Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.2647.342ON61235210351e-132
YLR206W (ENT2)7.342ON6132679891e-126
Skud_12.2707.342ON6262709781e-124
Suva_10.3007.342ON6182699321e-117
NCAS0H006707.342ON4832657672e-94
KAFR0L014607.342ON5502687201e-86
TDEL0C020507.342ON5012657055e-85
CAGL0A03872g7.342ON5102667022e-84
Smik_4.757.342ON4602656833e-82
Skud_4.947.342ON4472656797e-82
YDL161W (ENT1)7.342ON4542656772e-81
ZYRO0F11550g7.342ON5382656805e-81
NDAI0D006107.342ON4862666741e-80
Suva_4.837.342ON4622056572e-78
Kwal_56.246107.342ON5082686472e-76
TBLA0E004807.342ON5991966499e-76
Kpol_2001.707.342ON5331916231e-72
TPHA0D045607.342ON4872676163e-72
KLTH0H01430g7.342ON5022666174e-72
KLLA0C16731g7.342ON4782666102e-71
KNAG0C038007.342ON4472716073e-71
SAKL0F10934g7.342ON4981916113e-71
KNAG0B026507.342ON6462396082e-69
Ecym_47317.342ON5142665889e-68
KAFR0B008907.342ON4141415685e-66
TBLA0E020407.342ON7012135234e-57
ACL157C7.342ON5151924681e-50
KLTH0D16896g4.346ON4011432442e-21
Suva_12.2164.346ON4101432416e-21
Kwal_47.168574.346ON3821432371e-20
NDAI0D032004.346ON4351432382e-20
Kpol_1001.24.346ON4181432353e-20
SAKL0G17952g4.346ON4151432353e-20
Skud_10.3494.346ON4101432353e-20
KLLA0B04587g4.346ON4001432344e-20
YJR125C (ENT3)4.346ON4081432345e-20
TDEL0D007104.346ON3751432325e-20
Smik_10.4184.346ON4091432327e-20
AER155C4.346ON3641432291e-19
KNAG0M003804.346ON4031432301e-19
KAFR0B067404.346ON3991432282e-19
NCAS0A062104.346ON4231432273e-19
TPHA0B004004.346ON3991432264e-19
TBLA0E047604.346ON4261432222e-18
ZYRO0B14784g4.346ON4241432212e-18
Ecym_11334.346ON3921432166e-18
CAGL0H04323g4.346ON4121431981e-15
SAKL0H25762g4.17ON2621471781e-13
Kwal_55.206114.17ON2541461725e-13
TDEL0G017404.17ON2571341541e-10
Kpol_388.54.17ON2681421532e-10
TBLA0B062204.346ON3391431543e-10
TPHA0F002304.17ON2801421471e-09
KLTH0E05874g4.17ON2551361434e-09
ZYRO0G07876g4.17ON2591351382e-08
Suva_10.354.17ON2471341273e-07
Ecym_84074.17ON2541491264e-07
KLLA0D03949g4.17ON2251371221e-06
NCAS0C058404.17ON2671331231e-06
TBLA0G006504.17ON4231441252e-06
Skud_12.304.17ON2471341123e-05
NDAI0H002804.17ON3101391143e-05
ACL061C4.17ON2341351123e-05
KAFR0I014604.17ON2751551123e-05
CAGL0E03806g4.17ON2601261115e-05
YHR161C (YAP1801)5.84ON637881136e-05
TBLA0H012108.335ON4911631101e-04
Skud_8.2255.84ON621881073e-04
Kpol_344.88.335ON3841671063e-04
SAKL0H02530g5.84ON669961046e-04
Smik_8.2455.84ON627881038e-04
NCAS0B036608.335ON4161681020.001
KLLA0D16654g8.335ON3991681010.001
NDAI0J009308.335ON418167950.007
ZYRO0F13684g8.335ON407167930.010
YLL038C (ENT4)4.17ON247100910.011
KAFR0B058008.335ON382171920.013
Smik_12.194.17ON247100900.018
TBLA0B057705.84ON680120910.021
TDEL0F045908.335ON361166880.044
TPHA0A052105.84ON63296860.099
Kwal_YGOB_27.112618.335ON404170840.12
CAGL0E01199g8.335ON41298840.14
KNAG0A051008.335ON421166820.20
KLTH0G11902g8.335ON399172820.22
TBLA0A040408.335ON415167820.25
KNAG0E006105.84ON60472790.54
TPHA0C007408.335ON38597770.78
Kwal_27.11263singletonOFF275169761.0
NDAI0A028305.84ON47377724.0
TDEL0B003208.863ON63731716.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.264
         (612 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   403   e-132
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   385   e-126
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   381   e-124
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   363   e-117
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    300   2e-94
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   281   1e-86
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   276   5e-85
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   275   2e-84
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   267   3e-82
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   266   7e-82
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   265   2e-81
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   266   5e-81
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   264   1e-80
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   257   2e-78
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   253   2e-76
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   254   9e-76
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   244   1e-72
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   241   3e-72
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   242   4e-72
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   239   2e-71
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   238   3e-71
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   239   3e-71
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   238   2e-69
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   231   9e-68
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   223   5e-66
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   206   4e-57
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   184   1e-50
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    99   2e-21
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    97   6e-21
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    96   1e-20
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    96   2e-20
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    95   3e-20
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    95   3e-20
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    95   3e-20
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    95   4e-20
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    95   5e-20
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    94   5e-20
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    94   7e-20
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    93   1e-19
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    93   1e-19
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    92   2e-19
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    92   3e-19
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    92   4e-19
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    90   2e-18
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    90   2e-18
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    88   6e-18
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    81   1e-15
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    73   1e-13
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    71   5e-13
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    64   1e-10
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    64   2e-10
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    64   3e-10
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    61   1e-09
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    60   4e-09
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    58   2e-08
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    54   3e-07
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    53   4e-07
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    52   1e-06
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    52   1e-06
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    53   2e-06
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    48   3e-05
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    49   3e-05
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    48   3e-05
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    48   3e-05
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    47   5e-05
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    48   6e-05
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    47   1e-04
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    46   3e-04
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    45   3e-04
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    45   6e-04
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    44   8e-04
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    44   0.001
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    44   0.001
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    41   0.007
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    40   0.010
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    40   0.011
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    40   0.013
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    39   0.018
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    40   0.021
TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {O...    39   0.044
TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa] ...    38   0.099
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    37   0.12 
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    37   0.14 
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    36   0.20 
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    36   0.22 
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    36   0.25 
KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa] {O...    35   0.54 
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    34   0.78 
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    34   1.0  
NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.8...    32   4.0  
TDEL0B00320 Chr2 complement(59154..61067) [1914 bp, 637 aa] {ON}...    32   6.1  

