK +T D+Q  
Sbjct: 121 LNNFQDPSFLEFASTSWQVQKNPKSLNNNNNRHLIHASTASSSKPSNAQLKPNTLDDQLL 180

Query: 180 XXXXXXXXXXXXXXXXXXXXXXXXADICLTS--ANRQSNNYAVPQDSENRNDGEDAADDT 237
                                   AD  LT    N + +N  +PQ++EN N+ EDA DD 
Sbjct: 181 DINTQTSMTARTNTNTKTLTYTDTADPSLTQPECNNKGDN-DMPQNNENENEEEDAGDDA 239

Query: 238 TSSIVLNFSHSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYPGQDL 297
            SSIVLNFSH R L  K +R PKIFP YTNE+Y PSHSEIVSIDSFAGEDVSSTYPGQDL
Sbjct: 240 ASSIVLNFSHPRTLASKANRAPKIFPSYTNEDYNPSHSEIVSIDSFAGEDVSSTYPGQDL 299

Query: 298 SLTTARCEDDNDQDDVEGHYNRTSNDLNDKSTNQIRLNMEXXXXXXXXXXXXXXXXXXXX 357
           SLTTAR ED +D+D       R+SN  +D+S  +   ++E                    
Sbjct: 300 SLTTARREDKDDED-------RSSNGFDDESFEETSSSIESSVNYTNCSSSSNSSIVRYH 352

Query: 358 -XXXXXXXXKRESADHTNATYVSELSSITSSIDNLTTSTTPEEEDHLIHHNYDAQGYAXX 416
                     R   DHTNATYVSELSSITSSI+N+T STTPEEEDHL+ +NYD + Y   
Sbjct: 353 FNSSSRGSLGRGDVDHTNATYVSELSSITSSIENVTNSTTPEEEDHLVRNNYDTREYISG 412

Query: 417 XXXXXXXXXXXXXXXXXXXXXXXXPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQS 476
                                   PSISICDSLGYFRLVLQSILIQ+PDTKEIFTAIRQS
Sbjct: 413 EEDEEEVDDEEDISSSDYSILSILPSISICDSLGYFRLVLQSILIQNPDTKEIFTAIRQS 472

Query: 477 NNRPTIASVTDDWLLYDSNFSMXXXXXXXXXXXXXXKRSFPKILFYTMVIVTESG-QQIE 535
           NN PT+ASVTDDWLLYDSNFSM              KRSFPKIL YTMVIVT SG QQIE
Sbjct: 473 NNEPTVASVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILLYTMVIVTNSGQQQIE 532

Query: 536 EEPKNPNYGTRE-DMLKEQPLNSDLLLSHDPKQYFPNAYNNXXXXXXXXXXXXXXASLSE 594
           EE  N N   RE D+ +E+P NS+L LS+DP++YFP+ +++              ASLSE
Sbjct: 533 EENTNLNQQHREVDLTEEKPPNSELSLSNDPQRYFPSTFDDDYDEYIDDDDGGDDASLSE 592

Query: 595 QSGPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIXXXXXXXXXXXXXXXXX 654
           QSGPQMY+PTRM SNVTTAHRSIRTVNSIGEWAFNRHNSVTKI                 
Sbjct: 593 QSGPQMYLPTRMASNVTTAHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKECGDR 652

Query: 655 XXXXXPYPMTQIXXXXXXXXXXXXXXXXXXTXXXXXXXXXXXXXXXXXXXXXXXXXAMSA 714
                PYPMTQ+                  +                         AMSA
Sbjct: 653 ISPVEPYPMTQLSNSNTVTSNFSHLLKNKNSYKRTSKGNNESNSKNELKKIKTSINAMSA 712

Query: 715 VERXXXXXXXXXXXXXXXIDNNTHGTNKDRKRWKFQMNRFRNHKNSGSASMDKSQRCVMM 774
           VER               +DN+T   NKDRKRWKF+M RFRN+KN+GS  +DKSQRC +M
Sbjct: 713 VERSKSLPLPTLLKSLSGMDNHTDSNNKDRKRWKFKMTRFRNNKNNGSTDIDKSQRCAIM 772

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score =  242 bits (617), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 151/340 (44%), Positives = 186/340 (54%), Gaps = 74/340 (21%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           MQKSVRV DYFDNDDNGLWSWYLTN+RLGDFEE+ GNQLKYTLLKRFLNSHFY ++ ++ 
Sbjct: 1   MQKSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTA 60

Query: 61  RSN----------------------KKILLVSIPENVHEDISILEIFLKDYFHLEKLEHI 98
             +                      +KILLVSIP+ VH D+SILE FL+DYFHLE LE I
Sbjct: 61  TESPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGI 120

Query: 99  QISKLTHSHCYNHENHYLLTDNLNNFQDPTFLEFASTSWQVQKN---SKALNNNNRSLIH 155
           QI +LT S CYNHENHYLLTD +NNF DP FLEFA ++WQ +KN   +  L++ +   I 
Sbjct: 121 QIQRLTQSKCYNHENHYLLTDTINNFDDPVFLEFAGSNWQARKNLHLNNHLDHRDDDRIS 180

Query: 156 PPTISSSKTSNGQLKSSTSDEQWSXXXXXXXXXXXXXXXXXXXXXXXXADICLTSANRQS 215
           P +I +    N       +D+Q                            I +T      
Sbjct: 181 PQSIDTHSALN------KNDDQ----------------------------ILVTQP--ID 204