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  403 bits (1035), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 218/352 (61%), Positives = 218/352 (61%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           IIRVKAKELVSLLNDDERLREERSM                      NPHDSSPSYQNDL
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           EKALEESRITAQEDEQRRRELAQYDDEDPDF                             
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQNQQQSL 240

Query: 241 XXXXXXXXXXXXXPAYYDIFGNPISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                        PAYYDIFGNPIS                                   
Sbjct: 241 SQMQVPVQQQQEQPAYYDIFGNPISQDEYLQYQYQQDQEQAMAQQRWLDQQQEQQQLAEQ 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXHTAANMXXXXXXXXXXXXXXTGSNNPFSMDN 352
                                HTAANM              TGSNNPFSMDN
Sbjct: 301 QYFQQQQQAAAVAATNAMEQQHTAANMQQQQQPVDFQQPLPTGSNNPFSMDN 352

 Score =  167 bits (424), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 97/188 (51%), Positives = 97/188 (51%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           PLKQTRTGNQSISDKYNDLNTLLA            EARIPAQHTKTGTFINSQGTGYKQ
Sbjct: 425 PLKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 484

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGXXXXXXXXXXXXXXXINVSXXXXXXXX 544
           VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG               INVS        
Sbjct: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFGNQPQSPPANSPPQNSINVSYSQSQQQP 544

Query: 545 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAPD 604
                                                                   YAPD
Sbjct: 545 QYTQGYQQQQQQPQYAQNIQQQPQYAQNIQQQPQYTQNYHQGSSQQQQQQQQQQQGYAPD 604

Query: 605 QGISLIDL 612
           QGISLIDL
Sbjct: 605 QGISLIDL 612

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  385 bits (989), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 199/267 (74%), Positives = 201/267 (75%), Gaps = 2/267 (0%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           IIRVKAKELVSLLND+ERLREERSM                      NPHDSSPSYQ+DL
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXX--XXXXXXXXXXXXXXXXXXXX 238
           EKALEESRITAQEDEQRRRELAQYDDEDPDF                             
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQSL 240

Query: 239 XXXXXXXXXXXXXXXPAYYDIFGNPIS 265
                          PAYYDIFGNPIS
Sbjct: 241 SQFQAPLQQQQPQQQPAYYDIFGNPIS 267

 Score =  163 bits (412), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 79/93 (84%), Positives = 80/93 (86%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           PLKQTRTGNQSISDKY+DLNTLLA            EARIPAQHTKTGTFINSQGTGYKQ
Sbjct: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           V NEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG
Sbjct: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  381 bits (978), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 195/270 (72%), Positives = 198/270 (73%), Gaps = 5/270 (1%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKNM+KGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           IIRVKAKELVSLLNDDERLREERSM                      NP DSSPSYQ++L
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           EK LEESRITAQEDEQRRRELAQYDDEDPDF                             
Sbjct: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQPL 240

Query: 241 XXX-----XXXXXXXXXXPAYYDIFGNPIS 265
                             PAYYDIFGNPIS
Sbjct: 241 SQMPVPVQQQQQQQQQQLPAYYDIFGNPIS 270

 Score =  159 bits (403), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 77/93 (82%), Positives = 79/93 (84%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           PL+QTRTGNQSISDKYNDLN LLA            EARIPAQHTKTGTFINSQGTGYKQ
Sbjct: 450 PLEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 509

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           V +EPKNNPFLSNQYTGLPSTNIVPTQTGYGFG
Sbjct: 510 VTSEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 542

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  363 bits (932), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 189/269 (70%), Positives = 195/269 (72%), Gaps = 10/269 (3%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYSSTQVLVRDATAND RTPSIDTLDDLAQRSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXX----XXXXXXXXXXXXXXXXXXXXNPHDSSPSY 176
           IIRVKAKELVSLLNDDERLREER+M                          N +DS P+Y
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 177 QNDLEKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXX 236
           QNDLEKALEESRITAQEDE RR E+AQYDD+DPDF                         
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQQL 240

Query: 237 XXXXXXXXXXXXXXXXXPAYYDIFGNPIS 265
                             AYYDIFGNPIS
Sbjct: 241 QSQLQMPPQQQA------AYYDIFGNPIS 263

 Score =  155 bits (393), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 74/93 (79%), Positives = 79/93 (84%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           PL QTRTGNQSISDKYNDLN LLA            E+RIPAQHTKTGTFINSQGTGYKQ
Sbjct: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           V+NEPKNNPFL++QYTGLPST+IVPTQTGYGFG
Sbjct: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFG 525

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  300 bits (767), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 153/265 (57%), Positives = 181/265 (68%), Gaps = 13/265 (4%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNM+KGYS+TQVLVRDAT+ND+  PS + L +LAQRS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           IIRVKAKEL SLL D+ERL+EER++                        +D     Q++L
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDED---QDEL 177

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++ALEESR+TA+EDE+RRR++AQYDD+DPD                              
Sbjct: 178 QRALEESRLTAEEDERRRRQMAQYDDQDPDLQTALQLSKEEEELKKLQEMQRLQQQQGQM 237

Query: 241 XXXXXXXXXXXXXPAYYDIFGNPIS 265
                          Y+DIFGNPIS
Sbjct: 238 NQPQ----------GYFDIFGNPIS 252

 Score =  139 bits (350), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 73/89 (82%)

Query: 429 TRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQVINE 488
           TRTGNQSI+DKY+ LNTLLA            E RIPAQHT+TGTFINSQGTGY+QV N+
Sbjct: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428

Query: 489 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           PKNNPFL++QYTGLPSTNIV TQTGYGFG
Sbjct: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFG 457

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  281 bits (720), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 153/268 (57%), Positives = 180/268 (67%), Gaps = 15/268 (5%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN+MKGYSSTQVLVRDAT+ND+R  +IDTLDD+A RSYDSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+ KSLTVLDYLVRFGSENCVLWC+EN YVIKTLREFR+E+++G D+GQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXN---PHDSSPSYQ 177
           IIRVKAKEL SLL D+ERLREER                        +   P D      
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDD------ 174

Query: 178 NDLEKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXX 237
           +DL++ +EES+ TA+EDE+RR+ELA+YD+EDP+F                          
Sbjct: 175 DDLQRVIEESKKTAEEDERRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQL 234

Query: 238 XXXXXXXXXXXXXXXXPAYYDIFGNPIS 265
                             YYD+FGNPIS
Sbjct: 235 QMLQQQQTSAN------VYYDVFGNPIS 256

 Score =  125 bits (313), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 69/89 (77%), Gaps = 1/89 (1%)

Query: 430 RTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQVINE- 488
           RTGN+ I++KY++LN LLA            + RIPAQHTKTGTFINSQGTGYKQV NE 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 489 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
            KNNPFL+ QYTGLPS+NIVP+ TGYGFG
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFG 477

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  276 bits (705), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 143/265 (53%), Positives = 172/265 (64%), Gaps = 23/265 (8%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYSS QVLVR+ATAN+S  PS+D LD+LA+++YDSV+FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWCREN YVIKTL EFR++++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           IIRVKAKEL +LL+DDERLREER M                              + +DL
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRT---------TGEQDGFDDDL 171

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++AL+ESR+TA+EDE+RR+ L   DD+                                 
Sbjct: 172 QRALDESRLTAEEDERRRKMLGSEDDD--------------LQAALQLSKEEEELKRLQE 217

Query: 241 XXXXXXXXXXXXXPAYYDIFGNPIS 265
                          YYDIFGNPIS
Sbjct: 218 MQKLQQQQTQQQPSQYYDIFGNPIS 242

 Score =  125 bits (314), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 57/91 (62%), Positives = 68/91 (74%)

Query: 427 KQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQVI 486
           K  RTG+ ++++KY +LN LLA            +ARIPAQHTKTGTFINSQGTGY+QV 
Sbjct: 387 KPVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVT 446

Query: 487 NEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
            EPK NPFL +QYTG+PS+NIVP  TGYGFG
Sbjct: 447 GEPKKNPFLQSQYTGIPSSNIVPAHTGYGFG 477

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  275 bits (702), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 154/266 (57%), Positives = 179/266 (67%), Gaps = 14/266 (5%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M  Q VRSAKNM+KGYSSTQV+VRDATANDS +PS+  L+DLA ++YD+V+FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE+E SG DEG
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQND 179
           QIIRVKAKEL SLL DDERLREER++                      +  +   +Y +D
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRN---AYDDD 177

Query: 180 LEKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           L+KALEESR+TA+E+E RRRE AQY+++DPD                             
Sbjct: 178 LQKALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQ 237

Query: 240 XXXXXXXXXXXXXXPAYYDIFGNPIS 265
                           YYDIFGNPIS
Sbjct: 238 QQQQN----------VYYDIFGNPIS 253

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 70/90 (77%), Positives = 75/90 (83%)

Query: 428 QTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQVIN 487
           +TRTGNQSISDKY++LN LLA            EARIPAQHTKTGTFINSQGTGYKQV N
Sbjct: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419

Query: 488 EPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           EPKNNPFLS+QYTGLPSTNIVP+ TGYGFG
Sbjct: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  267 bits (683), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 140/265 (52%), Positives = 172/265 (64%), Gaps = 26/265 (9%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           I+RVK+KEL +LL+DDERL EER+M                          SS    NDL
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGR---------SSNDNDNDL 171

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++AL+ SR+TA+EDE+RR+      DED +                              
Sbjct: 172 QRALDASRMTAEEDEKRRKM-----DEDYE------------TALQLSKEEEELKRLQDL 214

Query: 241 XXXXXXXXXXXXXPAYYDIFGNPIS 265
                        P YYDIFGNPI+
Sbjct: 215 QRMQQLQTQQQQQPMYYDIFGNPIT 239

 Score =  146 bits (369), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 75/93 (80%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           PL QTRTGNQS++DKYN LN LLA            +AR+PAQHTKTGTFINSQGTGYKQ
Sbjct: 346 PLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQ 405

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           V N+PK NPFLS QYTGLPSTN+VPTQTGYGFG
Sbjct: 406 VSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  266 bits (679), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 173/265 (65%), Gaps = 26/265 (9%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           I+RVKAKEL +LL+DDERL EER+M                      N  D      +DL
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNM-----NIKGRSRKGRKRRGTGRNDEDD-----DDL 170

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++A++ SR+TA+EDE+RR++     DED +                              
Sbjct: 171 QRAIDASRMTAEEDERRRKQ-----DEDYE-----------TALQLSKEEEELKRLQDLQ 214

Query: 241 XXXXXXXXXXXXXPAYYDIFGNPIS 265
                        P YYDIFGNPI+
Sbjct: 215 RMQQVHAQQQQQQPMYYDIFGNPIT 239

 Score =  142 bits (359), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 66/93 (70%), Positives = 75/93 (80%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           PL QTRTGNQS++DKY  LN LLA            ++R+PAQHTKTGTFINSQGTGY+Q
Sbjct: 333 PLTQTRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQ 392

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           V N+PK NPFL++QYTGLPSTNIVPTQTGYGFG
Sbjct: 393 VSNDPKQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  265 bits (677), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 138/265 (52%), Positives = 171/265 (64%), Gaps = 26/265 (9%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWCREN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           I+RVKAKEL +LL+DDERL EER+M                           S    +DL
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTG----------RSDENDDDL 170

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++A+  SR+TA+EDE+RR++     DED +                              
Sbjct: 171 QRAISASRLTAEEDERRRKQ-----DEDYE-----------TALQLSKEEEELKRLQDLQ 214

Query: 241 XXXXXXXXXXXXXPAYYDIFGNPIS 265
                        P YYDIFGNPI+
Sbjct: 215 RMQQQQGQQQLQQPMYYDIFGNPIT 239

 Score =  135 bits (339), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 74/92 (80%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           PL Q RTGNQS++DKY+ LN LLA            EARIPAQHTKTGTFINSQGTGY+Q
Sbjct: 340 PLIQNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQ 399

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGF 516
           V ++P +NPFL++QYTGLPST++VPTQTGYGF
Sbjct: 400 VSDDPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  266 bits (680), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 142/265 (53%), Positives = 167/265 (63%), Gaps = 21/265 (7%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M  QFVRSAKN +KGY+S QVLVRDATAN+   PS+D LD+LA RSYDSV+FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCREN Y+IKTLREFRH+++   D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           IIRVKAKEL +LL DDERLR ER                         P  +  SY +++
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERG--------EDKGAPPRMMSPSPPTPRRN--SYDSEM 170

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           ++AL+ SR+TA+EDE+RR+ L   ++ED D                              
Sbjct: 171 QRALDASRLTAEEDERRRKTL---NNEDADLETALQLSKEEEELKRLQELQKAQQDQQRL 227

Query: 241 XXXXXXXXXXXXXPAYYDIFGNPIS 265
                          YYDIFGNPIS
Sbjct: 228 SQMQPQ--------GYYDIFGNPIS 244

 Score =  134 bits (336), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 61/93 (65%), Positives = 72/93 (77%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           P++  RTGNQSISDKYNDLN LLA            +ARIPAQHTKTGTFINSQGTG+KQ
Sbjct: 419 PMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQ 478

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
             NEPK NPFL  Q+TG+P++++VP+ TGYGFG
Sbjct: 479 YSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  264 bits (674), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 148/266 (55%), Positives = 175/266 (65%), Gaps = 6/266 (2%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQFVRSAKNMMKGYS+TQVLVRDAT+NDS  PS + L ++++RS+DSVDFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC++N Y+IKTL+EF+ E+++  DE  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDDN-VDESS 119