Query: 216 NNYAVPQDSENRNDGEDAADDTTSSIVLNFSHSRALEPKTSRLPKI--------FPPYTN 267
           +    P+  E  N   D  D   SSIVLNFSH+R        L  +        F P  N
Sbjct: 205 STLVTPETREKEN--LDDIDVGGSSIVLNFSHTREHRKDKDPLNMVKQEEQSNKFSP--N 260

Query: 268 EEYTPSHSEIVSIDSFAGEDVSSTYPGQDLSLTTARCEDD 307
             +TP  SE+VSI+SF   D S  Y G  L LT  R +++
Sbjct: 261 MMFTPPQSELVSINSFDDGD-SMNYNGHPLKLTLTRQDEE 299

 Score =  182 bits (462), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 129/213 (60%), Gaps = 26/213 (12%)

Query: 441 PSISICDSL-GYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMX 499
           PSISI D++ G+FRLVLQSILIQ P TKEI+TAIRQSNN PTIA + DDWLLYDS FSM 
Sbjct: 424 PSISISDAIEGHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDSQFSMD 483

Query: 500 XXXXXXXXXXXXXKRSFPKILFYTMVIVTESGQQIEEEP---KNPNYGTR------EDML 550
                         RSFPKILFY+MVIVT++  Q  + P     P+  T       E + 
Sbjct: 484 NLQILTLQDLLDTNRSFPKILFYSMVIVTDAHHQPIQGPTSTAGPDLTTSYLSNKLESIA 543

Query: 551 KEQ----------PLNSDLLLSHDPKQYFPNAYNNXXXXXXXXXXXXXXASLSEQSGPQM 600
            ++          P+  D  +   P+Q+FP                    SL E++GP+M
Sbjct: 544 GDETNQRFENRYYPMADD-QVEDQPQQFFPQE-----DDHDDDNMYDTDDSLMEEAGPEM 597

Query: 601 YIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNS 633
           Y+PTRME+N TTAHRSIRTVNSIGEWAFNR+N+
Sbjct: 598 YLPTRMETNNTTAHRSIRTVNSIGEWAFNRNNT 630

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score =  222 bits (565), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 107/158 (67%), Positives = 122/158 (77%), Gaps = 16/158 (10%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYG-----D 55
           MQ SVRV DY++NDDNGLWSWYL N+RLGDFEEL GNQLKYTLLKRFLNSHFY      D
Sbjct: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTD 60

Query: 56  NSISVRSN-----------KKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLT 104
            +I   +N           KKILLVSIP+ VH DIS+LE+FL+DYFHLE LE+IQI+KLT
Sbjct: 61  TAIDDNNNTNSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120

Query: 105 HSHCYNHENHYLLTDNLNNFQDPTFLEFASTSWQVQKN 142
            S CYNHENHYLLTD +NNF DP FLEFA ++WQ + N
Sbjct: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPN 158

 Score =  176 bits (446), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 104/226 (46%), Positives = 127/226 (56%), Gaps = 39/226 (17%)

Query: 441 PSISICD-SLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMX 499
           PSISI D + G+FRLVLQS LIQ+P TKEIFTAIRQSNN PTIA +TDDWLLYDS F+M 
Sbjct: 463 PSISISDRNEGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMD 522

Query: 500 XXXXXXXXXXXXXKRSFPKILFYTMVIVTESGQQIEEEPKNPNYGTREDMLKEQPLNSDL 559
                         R+FPKILFY+MVIV ES   I ++  N N  T    L  + L++ L
Sbjct: 523 NLQILTLQDLLDSNRTFPKILFYSMVIVNESSPPINDDQHNYNGMT---ALNSEYLSNKL 579

Query: 560 ----------------------------------LLSHDPKQYFPN-AYNNXXXXXXXXX 584
                                             +++  P+Q+FP    ++         
Sbjct: 580 ESLEKTSSEEGKSINRYKYYPTLPKAGITAKNGEMIADVPEQFFPGPPSDDENGKGEDYD 639

Query: 585 XXXXXASLSEQSGPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNR 630
                 SL EQ GP+MY+PTRM++NVTTAHRSIRT NSIGEWAFNR
Sbjct: 640 DDYDDESLMEQHGPEMYLPTRMQTNVTTAHRSIRTANSIGEWAFNR 685

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 56/109 (51%), Gaps = 7/109 (6%)

Query: 206 ICLTSANRQSNNYAVPQDSENRNDGEDAADDT--TSSIVLNFSHSR--ALEPKTSRL--P 259
           I  T++   +N    P ++E  N  E    +    SSIVLNF H R  + +PK + +   
Sbjct: 216 ITTTTSLSHNNQAYTPDENEQLNQTEKHTGNAYDNSSIVLNFPHLRKHSKDPKQTIINEQ 275

Query: 260 KIFPPYTNEEYTPSHSEIVSIDSFAGEDVSS-TYPGQDLSLTTARCEDD 307
           +  P   N+ YTP  SE+VSI+SF  +D +S  Y G  L L   R +++
Sbjct: 276 QEEPLANNQYYTPPQSELVSINSFGDDDTNSMAYQGHPLHLVLTRQDEE 324

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score =  213 bits (541), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 146/353 (41%), Positives = 191/353 (54%), Gaps = 65/353 (18%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           MQKS++V DYFDNDDNGLWSWYL+++R GDFEE   N+LK TLL+RFLNSHF  + S   
Sbjct: 1   MQKSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHFDSNRS-HY 59

Query: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
             N KIL VSIP+ VH D+S+LE FL+DYFHLE LEHI+I+KLT S  YNHENHY+L D 
Sbjct: 60  GQNTKILFVSIPDKVHRDLSLLENFLRDYFHLEHLEHIEITKLTQSPVYNHENHYILIDK 119

Query: 121 LNNFQDPTFLEFASTSWQVQ-----------KNSKALNNNNRSL---IHPPTISSSKTSN 166
           LNNF DPTFL+FAST WQ Q           + S ++ NN+ S+     P    + ++  
Sbjct: 120 LNNFDDPTFLQFASTRWQQQLSNQQSNRLSDRQSGSIPNNDSSVEFNKKPCGTVTERSRA 179

Query: 167 GQLKSSTSDEQWSXXXXXXXXXXXXXXXXXXXXXXXXADICLTSANRQSNNYAVPQDSEN 226
           G L S +++   S                          I   S   Q N   +P +S N
Sbjct: 180 GSLSSFSANSGPSDLGSDTGGLQNIEVRS----------IQSESTAGQFNQ--IPINSIN 227

Query: 227 RNDGEDAADDTTSSIVLNFSHS---RALEPKTSRLPKI----FPPYTNEE---------- 269
             D E+       SIVL+FSHS   + +E K S+  +I    +   TN+           
Sbjct: 228 DQDDENE------SIVLDFSHSLLRKQMEEKKSQAQRIRQQEYSADTNQTITNLHTNDKD 281

Query: 270 ------YTPSHSEIVSIDSFAGEDV---------SSTYPGQDLSLTTARCEDD 307
                 Y+P+ SE VSI+S+  E +           +Y GQ L+LTT   +DD
Sbjct: 282 TNASDIYSPAISENVSINSYEDESMRDGSDSITAKDSYSGQPLALTTTHYKDD 334

 Score =  179 bits (454), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 94/200 (47%), Positives = 125/200 (62%), Gaps = 19/200 (9%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           PSISI D+ G++RLV+QS L+QDP+TKEI+TAIRQSNN+PT+A V DDWLLYDS FSM  
Sbjct: 388 PSISISDARGHYRLVMQSSLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSMNN 447

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIVTESGQQIEEEPKNPNYGTREDMLKEQP----LN 556
                        RSFPKI+FY+M++V++  Q++ +         +ED           +
Sbjct: 448 LQMLTLQELLDMNRSFPKIIFYSMIVVSDEQQELLQWSN--GMTQKEDTADASSSIPRAD 505

Query: 557 SDLLLSHDPKQYFPNAYNNXXXXXXXXXXXXXXASLSEQSGPQMYIPTRMESNVTTAHRS 616
           S   +S DP+Q++ N  ++               SLSEQSGP MY PTR++SN +TAHRS
Sbjct: 506 SYASMSRDPQQFYANMDDD-------------DTSLSEQSGPMMYAPTRLQSNTSTAHRS 552

Query: 617 IRTVNSIGEWAFNRHNSVTK 636
           IRTVNSIG+WAF   N   +
Sbjct: 553 IRTVNSIGDWAFVHKNETKR 572

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score =  200 bits (509), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 91/143 (63%), Positives = 116/143 (81%), Gaps = 3/143 (2%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           M KSVRVGDY+ ND+NG+WSWYL+NLR GDFEE+I N+LKYTLLKRFLNS+  G+ S   
Sbjct: 1   MSKSVRVGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLGNFSPES 60

Query: 61  RS---NKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLL 117
            +   NKK++ VSIPE+VH+DISILE+FL+DYFHL+ L++ QI KLT    Y+HENHY L
Sbjct: 61  PTRFINKKLIFVSIPEDVHQDISILELFLRDYFHLKVLDNNQIHKLTQDKVYHHENHYFL 120

Query: 118 TDNLNNFQDPTFLEFASTSWQVQ 140
            D LNNF+DPTFLEF  ++W+++
Sbjct: 121 MDELNNFEDPTFLEFGKSNWKME 143

 Score =  152 bits (383), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/200 (43%), Positives = 112/200 (56%), Gaps = 24/200 (12%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           PSISI D+LGYFRLVLQSILIQDP TKE+FTA+RQSNN+PTIA +TDDWLLYD+ FSM  
Sbjct: 456 PSISIFDTLGYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSMHN 515

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIVTE----------SGQQIEEEPKNPNYGTREDML 550
                       K+ +PKILFYTMV++ +          +G Q  + P +P      ++ 
Sbjct: 516 LQILTLQDIMTIKKDYPKILFYTMVVINDRSEIACEFPYNGAQFTKAP-SPITNKSHEVE 574

Query: 551 KEQPLNSDLLLSHDPKQYFPNAYNNXXXXXXXXXXXXXXASLSEQSGPQMYIPTRMESNV 610
           KE+     L    + + YFP                     L +          R +SN+
Sbjct: 575 KEE-----LDQPTEVQAYFPGNGQAIKDSIKPNNRDSLTFDLCQAE--------RTKSNM 621

Query: 611 TTAHRSIRTVNSIGEWAFNR 630
           TT HRSIRTVNSIG+W+ +R
Sbjct: 622 TTTHRSIRTVNSIGDWSISR 641

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 54/104 (51%), Gaps = 6/104 (5%)