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           IIRVKAKEL +LL DDERL+EERS+                      N          DL
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSI----NLKNNRRSERKNRSRRGTNATRRGTKSDEDL 175

Query: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFXXX-XXXXXXXXXXXXXXXXXXXXXXXXX 239
           +KALEESRITA+EDE+RRRELAQYD++D D+                             
Sbjct: 176 QKALEESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQLQQQQ 235

Query: 240 XXXXXXXXXXXXXXPAYYDIFGNPIS 265
                           YYDIFGNPIS
Sbjct: 236 QQQMQFQQQPQQQEQVYYDIFGNPIS 261

 Score =  133 bits (334), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 63/89 (70%), Positives = 72/89 (80%), Gaps = 1/89 (1%)

Query: 429 TRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQVINE 488
           TRTGNQSISDKYN+LN LLA            + RIPAQHT+TGTFINSQGTGYKQ++N+
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 489 P-KNNPFLSNQYTGLPSTNIVPTQTGYGF 516
           P K NPFL+NQYTGLPS+NIVP+ TGYGF
Sbjct: 428 PVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  257 bits (657), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 158/205 (77%), Gaps = 10/205 (4%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQ VRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRH+++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           I+RVKAKEL SLL+D+ERL EER+M                         + S    +DL
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRR----------TNRSSEDDDDL 170

Query: 181 EKALEESRITAQEDEQRRRELAQYD 205
           ++A++ SR+TA EDE+RR++   Y+
Sbjct: 171 QRAIDASRMTADEDERRRKQDEDYE 195

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 63/93 (67%), Positives = 74/93 (79%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           PL QTRTGNQS++DKY+ LN LL             + R+PAQHTKTGTFINSQGTGY+Q
Sbjct: 348 PLTQTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQ 407

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           V N+PK+NPFL++QYTGLPSTN+VP QTGYGFG
Sbjct: 408 VSNDPKHNPFLNSQYTGLPSTNVVPAQTGYGFG 440

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  253 bits (647), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 134/268 (50%), Positives = 166/268 (61%), Gaps = 18/268 (6%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK  +R AKN++ GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN YVIKTLREF HE+E G D+GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           I+RVKA+EL +LL DDERLREERS+                          ++ S   DL
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTKNRKPRR---------------RPTAGSEDEDL 165

Query: 181 EKALEESRITA-QEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           ++A+EESR+TA QE+ +RRR+L  YD+   D                             
Sbjct: 166 QRAMEESRLTAEQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQA 225

Query: 240 XXXX--XXXXXXXXXXPAYYDIFGNPIS 265
                           P YYD+FGNPIS
Sbjct: 226 QQQMFGLSQQQTQAQQPMYYDVFGNPIS 253

 Score =  127 bits (319), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 69/89 (77%)

Query: 429 TRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQVINE 488
           TRTGNQSI++K+++LN LLA            + RIPAQHTKTG FINSQGTGYKQV + 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454

Query: 489 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           PK+NPFL  QYTGLPSTN+VP+ TGYGFG
Sbjct: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  254 bits (649), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 123/196 (62%), Positives = 148/196 (75%), Gaps = 8/196 (4%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQF+RS KNM+KGYSSTQ+LVRDATAND  TPSID LDD+A+++YDSVDFFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE----SGF 116
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WC+EN Y+IKTL+EFR ++     +G+
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DEGQIIRVKAKELVSLLNDDERLREERSMXXXXXXXXX----XXXXXXXXXXXXXNPHDS 172
           D+GQI+RV+A EL SLL DDERLREERS+                          N   +
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 173 SPSYQNDLEKALEESR 188
              Y +DL+KA+EES+
Sbjct: 181 DDHYDDDLQKAIEESK 196

 Score =  143 bits (360), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 74/93 (79%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           P+ Q RTGNQ ISDKYN+LNTLLA            + RIPAQHT TGTFINSQGTGYKQ
Sbjct: 466 PIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQ 525

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
            IN+PKNNPF+SNQYTGLPSTN+VP+ TGYGFG
Sbjct: 526 YINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFG 558

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  244 bits (623), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 148/191 (77%), Gaps = 13/191 (6%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           M KQFVRSAKN++KGYSSTQV+VR+AT+NDS  P IDTLD LA+++YDSV+FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+I+TL+EF + ++S  D+GQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           IIRVKAKEL SLLND+ERLR+ER M                            PS  ++L
Sbjct: 121 IIRVKAKELTSLLNDEERLRDERGMNRRGGRRERARPR-------------RRPSDDDEL 167

Query: 181 EKALEESRITA 191
           ++A+EES+ TA
Sbjct: 168 QRAIEESKRTA 178

 Score =  137 bits (346), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 64/89 (71%), Positives = 72/89 (80%)

Query: 429 TRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQVINE 488
           TRTGNQ I+DK+ +LN LLA            EARIPAQHTKTGTFINSQGTGY+QV N+
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 489 PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           PKNNPFL++QYTGLPSTNIVP+ TGYGFG
Sbjct: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  241 bits (616), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 142/267 (53%), Positives = 167/267 (62%), Gaps = 32/267 (11%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MS QFVRS KN++KGYSSTQVLVR+ATAN+   P+ID L D+A+++YDS DFFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE--SGFDE 118
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+IKTL EFR+E+E   G D+
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQN 178
           GQIIRVKAKEL +LL DDERLREER +                          +      
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRR-------------PPARNGSDE 167

Query: 179 DLEKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXX 238
           DL++ALEESR TA+EDE++RR L Q DD D                              
Sbjct: 168 DLQRALEESRRTAEEDERKRR-LNQ-DDSD---------------LQAALQLSKEEEELK 210

Query: 239 XXXXXXXXXXXXXXXPAYYDIFGNPIS 265
                          P YYD+FGNPIS
Sbjct: 211 RLQELQSSMHMQQQQPVYYDVFGNPIS 237

 Score =  126 bits (317), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 68/88 (77%)

Query: 430 RTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQVINEP 489
           RTGN+ +++KYN+LN LLA            E RIPAQHT+TGTFINSQGTGY+Q   E 
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 490 KNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           K NPFLSNQYTGLPS+NI+PTQTGYGFG
Sbjct: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  242 bits (617), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 168/266 (63%), Gaps = 16/266 (6%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK  +R AKN++ GYS+TQVL+R+AT+ND   PS+D +D++A+RS+DSV FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W +EN Y+IKTLREF HE+E+G D+GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           I+RVKA+EL +LL D+ERLREER +                          +S SY +D+
Sbjct: 121 IVRVKARELTALLQDEERLREERELKGRNRRPRRRK---------------NSDSYDDDM 165

Query: 181 EKALEESRITA-QEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           ++ALEESR+TA QE+ +RRR+L  YD+   D                             
Sbjct: 166 QRALEESRMTAEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQMQQA 225

Query: 240 XXXXXXXXXXXXXXPAYYDIFGNPIS 265
                         P YYD+FGNPIS
Sbjct: 226 QQQMFGLQQQQTQQPMYYDVFGNPIS 251

 Score =  127 bits (319), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 70/91 (76%), Gaps = 2/91 (2%)

Query: 429 TRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQVINE 488
           TRTGNQS++DK++DLN LLA            + RIPAQHTKTGTFINSQGTGYKQV N 
Sbjct: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446

Query: 489 P--KNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           P  K+NPFL  QYTGLPST++VP+ TGYGFG
Sbjct: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFG 477

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  239 bits (610), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 160/266 (60%), Gaps = 21/266 (7%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK F+RSAKN++ GYS  QVLVR AT+ND   PS+D L++LA+R++D+V+FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WC+EN Y+IKTLREF H +E +  D G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQND 179
           +I+RVKAKEL +LL D+ERL+EER M                                +D
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKN------------RRDDNEDDDD 168

Query: 180 LEKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           L++ALEESRITA+E+E+RR++L    D+                                
Sbjct: 169 LQRALEESRITAEEEERRRKQLMMQGDDS--------SLQAALELSKEEEELRRLQQLQA 220

Query: 240 XXXXXXXXXXXXXXPAYYDIFGNPIS 265
                         P YYDIFGNPIS
Sbjct: 221 QQQAALWQQQQQQQPMYYDIFGNPIS 246

 Score =  127 bits (318), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/94 (62%), Positives = 73/94 (77%), Gaps = 1/94 (1%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           P+ + RTGNQSISDK+++LN LLA            E R+PAQHTKTGTFINSQGTGYKQ
Sbjct: 355 PVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQ 414

Query: 485 VINE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           + N+ PK+NPFL++QYTG+PS+ I P+ TGYGFG
Sbjct: 415 ITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  238 bits (607), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 129/271 (47%), Positives = 159/271 (58%), Gaps = 41/271 (15%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64
            +RSAKN++KGYS T+VLVRDATAN+S  PS + LDDLA +SY+SV+FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+EN Y+IKTLREF HE+  G DEG+IIRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDLEKAL 184
           KAKEL SLL D+ERL+EER+M                      +          DL++A+
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSD---------EDLQRAI 171

Query: 185 EESRITAQ----------EDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXX 234
           EES+ TA+            E  R+   Q   E+ D                        
Sbjct: 172 EESKRTAEEEERRRRNGASSEADRQAALQLSREEEDL----------------------R 209

Query: 235 XXXXXXXXXXXXXXXXXXXPAYYDIFGNPIS 265
                              P YYD+FGNPI+
Sbjct: 210 RLQEQARLAQQQQQQQQQQPMYYDVFGNPIT 240

 Score =  135 bits (340), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 65/93 (69%), Positives = 73/93 (78%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           PL QTR+GNQ+ISDKY+ LN LLA            E RIPAQHT+TGTFINSQGTGY+Q
Sbjct: 334 PLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQ 393

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           V N+ K NPFL+ QYTGLPSTNIVPTQTG+GFG
Sbjct: 394 VNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFG 426

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  239 bits (611), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 142/191 (74%), Gaps = 11/191 (5%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSK  +R+AKN++ GYSS QVLVR+AT+N+   P++D LD+LA+++YD+V+FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +EN Y+IKTLREF HE+E G D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQNDL 180
           IIRVKAKEL SLL D+ERL EER+M                              Y +DL
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNMRKKRRGKTRRPERSR-----------GGEEYDDDL 169

Query: 181 EKALEESRITA 191
           ++ALEESR+TA
Sbjct: 170 QRALEESRLTA 180

 Score =  130 bits (328), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 64/93 (68%), Positives = 71/93 (76%), Gaps = 1/93 (1%)

Query: 426 LKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQV 485
           L  TRTGNQSIS KYNDLN LLA            + RIPAQHT+TG FINSQGTGYKQV
Sbjct: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430

Query: 486 IN-EPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
            N +PKNNPFL+ QYTGLPST++VP+ TGYGFG
Sbjct: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFG 463

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  238 bits (608), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 124/239 (51%), Positives = 158/239 (66%), Gaps = 28/239 (11%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MS+QFVRSAKN+MKGYSSTQVLVRDATAND RTP +DTL+D+A  S+DSVDFFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W R++ +++K LR FR  ++  GFD+G
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIIRVKAKELVSLLNDDERL------REERSMXXXXXXXXXXXXXXXXXXXXXXNPHD-- 171
           QI+RVKA++LV LL   E+L      R   +                       +P D  
Sbjct: 121 QIVRVKARDLVELLQSGEQLGGRKAKRARGASRRDRGRRRGGDRGGGEYRQRGDDPEDEY 180

Query: 172 -----SSPSYQ--------------NDLEKALEESRITAQEDEQRRRELAQYDDEDPDF 211
                  P  Q              +DL++A+EES+ T QEDE+RRR+L+ YD+EDP+F
Sbjct: 181 YPRPAGGPPPQRQGYESGGARGNDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEF 239

 Score =  114 bits (286), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 69/96 (71%), Gaps = 3/96 (3%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           P+ +  TGNQ +++KY++LN LLA              RIPAQHT+TGTFINSQGTG+KQ
Sbjct: 490 PMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQ 549

Query: 485 VINE---PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           V +E   P +NPFL++QYTGLPST IVP  TGYGFG
Sbjct: 550 VNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  231 bits (588), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 125/266 (46%), Positives = 159/266 (59%), Gaps = 12/266 (4%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQ +RSAKN+M GYS  QVLVR+AT+ND   PS+D +++LA+R+Y +V+FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W REN ++I+ L EF H +E SG D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQND 179
           Q+IRVKAKEL++LL DDERL+EER++                      NP    P    D
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNL-------RLGRGKKNPQNVPETNPDGVDP----D 169

Query: 180 LEKALEESRITAQEDEQRRRELAQYDDEDPDFXXXXXXXXXXXXXXXXXXXXXXXXXXXX 239
           L++ALEESRITA+E+E+RR+   + +D +                               
Sbjct: 170 LKRALEESRITAEEEERRRKLAEKTEDAEELQAALQLSKEEEELRKLRELQQQREQQMAF 229

Query: 240 XXXXXXXXXXXXXXPAYYDIFGNPIS 265
                         P YYDIFGNPI+
Sbjct: 230 WQQQQVQQVQYQQQPMYYDIFGNPIT 255

 Score =  126 bits (317), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 62/90 (68%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 429 TRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQVINE 488
           TRTGNQSISDKY +LN LLA            +ARI +QHTKT TFINS GTG+KQV NE
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 489 -PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
            PK+NPFL+ QYTGLPSTNIVP+ TGYGFG
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFG 492