Query: 223 DSENRNDGEDAADDTTSSIVLNFSHSRALEPKTSRLPKIFPP-YTNEEYTPSHSEIVSID 281
           D+ N+  G D  DD  SSIVLNFSH+R    + +++  +    Y ++ YTP  SE+VSI+
Sbjct: 292 DNSNKRTGLD--DDGASSIVLNFSHNRNAHKRKTKIDSLLGERYPSDFYTPPQSELVSIN 349

Query: 282 SFAGEDVSSTYPGQDLSLTTARCEDDNDQDDVEGHYNRTSNDLN 325
           S      +  Y GQ L L   +   D+  +    + NR+   +N
Sbjct: 350 SCGS---AEDYTGQSLRLMVTKNGTDSKDEQPGDNPNRSKTSVN 390

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score =  196 bits (497), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 91/132 (68%), Positives = 104/132 (78%), Gaps = 4/132 (3%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           MQKS+RV DY+DNDDNGLWSWYL N+R GDFEEL  N+LKYTLLKRFL +HF     I  
Sbjct: 1   MQKSIRVNDYYDNDDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHFTSLEGI-- 58

Query: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
             N KIL +SIP+ VH DIS+LE FLKDYFHLE L++I+I KLT S+CYNHENHYLLTD 
Sbjct: 59  --NSKILFISIPDKVHSDISVLETFLKDYFHLEDLQNIKIQKLTTSNCYNHENHYLLTDT 116

Query: 121 LNNFQDPTFLEF 132
           LNNF D  FL +
Sbjct: 117 LNNFNDRKFLRY 128

 Score =  134 bits (337), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 81/195 (41%), Positives = 107/195 (54%), Gaps = 31/195 (15%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           PSI+I D+ G+FRLVLQS+L+Q  D K IFTAIRQSNN+   A+V DDW+LYDS+FSM  
Sbjct: 463 PSITIKDTEGHFRLVLQSVLLQRED-KAIFTAIRQSNNKVDRATVQDDWILYDSDFSMNN 521

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIVTESGQQIEEEPKNPNYGTREDMLKEQPLNSDLL 560
                         +  KILFY+M+IV ++              T +DML E+  +S  +
Sbjct: 522 LMMMTLRGLFNFSENMSKILFYSMIIVDDA-------------ETADDMLDEEATHSGDV 568

Query: 561 LSHDPKQYFPNAYNNXXXXXXXXXXXXXXASLSEQSGPQMYIPTRMESNVTTAHRSIRTV 620
               P+  F                     S S    PQMY+P +  S+ TTAHRSIRTV
Sbjct: 569 SDTQPQLMF-----------------DEEDSDSGVQEPQMYLPQKTASHATTAHRSIRTV 611

Query: 621 NSIGEWAFNRHNSVT 635
           NSIGEWA+ + ++ T
Sbjct: 612 NSIGEWAYKKKSNAT 626

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  194 bits (492), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 178/308 (57%), Gaps = 31/308 (10%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           ++ SV+V DYFDND+NGLWSWYL NLR G+FEEL  NQLK+ LL+RFLN     D   SV
Sbjct: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSD---SV 58

Query: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
             NKK+LLVSIP+ +HE+ ++LE FL+DYF+L+ L+ IQI KLT   CYNHENHYL++D+
Sbjct: 59  LFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDS 118

Query: 121 LNNFQDPTFLEFASTSWQVQKNSKAL--NNNNRSLIHPPTISSSKTSNGQLKSSTSDEQW 178
           L+NF D +FLEF + S + + +++ L  ++NN+  I    IS    ++  L ++ S E  
Sbjct: 119 LSNFNDKSFLEFGAKSRRPRDDTEILGQDSNNQYSI----ISGETEADPALPAAISSESP 174

Query: 179 SXXXXXXXXXXXXXXXXXXXXXXXXADICLTSANRQSNNYAVPQDSENRNDGEDAADDTT 238
           +                         D+ L + N  S    V  D++      D +DD +
Sbjct: 175 ASVHLSKVVQE---------------DVPLRTHNSSSRLLIV--DNQECASSTDESDDAS 217

Query: 239 SSIVLNFSHSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYPGQDLS 298
           + +VL F H R +  K    P++    + EE   + S  VS+ S   +DVSS Y G+ L+
Sbjct: 218 TELVLKFEH-RGMLGKQRLHPEVRKMASTEEAIDTPSTGVSLRS---DDVSS-YDGEVLT 272

Query: 299 LTTARCED 306
            T  R ED
Sbjct: 273 QTITRDED 280

 Score =  135 bits (339), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 86/222 (38%), Positives = 111/222 (50%), Gaps = 30/222 (13%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           PSISI +  G FRLVLQSIL+  PDT+++FTA+RQSNN PT+A V DDWLLYD  FSM  
Sbjct: 322 PSISISEKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNN 381

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIVTE-----------SGQQIEEEPKNPNYGTREDM 549
                        + FPKILFY++V+++E           S      +P   N    E+ 
Sbjct: 382 LQILALHDVLEMNKFFPKILFYSLVMISEEVAADAQDYYPSKPSKSPQPTASNSTISENT 441

Query: 550 LKEQPLNSDLLLSH---DPKQYFP-NAYNNXXXXXXXXXXXXXXASL----------SEQ 595
           LK QP      L+H   +   Y    AYN+                           SE 
Sbjct: 442 LKVQP-----TLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGEEDDYYDDDKNSEG 496

Query: 596 SGPQMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKI 637
               +Y  TR  SN +TAHRSIRT+ SIG+WAF+  +S  K+
Sbjct: 497 VVVPLYSATRTNSNKSTAHRSIRTIKSIGDWAFHHDSSSRKL 538

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  183 bits (465), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 130/319 (40%), Positives = 165/319 (51%), Gaps = 61/319 (19%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           M   V+V DYF+ND NGLWSWYL+NLR G FEEL  N LK+TLLKRFLN H   D    V
Sbjct: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQD---IV 57

Query: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           + NKK+LLVSIP+N+H+DI+ILE FL+ YFHL+ L++IQI KLT S  YNHENHYL++DN
Sbjct: 58  QFNKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDN 117

Query: 121 LNNFQDPTFLEFASTSWQVQKNSKALNNNNRSLIHPPT----ISSSKTSNGQLKSSTSDE 176
           LNNF D +FL F        +    L+ N  S++   T    + +++  NG  + S   E
Sbjct: 118 LNNFHDRSFLGFGQKKHDNVR--PQLSYNGYSVLSGETGYASLRTTEEQNGTHRPSGVVE 175

Query: 177 QWSXXXXXXXXXXXXXXXXXXXXXXXXADICLTSANRQSNNYAVPQD---SENRNDGEDA 233
           Q                             C        N+ A P+D    E     ED 
Sbjct: 176 Q-----------------------------C------NGNSPATPRDVTAVEPVKSSEDE 200

Query: 234 ADDTTSSIVLNFSHSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYP 293
            D  +  IVLNF H         R          E+   + SE VSI+S   ED SS Y 
Sbjct: 201 EDQESGEIVLNFPHKPPKNIINQR----------EQEVVTTSEDVSINS---EDASS-YD 246

Query: 294 GQDLSLTTARCEDDNDQDD 312
           G+ L  T  R ED +  D+
Sbjct: 247 GEALIQTITRDEDASSADE 265

 Score =  145 bits (366), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 110/216 (50%), Gaps = 33/216 (15%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           P+ISI D+ G FRLVLQSILIQ+PDT+EIFTA+RQSNN P +A + DDWLLYD  FSM  
Sbjct: 301 PAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHN 360

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMV------IVTESGQQIEEEPKNPNYGTREDMLKEQP 554
                        R FPKILFYTMV      I  E+   I  +P  P           Q 
Sbjct: 361 LQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPP--------PSQG 412

Query: 555 LNSDLLLSHDPKQYFPNAYNNXXXXXXXXXXXXXXASL--SEQSGPQ------------- 599
           + S   LS +  +  P A +N               S   +E   P+             
Sbjct: 413 IASTSTLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDEDDQEVNG 472

Query: 600 ---MYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHN 632
              +Y PTR  SN TTAHRSI TVNSIGEWAF+ HN
Sbjct: 473 VMPLYAPTRTNSNSTTAHRSILTVNSIGEWAFH-HN 507

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  176 bits (445), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 125/310 (40%), Positives = 164/310 (52%), Gaps = 37/310 (11%)

Query: 2   QKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVR 61
           + SV+V DYF ND+NGLWSWYL NLR G+FEEL  NQLK  LL+RFLN     +   +V 
Sbjct: 3   ENSVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSE---TVP 59

Query: 62  SNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNL 121
            NKK+LLVSIP+ +HE+ ++LE FL+DYFHL+ L++IQI KLT   CYNHENHYL+ DNL
Sbjct: 60  FNKKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNL 119

Query: 122 NNFQDPTFLEFASTSWQVQKNSKALNNNNRSLIHPPTISSSKTSNGQLKSSTSDEQWSXX 181
           +NF D +FLEF        K   A N N  S          +TSN Q   S    + S  
Sbjct: 120 SNFNDKSFLEFG------IKRVGACNGNELS---------GETSNNQY--SIISGETSTD 162

Query: 182 XXXXXXXXXXXXXXXXXXXXXXADICLTSANRQSNNYAVPQDSENRNDGEDAADDTTSSI 241
                                  D  L + +  S +  + ++S + N   D +DDT S I
Sbjct: 163 VTKSSLEIPLSPEFIRDSKVTQEDPALQTQSTSSRSLRI-ENSGSLN-SSDESDDTESEI 220

Query: 242 VLNFS-----HSRALEPKTSRLPKIFPPYTNEEYTPSHSEIVSIDSFAGEDVSSTYPGQD 296
           VL F        R L  +  R P         +Y  + S  +S+ S   EDVSS Y G++
Sbjct: 221 VLRFKPRGTVGKRQLYSEVKRSP------LANDYIDTPSTGMSLRS---EDVSS-YDGEE 270

Query: 297 LSLTTARCED 306
           L+   +R ED
Sbjct: 271 LAHIASRDED 280

 Score =  128 bits (321), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 82/222 (36%), Positives = 113/222 (50%), Gaps = 29/222 (13%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           PSISI +  G FRLVLQSILIQ  DT++++TA+RQSNN PT+A V DDWLLYD  FSM  
Sbjct: 322 PSISISEKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNN 381

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIVTESGQQIEEE------PKNPNYGTREDMLKEQP 554
                        + FPK+LFY++++VT+      +E       ++P       +L E  
Sbjct: 382 LQILALHDVLEINKFFPKVLFYSLIVVTDEVAIDAQEYYPSASHQSPERTVSTSLLSENT 441

Query: 555 LNSDLLLSHDPKQYFPNAYNNXXXXXXXXXXXXXXASLS-------------EQSGP--- 598
           L     L+  P     N++ +              A  S             E+ G    
Sbjct: 442 LKLQTTLT--PSLTNTNSFLSMGVNSSSLTPFYATAQGSPDRANDEDDYFDDERDGKTDD 499