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  223 bits (568), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 98/141 (69%), Positives = 123/141 (87%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLN 64
            +RSAKN++KGYSSTQ LVRDAT+N    P ID L +LA+ +Y++++FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRV 124
            KGKYW+HV KSL VLDYLVRFGSENCV+WC+EN Y+IKTLREF +E+ESG D+GQ++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAKELVSLLNDDERLREERSM 145
           +AKEL SLL D+ERLREER++
Sbjct: 121 RAKELTSLLMDEERLREERAL 141

 Score =  132 bits (333), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 66/93 (70%), Positives = 72/93 (77%)

Query: 425 PLKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQ 484
           PLKQTRTG+QSISDKY+ LNTLLA              RIPAQHTKTGTFINSQGTGYKQ
Sbjct: 310 PLKQTRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQ 369

Query: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
           V     NN FL++QYTGLPS+NIVP+QTGYGFG
Sbjct: 370 VSTNGFNNVFLNSQYTGLPSSNIVPSQTGYGFG 402

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  206 bits (523), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 108/213 (50%), Positives = 138/213 (64%), Gaps = 13/213 (6%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MS QFVRS KNM KGYS TQVLVRDATAN+    SID LD L + SYD+ +F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W R+N   ++ LR+F + + +G D+GQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPH-----DSSPS 175
           +IRVKA EL+ LL D ERL  ER M                       PH        P 
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGM--------NMRGRRNALPPRRMGPHRRPSMPRRPE 172

Query: 176 YQNDLEKALEESRITAQEDEQRRRELAQYDDED 208
            + D+++ALEES+ TA+EDE RRR+  + + +D
Sbjct: 173 DEEDVDRALEESKKTAEEDEARRRKDQEREKQD 205

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 50/83 (60%)

Query: 426 LKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQV 485
           L+   TGN  IS KY++LN LLA              RIPAQHTKTGTFINSQGTGYKQV
Sbjct: 591 LQPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQV 650

Query: 486 INEPKNNPFLSNQYTGLPSTNIV 508
            +     P L  QYTGLP+   V
Sbjct: 651 TSSSSPIPLLPTQYTGLPAQTAV 673

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  184 bits (468), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 107/192 (55%), Positives = 135/192 (70%), Gaps = 12/192 (6%)

Query: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60
           MSKQ +RSAKN++ GYS  Q+LVR+AT+N+   PS+D +++LA+RSY +V+FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENES-GFDEG 119
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W REN Y+ + L EF H +ES G D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIIRVKAKELVSLLNDDERLREERSMXXXXXXXXXXXXXXXXXXXXXXNPHDSSPSYQND 179
           QIIRVKA+ELV+LL D+ERLREER+M                         D  P    D
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRLGRNPRNRQASVPPPA-------EDLDP----D 169

Query: 180 LEKALEESRITA 191
           L++ALEESRITA
Sbjct: 170 LQRALEESRITA 181

 Score =  134 bits (338), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 65/93 (69%), Positives = 75/93 (80%), Gaps = 1/93 (1%)

Query: 426 LKQTRTGNQSISDKYNDLNTLLAXXXXXXXXXXXXEARIPAQHTKTGTFINSQGTGYKQV 485
           L+ TRTGNQSI+DKY++LNTLLA            + RIPAQHTKTGTFINSQGTGYKQV
Sbjct: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457

Query: 486 INE-PKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517
            NE PK+NPF++ QYTGLPSTN+VP+ TGYGFG
Sbjct: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFG 490

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+NM+  Y+  +  VR+AT N+    S   ++ ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   R N  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +A ELV LL+DD ++R ER
Sbjct: 135 NVRNRAHELVLLLDDDGKIRTER 157

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 97.4 bits (241), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R + K LV LL+DD ++R ER
Sbjct: 135 NVRTRVKALVELLSDDSKIRAER 157

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 85/143 (59%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +LDYL+R G+E  +   R N  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +A EL  LL+DD ++R ER
Sbjct: 135 NVRNRAHELALLLDDDAKVRAER 157

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 87/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  + +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +AK LV LL DD  +R+ER
Sbjct: 135 NVRNRAKLLVELLQDDSNIRQER 157

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+M  Y+  +  VR+AT N+    S   ++ ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R KA+ L +LL DDE++R ER
Sbjct: 135 NVRNKAQSLTALLKDDEQIRAER 157

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 87/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ ++  +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   R N  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +A+ELV LLN+D+++R ER
Sbjct: 135 NVRNRAQELVKLLNNDDQIRAER 157

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R + K L+ LL+DD ++R ER
Sbjct: 135 NVRTRVKTLIELLSDDNKIRAER 157

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YLV+ GSE  +   R N  ++K L  F + +  G D+G 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +A +LV LL  DE++R+ER
Sbjct: 135 NVRNRASQLVKLLESDEQIRQER 157

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 94.7 bits (234), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R + K L+ LL+DD ++R ER
Sbjct: 135 NVRTRVKALIELLSDDNKIRAER 157

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 85/143 (59%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           RL +K    WR + K+L +LDYL+R  SE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +AK L  LL+DDE +R ER
Sbjct: 135 NVRNRAKALAELLSDDETIRAER 157

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 94.0 bits (232), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   +D ++Q +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R + K L+ LL+DD ++R ER
Sbjct: 135 NVRTRVKALIDLLSDDNKIRAER 157

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 92.8 bits (229), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 83/143 (58%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+M  Y+  +  VR+AT N+    S   +  +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + KS+ +L+YLV+ GSE  +   R N  +I+ L  F + +  G D+G 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R + K LV LL DDE +R ER
Sbjct: 135 NVRNRTKALVKLLEDDELIRAER 157

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 85/143 (59%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  ++  +  VR+AT N+    S   ++ +AQ +Y+  +  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL+R GSE  +   R    +++ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +AK++V LL DD  +R+ R
Sbjct: 135 NVRNRAKQIVELLQDDAAVRDAR 157

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 87/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + KSL +LDYL+R GSE  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +AK L  LL+DD ++R+ER
Sbjct: 135 NVRNRAKALGELLSDDTKIRQER 157

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 85/143 (59%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +LDYL++ GSE  +   R +  V+K L+ F + +  G D+G 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +   L+ LL DD  +R+ER
Sbjct: 135 NVRNRVTTLIELLRDDNSIRQER 157

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 83/143 (58%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N+M  Y+  +  VR+AT N+    S   +  +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + KSL + DYL++ GSE  +   R +  +IK L  F + +  G D+G 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R KA+ LV+ L DD+ +R ER
Sbjct: 135 NVRNKAQSLVAFLKDDDLIRAER 157

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 84/143 (58%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +L+YL+  G+E  +   R +  +I+ L  F + +  G D+G 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +A+ + SLL+ D+ +R  R
Sbjct: 135 NVRSRAQAMTSLLSSDDAIRSAR 157