Query: 599 ----QMYIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTK 636
               Q+Y  TR  SN +TAHRSIRT+ SIG+WAF+ H+S ++
Sbjct: 500 GEVFQLYSATRTNSNKSTAHRSIRTIKSIGDWAFH-HDSTSR 540

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  170 bits (430), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (74%), Gaps = 5/142 (3%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           M KSVRVGDYF NDDNGLWSWYLTN+R GDFEEL  NQLK++L KRFL +  Y + +++ 
Sbjct: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRT--YLEPTLNE 58

Query: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           R + K+L+VSIPE+V  DI++LE FL DY +L+ +E   I+KLT S  YNHENHY++ D 
Sbjct: 59  RKDTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNME---ITKLTTSRIYNHENHYVVMDK 115

Query: 121 LNNFQDPTFLEFASTSWQVQKN 142
            NNF++  FL FAST+ Q  K 
Sbjct: 116 ENNFKNSNFLHFASTNIQTGKG 137

 Score =  111 bits (278), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 98/188 (52%), Gaps = 25/188 (13%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           PSISI DS G+FRLVLQS+L  +P + EIFTAIRQSNN+PT A V DDWLLYDS FSM  
Sbjct: 300 PSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHN 359

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIVTESGQQIEEEPKNPNYG-TREDMLKEQPLNSDL 559
                        +  PK+LFY++V V ++    + + +      T    L   P ++  
Sbjct: 360 LQMLTLQDLSELNKGCPKVLFYSLVEVVDTPSLEDADTECATISNTASTSLSSAPTSTS- 418

Query: 560 LLSHDPKQYFPNAYNNXXXXXXXXXXXXXXASLSEQSGPQMYIPTRMESNVTT-AHRSIR 618
            +S +P+ +FP+  N                   + SG ++    +  +N +T  HRSI 
Sbjct: 419 -VSCEPRVFFPSNVN------------------GDNSGCRL---AKGNTNSSTLGHRSIV 456

Query: 619 TVNSIGEW 626
           T NS  +W
Sbjct: 457 TTNSAADW 464

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score =  162 bits (411), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 102/133 (76%), Gaps = 5/133 (3%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           M  SV++ DYFDND+NGLWSWYLTNLR G+FEELI N+LK +LLKRFL +    ++ I  
Sbjct: 1   MPNSVQIHDYFDNDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRNQVDINDQI-- 58

Query: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
              KKILL+SIP+++  DI++LEIFL DYFHL  L +I+I KLT  + YNHENHYLL D+
Sbjct: 59  ---KKILLISIPDHIFSDINVLEIFLSDYFHLNDLSNIKIIKLTKFNVYNHENHYLLIDS 115

Query: 121 LNNFQDPTFLEFA 133
           +NNF+D TFL + 
Sbjct: 116 VNNFKDETFLNYV 128

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 2/89 (2%)

Query: 441 PSISIC-DSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMX 499
           P +SI  +++G++RLVLQS+LI + +  ++ T +RQSNN    A++ DDW+LYD  FSM 
Sbjct: 254 PCVSINNEAIGHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKFSMR 313

Query: 500 XXXXXXXXXXXXXKR-SFPKILFYTMVIV 527
                              KILFY+M+ V
Sbjct: 314 NLNILSLKDLSIIGNVDSIKILFYSMIDV 342

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score =  155 bits (391), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 99/140 (70%), Gaps = 3/140 (2%)

Query: 3   KSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGD-NSISVR 61
           K V+V DY+DND+NGLWSWYL+N+R G FEEL  N LK TLLKRFL  +F  D NS S  
Sbjct: 7   KPVQVNDYYDNDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66

Query: 62  SNK--KILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 119
           S    KIL  SIP+N+H+D+ ILE  LKDYF L+ L++IQI KLT + CYNHENHY+L D
Sbjct: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126

Query: 120 NLNNFQDPTFLEFASTSWQV 139
            L+NF + +F     T  ++
Sbjct: 127 ILDNFGNTSFFIHDGTKQKI 146

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/215 (37%), Positives = 106/215 (49%), Gaps = 31/215 (14%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           PSISI DSLG+FRLVLQ ILI  P  ++ +TAIRQS++   +A + DDWLLYD  FSM  
Sbjct: 501 PSISISDSLGHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDN 560

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIVTESGQQIEEEP------------KNPNY---GT 545
                        R +PKILFYT+V + ++   I                KN N    G 
Sbjct: 561 LEILTLQELLDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGD 620

Query: 546 REDMLKEQPLNSDL---------LLSHDPKQYFPNAYNNXXXXXXXXXXXXXXASLSEQS 596
             +    Q +N++          L+ H   +  P                     +    
Sbjct: 621 DRNKKDNQKINTEFNTTRIHSNHLIDHSSSEDIPRQL------YTTLSSDEEYGEIEYPE 674

Query: 597 GPQMYIPTRMESNVTT-AHRSIRTVNSIGEWAFNR 630
           G +MY P++++SN TT AHRSIRTVNSIGEWAF+R
Sbjct: 675 GLEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHR 709

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score =  151 bits (381), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 93/134 (69%), Gaps = 7/134 (5%)

Query: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60
           M  SV+V DY++ND NGLWSWYL+NLR G+FEEL GN+LK+ LLKRFL   F     +  
Sbjct: 1   MPTSVQVKDYYENDYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQFQATGPL-- 58

Query: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEH--IQISKLTHSHCYNHENHYLLT 118
             NKK+LLVSIP+ +H+DI +LE FL +YFHL K +H  I I KLT    Y HENHYL+ 
Sbjct: 59  --NKKLLLVSIPDEIHQDIKVLEEFLSEYFHL-KDDHTNIVIDKLTRGTVYKHENHYLIQ 115

Query: 119 DNLNNFQDPTFLEF 132
           D L NF D  FLE 
Sbjct: 116 DKLTNFNDEWFLEM 129

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 92/201 (45%), Gaps = 39/201 (19%)

Query: 447 DSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXXXXXXXX 506
           D+ G FRLVLQSILI + +T++IFT IRQS N  + A + DDWLLYD++F++        
Sbjct: 284 DNFGTFRLVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFNLGNLQMLSL 343

Query: 507 XXXXXXKRSFPKILFYTMVIVTESGQQIEEEPKNPNYGTREDMLKEQPLNSDLLLSH--- 563
                  +  PKILFY+M+ V +S                         N++L L H   
Sbjct: 344 YDILDFSKFLPKILFYSMIHVKDSVDD----------------------NTELSLQHLIT 381

Query: 564 ------DPKQYFPNAYNNXXXXXXXXXXXXXXA-----SLSEQSGPQMYIPTRMESNVTT 612
                 +   Y P+  ++                    S++++    +Y P    +  T 
Sbjct: 382 VNNTLTNGNMYSPHEVDDSMSELSSDNSIECYTGNSNDSIADEPVIGLYSPA---TAATA 438

Query: 613 AHRSIRTVNSIGEWAFNRHNS 633
            HRSIRTV SIG WA NR N+
Sbjct: 439 GHRSIRTVESIGAWALNRSNT 459

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 95/192 (49%), Gaps = 18/192 (9%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           P++++ D    F+LVLQSILI + D+ E+ TAIRQSNN    A + DDWLLYDS FSM  
Sbjct: 249 PTVNLPDPYANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFSMTN 308

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIVTESGQQIE--EEPKNPNYGTREDMLKEQPLNSD 558
                        + +PKILFY++V +      I   E   NP+    ED +       D
Sbjct: 309 LQILSLNELLHINKDYPKILFYSLVSIPNVTVNISNYENSSNPHL---EDYINHS---DD 362

Query: 559 LLLSHD-PKQYFPNAYNNXXXXXXXXXXXXXXAS---LSEQSGPQ------MYIPTRMES 608
            L  HD P+Q++P   N+               S     + S PQ      M IPT++ +
Sbjct: 363 SLSIHDTPQQFYPMIVNDNNNNININNHNNTRRSSVDYYDDSIPQQFYPDDMNIPTKVNT 422

Query: 609 NVTTAHRSIRTV 620
           N T AHRS RT+
Sbjct: 423 NTTIAHRSYRTI 434

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 18 LWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILLVSI 71
          +W+WYL ++R G FEE++GN+  Y LLK  L    +  +    + NK   L+SI
Sbjct: 15 VWTWYLCHVRNGSFEEILGNEDYYKLLKNNLVDDVFNID----KGNKIFKLISI 64

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 52/87 (59%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           PSISI    G FR+VLQSILI +    ++ TA+RQSNN  T+A + DDWLLYD  FSM  
Sbjct: 330 PSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNN 389

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIV 527
                          FPKILFY++V +
Sbjct: 390 IQMVSLIDIFEMNGVFPKILFYSVVAI 416

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 66/109 (60%), Gaps = 6/109 (5%)

Query: 13  NDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILLVSIP 72
           +D NGLWSWYL NLR G+FEEL  + +K  L+KR +  +  G  S S R    +LLVS+P
Sbjct: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNR----VLLVSVP 65

Query: 73  ENVHEDISILEIFLKDYF-HLEKLEHIQISKLT-HSHCYNHENHYLLTD 119
           +++ +  SILE FL+     + ++    I+KLT      N E+HYL+ D
Sbjct: 66  DDIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 72/121 (59%), Gaps = 5/121 (4%)

Query: 11  FDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILLVS 70
           + +D + +WSWYL+NL+ G+FE L+   ++   L+ +  S F   N      +KKILL S
Sbjct: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGN----EGSKKILL-S 63

Query: 71  IPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQDPTFL 130
           +P  + +++SI  +FL   F+ E+L++I + + + S     + HYLLTD L+ F +  F+
Sbjct: 64  VPSMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFI 123

Query: 131 E 131
           E
Sbjct: 124 E 124

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%)

Query: 450 GYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXXXXXXXXXXX 509
           G  R VL S+LIQ+  +KE FTAIRQ ++ P  A++ D+WLLYDS FS+           
Sbjct: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359

Query: 510 XXXKRSFPKILFYTMVIVTE 529
               +    +L Y  +++++
Sbjct: 360 LLSNKGNSMLLLYKTILISK 379

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 67/118 (56%), Gaps = 3/118 (2%)

Query: 9   DYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILL 68
           D    DDN + SWYL NLR G FE +I ++ K   L   L+   + DN     +NK  +L
Sbjct: 4   DNIKKDDNEVLSWYLRNLREGRFENIIEDRAKNYHLNTILDRQLF-DNKQYGATNK--IL 60

Query: 69  VSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQD 126
           VS   ++ E +SI +IFL   F  E+L++I++ +L      N E HY LTD+LN+F D
Sbjct: 61  VSTLTSIDEIVSIKDIFLGQLFDHERLQYIEVEELKSLKGDNKETHYFLTDHLNSFND 118