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 84/143 (58%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + K+L +L+YL++ GSE  +   R +  ++K L  F + +  G D+G 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +AK L  LL DD ++R ER
Sbjct: 170 NVRTRAKALTELLGDDNKIRAER 192

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 83/143 (58%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+S       +  +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K    WR + KS+ +L+YL+  GSE  +   R    +IK L  F + +  G D+G 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R + + LV LLN+DE++R ER
Sbjct: 135 NVRNRTQALVQLLNNDEQIRIER 157

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 84/143 (58%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR+AT N+    S   ++ +AQ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + K+L +L+YL++ GSE  +   R +  ++K L  F + +  G D+G 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            +R +A  L +LL DD  +R ER
Sbjct: 135 NVRNRAAALTALLADDSSIRAER 157

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 82/147 (55%), Gaps = 12/147 (8%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
           F+RS +NM  G S+T+V V+ AT +D  + +   L ++++  +Y +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGF 116
           +  G Y +       H+ K+LT++ YL+  GS + V W R+  Y++ TLREF    +   
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 117 DEGQIIRVKAKELVSLLNDDERLREER 143
              + +R+ + +L  LL DD  L+E R
Sbjct: 119 KMAEQVRMLSIKLSKLLKDDLMLQERR 145

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 70.9 bits (172), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 79/146 (54%), Gaps = 8/146 (5%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
            +++ +N+  G SST+V  R+AT +D    +  +L ++L+  +Y      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  NDKG-----KYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDE 118
           +        K   H+ K+LT++ YL+  GS+  V+W R   Y+I TL+EF   + +    
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 119 GQIIRVKAKELVSLLNDDERLREERS 144
              IR  A  L ++L D+E LR+ RS
Sbjct: 121 ASQIRNLASSLAAILRDEELLRQRRS 146

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 74/134 (55%), Gaps = 6/134 (4%)

Query: 17  SSTQVLVRDAT-ANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKG-----KYW 70
           S+T++ V+ AT  N+S   +   +++++  +Y      EI+ ++ KRL   G     K  
Sbjct: 13  STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGHGRRNSHKIC 72

Query: 71  RHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKELV 130
            H+ K+LT++ YL+  GS + + W R N  ++  L+EF  ++ +    GQ IR  +++L 
Sbjct: 73  IHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKIGQQIRAMSQDLC 132

Query: 131 SLLNDDERLREERS 144
           +L+ DD+ L   R+
Sbjct: 133 TLIKDDDLLENRRA 146

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 75/142 (52%), Gaps = 8/142 (5%)

Query: 8   SAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           S +N ++  S+T+  V++AT ++  + +  TL ++++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
            K        H+ K++T++ YL+  GS + + W R N  + + L++F   +E      + 
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEKMAEQ 123

Query: 122 IRVKAKELVSLLNDDERLREER 143
           IR  A +L  L+NDDE L   R
Sbjct: 124 IRYIAGDLCILINDDELLEARR 145

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 73/143 (51%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDK 61
           +K+F R A+N +   +  +  VR+AT ND    S+  +  +   +++     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120
           R  +K G  WR + KS+ +L YL+  GS   V   + N  +IK L  F   ++ G+++  
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 121 IIRVKAKELVSLLNDDERLREER 143
            I    + L+ L+ DD  L + R
Sbjct: 135 KISKATERLIELMTDDHLLNDLR 157

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 75/142 (52%), Gaps = 8/142 (5%)

Query: 8   SAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLN-- 64
           S +N ++  S T+  VR AT +D  + +  TL ++++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 65  ---DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
              +  K   H+ K+LT++ YL+  GS + + W R N  + + L+ F  +N      GQ 
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMGQQ 123

Query: 122 IRVKAKELVSLLNDDERLREER 143
           I     ++ +++NDD+ L ++R
Sbjct: 124 IVFICNDICNIINDDDMLEQKR 145

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 70/136 (51%), Gaps = 6/136 (4%)

Query: 15  GYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL---NDKGKYW 70
           G S T++  ++AT +D  + +  +L ++++  +Y S    EI  ++ KRL   N K  + 
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 71  R--HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKE 128
              H+ K+LT+  YL+  GS   V W R   Y+I +L+EF   +         IR  A  
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERMAVQIRSLAST 130

Query: 129 LVSLLNDDERLREERS 144
           L  +L DDE LR+ RS
Sbjct: 131 LSVILRDDELLRQRRS 146

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 67/135 (49%), Gaps = 6/135 (4%)

Query: 15  GYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRH- 72
           G SST++ VR AT  D +T +  TL ++++  +Y      EI  +L +RL+  G+   H 
Sbjct: 11  GPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTSHK 70

Query: 73  ----VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKE 128
               + K+LT++ YL+  GSE  V W R N    + L+      +      + IR  + +
Sbjct: 71  NSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKRDEPLAKQIRSMSNQ 130

Query: 129 LVSLLNDDERLREER 143
           +   + DDE L  ++
Sbjct: 131 ICDCVKDDELLENKK 145

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 69/134 (51%), Gaps = 7/134 (5%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKEL 129
              V K+LT++ YL+  GS   + W + N  +I+ L +F+ ++      G+ IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNL 132

Query: 130 VSLLNDDERLREER 143
             LL DDE L  +R
Sbjct: 133 HELLQDDELLERQR 146

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 79/149 (53%), Gaps = 15/149 (10%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
           F+ S +++  G SST V V+ AT +     +  +L +++A  +Y      EI  +L KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  NDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFR---HENE 113
              G Y +       ++ K+LT++ +LV  GSE C+ W R +  +I++ ++F     E +
Sbjct: 61  --VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKK 118

Query: 114 SGFDEGQIIRVKAKELVSLLNDDERLREE 142
              ++ Q++  K  +L++  N  E +R+E
Sbjct: 119 QMVNQIQLLSCKLCQLLTDSNLLEDMRKE 147

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 74/137 (54%), Gaps = 8/137 (5%)

Query: 15  GYSSTQVLVRDAT-ANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWR-- 71
           G S+TQ+ V+ AT +N+S   +   +++L+  +Y      EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKA 126
                 V K+LT+++YL+  GSE  VLW R +   I+ L+++   N+    + + I+  +
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDKDKSKVKQIKSLS 130

Query: 127 KELVSLLNDDERLREER 143
           +++   L +D+ L + R
Sbjct: 131 EDISKNLKEDDFLEKRR 147

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 64/133 (48%), Gaps = 6/133 (4%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRH--- 72
           S T+  V+ AT  D    +  TL ++++  +Y      EI+ +L KRL+   +   H   
Sbjct: 13  SPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRKTSHKNC 72