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 50/88 (56%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           PSIS     G  R VLQSI+ +   T E+ TAIRQS+    +A+ +D+WLLYDS+FS+  
Sbjct: 284 PSISCHHPYGQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSLNN 343

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIVT 528
                           P+ILFYTM +V+
Sbjct: 344 LEISTLQDILYPNYENPRILFYTMSVVS 371

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 53/87 (60%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           PSI + +S G F+LVLQS+++ + ++ E FTA+RQSN+    A+  D+WLLYDS FSM  
Sbjct: 328 PSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDN 387

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIV 527
                          F KI FY+MVI+
Sbjct: 388 LEIVTLNYLMDIYADFVKIFFYSMVII 414

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 63/119 (52%), Gaps = 13/119 (10%)

Query: 17  GLWSWYLTNLRLGDFEELIGNQLKY-TLLKRFLNSHFYGDNSISVR------SNKKILLV 69
            LW+WYL  +R G+FEEL+  + KY ++L +   +      +I +       S+  IL +
Sbjct: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGNILFL 73

Query: 70  SIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHC------YNHENHYLLTDNLN 122
           S+   + +D  I++ FL D F    L +I I ++ +++        +HE +Y++ D+LN
Sbjct: 74  SLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVIDSLN 132

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/114 (35%), Positives = 58/114 (50%), Gaps = 6/114 (5%)

Query: 441 PSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMXX 500
           PS+SI +    FR+VLQSIL+ D +   I TA+RQ NN P IA+ +DD LLYD+  S+  
Sbjct: 238 PSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLIT 297

Query: 501 XXXXXXXXXXXXKRSFPKILFYTMVIVTESGQQIEEEPKNPNYGTREDMLKEQP 554
                        R+ PK+LFY++  +  S       P+    G    +   QP
Sbjct: 298 FRILSLVDLMELNRAHPKMLFYSVAEIFNSS------PRCSAAGCCAQVHHSQP 345

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 60/107 (56%), Gaps = 11/107 (10%)

Query: 14  DDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILLVSIPE 73
           D +GLWSWYL NLR G FE+L+G++ +Y+ LK FL   F    + S    +++ L+S P 
Sbjct: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCF----AHSTGQERRLQLLSFPA 59

Query: 74  NVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120
           +V  D  ILE F++   ++     + I ++   H    E HYL+  N
Sbjct: 60  SVPCDYKILEEFIRQQGNIS----VAIPRV---HATGTEKHYLVDGN 99

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}
          
          Length = 324

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 16 NGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILLVSIP 72
          N  W WY+ NL  G+FEEL  N +K   L  FL +H++G    + +  +++LLV+ P
Sbjct: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFL-AHYFGGKQ-TTKLQRRLLLVTSP 72

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 66/129 (51%), Gaps = 13/129 (10%)

Query: 12  DND-DNGLWSWYLTNLRLGDFEEL--IGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILL 68
           DND +  LW+WYL N+    F E   I N+ KY+ LK+ ++   +   +I+ +  K I+ 
Sbjct: 14  DNDIEYNLWTWYLNNIEEKTFHEFNEIENKEKYSKLKKLIDKKLFTVTNINTKKVKNIIF 73

Query: 69  VSIPENVHEDISILEIFLKDYFHL-EKLEHIQISKL-----THSHCYNHENHYLLTDNLN 122
           +++P+  +        +L+ Y  L   ++ + I+KL     T   C    N+ L+ D + 
Sbjct: 74  LTLPKTKNFQTRDSYFYLQKYLELIFSVQQLYITKLQNNTSTTPSC----NYCLIMDPIL 129

Query: 123 NFQDPTFLE 131
           NFQ+ TF E
Sbjct: 130 NFQNTTFKE 138

>Kpol_1056.11 s1056 (27423..28925) [1503 bp, 500 aa] {ON}
           (27423..28925) [1503 nt, 501 aa]
          Length = 500

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 3/47 (6%)

Query: 6   RVGDY--FDNDDNGLWSWYLTNLR-LGDFEELIGNQLKYTLLKRFLN 49
           ++GDY  FDN D  L+S +LTNL  L D +ELI N L   L+   +N
Sbjct: 169 KIGDYKSFDNIDCNLFSIFLTNLLFLNDSKELIYNNLFKALMFSLIN 215

>Ecym_8423 Chr8 (886963..888261) [1299 bp, 432 aa] {ON} similar to
           Ashbya gossypii ADR236W
          Length = 432

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 34/82 (41%), Gaps = 6/82 (7%)

Query: 85  FLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDNLNNFQDPTFLEFASTSWQVQKNSK 144
            + DY  + +L + QI++ T   C+     YL         DP  L+  S  W  Q   +
Sbjct: 137 LMDDYVSILRLNNQQITENTLRECWQQYARYL------GITDPKRLKSFSNGWLSQFKKR 190

Query: 145 ALNNNNRSLIHPPTISSSKTSN 166
                 R+ + P  +SS K +N
Sbjct: 191 HGLKLKRNFLKPGVVSSGKNTN 212

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,256,612
Number of extensions: 2848305
Number of successful extensions: 11451
Number of sequences better than 10.0: 64
Number of HSP's gapped: 11798
Number of HSP's successfully gapped: 102
Length of query: 774
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 657
Effective length of database: 40,065,477
Effective search space: 26323018389
Effective search space used: 26323018389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)