Query: 73  --VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKELV 130
             + K+LT++ YL+  GS   V W R N  +I  L   + E       G  I+  A +L+
Sbjct: 73  IFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPEIKSIAADLM 132

Query: 131 SLLNDDERLREER 143
            L+ DD+ L E R
Sbjct: 133 ELIQDDDLLEERR 145

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 80/144 (55%), Gaps = 11/144 (7%)

Query: 8   SAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           S +N ++  S T++ VR AT ++  + +  TL ++++  +Y +    EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGY 63

Query: 67  GKYWRH-----VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI 121
           GK   H     + K+LT++ YL+  GS   + W  EN  + + ++ F   +++  DE   
Sbjct: 64  GKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFE-VSDTIHDEKFA 122

Query: 122 IRVK--AKELVSLLNDDERLREER 143
           I+++  ++ ++ L+N+ E L ++R
Sbjct: 123 IQIRDLSERILELINNRELLEQKR 146

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 68/134 (50%), Gaps = 7/134 (5%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKEL 129
              V K+LT++ YL+  GS   + W + N  +I+ L  F  ++     + + IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNL 132

Query: 130 VSLLNDDERLREER 143
           + LL DD  L ++R
Sbjct: 133 LELLQDDGLLEKQR 146

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 75/139 (53%), Gaps = 15/139 (10%)

Query: 19  TQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLND---KGKYWRH-- 72
           T+  V+ AT ++  T +  TL ++++  +Y      +I+ ++ KRL+      K   H  
Sbjct: 15  TESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSATSSNKKLSHKT 74

Query: 73  ---VAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLRE---FRHENESGFDEGQI--IRV 124
              + K+LT++ YL+  GS   + W R NFY+++ + +   F+ ++ S  D   I  I+V
Sbjct: 75  SVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDNSA-DSKMIGQIKV 133

Query: 125 KAKELVSLLNDDERLREER 143
            A+++ +L+N++  L + R
Sbjct: 134 IAEDMTNLINNENLLEQRR 152

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 62/135 (45%), Gaps = 6/135 (4%)

Query: 15  GYSSTQVLVRDATA-NDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT  N+    S   + ++   +Y      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQIIRVKAKE 128
              H+ K+LT+ +YL+  GSE+ V W +    +++ L++F   NE        IR  +  
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIRSFSLS 130

Query: 129 LVSLLNDDERLREER 143
           L+ L+ +   L + R
Sbjct: 131 LLELMQNPALLEDHR 145

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 77/155 (49%), Gaps = 18/155 (11%)

Query: 5   FVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL 63
           F  S +N++  YS T++ VR AT  +    S  TL ++++  +Y +    EI+ +L K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHEN 112
                  N  G    K    V K+ T++ YL+  GS + + W + N  V++ L +    N
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNN 120

Query: 113 ESGFDEGQIIRVKA----KELVSLLNDDERLREER 143
               DE   I  +A    K+++ L+ND++ L + R
Sbjct: 121 HITDDEDLHILNQAQKITKDIILLINDNKLLEKRR 155

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 67/126 (53%), Gaps = 10/126 (7%)

Query: 8   SAKNMMKGY--SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRLN 64
           S  +  KG+  S T++ VR AT ++    +  TL ++++  +Y      +++ ++ KRL+
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 65  DKGK-----YWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEG 119
              K        HV K+LT++ YL+  GS + + W + + YVI+ L  F  E +S  DE 
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF--EAQSSSDEP 119

Query: 120 QIIRVK 125
            + +++
Sbjct: 120 MVNQIR 125

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT   S  P    LD +   + +  DF+EI+  LD R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R GS++  L  + R   F+ I+ +R
Sbjct: 65  LMIREGSKDVALRYYSRNLEFFDIENIR 92

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 72/163 (44%), Gaps = 30/163 (18%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   Q+ +R AT  DS  P+   LD +     + V   +I+D + KRL D
Sbjct: 20  ARYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV-------RFGSENCVLWCRENF 99
                               G  WR V KSL VL +L+       +       L     F
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLLLNVDPGEQLDDLVEYLLNHYGF 138

Query: 100 YVIKTLREFRHENES-GFD--EGQIIRVKAKELVSLLNDDERL 139
           +    L  ++ +N S G D    ++I++K +E++ L+ND++ L
Sbjct: 139 FKHDILEIYQVQNSSDGKDSKHQEVIQLKCQEIIELINDEKLL 181

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT   S  P    LD +   +    DF+EI+  LD R+ND    W  V K+L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R G ++  L  + R   F+ I+ +R
Sbjct: 65  LMMREGKKDVALRYYSRNLEFFSIENIR 92

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 75/167 (44%), Gaps = 31/167 (18%)

Query: 7   RSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ +R AT  D+  P+   L  + +  Y SV  + + + + KR+ D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWCRENFY--- 100
                              G  WR + K L V++YL+   SE    N V  C EN     
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLENHKQIF 139

Query: 101 ---VIKTLREFRHENESGFDEGQIIRVKAKELVSLLNDDERLREERS 144
              ++    EF ++ +    E  I + K + +++L++D E LREERS
Sbjct: 140 NSNILNYKIEFCNDGKMEVHERGIQK-KCEVIINLVDDPEFLREERS 185

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 2/96 (2%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    +D +   + DS +F EIM  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRFGSENCVLWCRENFYVIKTLREFRHENESGFD 117
            ++R G  +  +    +      LR+  H   S  D
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQLRDVFHSKLSSGD 100

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT   S  P    LD +   +    DF+EI+  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVL--WCRE-NFYVIKTLR 106
            ++R G+++  L  + R   F+ I+ +R
Sbjct: 65  LMIREGAKDVALRYYSRNLEFFDIENIR 92

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 73/168 (43%), Gaps = 31/168 (18%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L  + +  Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWCRENFYVI 102
                               G  WR V K L V+D+L+   SE    N VL C      I
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSCLTTHKHI 138

Query: 103 KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERS 144
            T RE  +      ++G++      IR K ++++  + D   L++ERS
Sbjct: 139 LT-REIPNFKVKFSNDGKMEIHERGIRKKGEDILQYMEDPHFLKKERS 185

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 71/168 (42%), Gaps = 31/168 (18%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT  DS  P+   L  + +  Y+ V  F + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV----RFGSENCVLWCRENFYVI 102
                               G  WR V K L +L+YL+    R    + VL C +    I
Sbjct: 79  HMAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHI 138

Query: 103 KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERS 144
            T    ++  +   D G++      I+ K + ++ L+ D   L+ ERS
Sbjct: 139 LTKETMQYRVDFSSD-GKMELHERGIKKKCEHIIQLIEDTSYLKRERS 185

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 73/167 (43%), Gaps = 31/167 (18%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L  + +  Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVI 102
                               G  WR V K LTV++YL   V  G E N V+ C +    I
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRCLDTHKHI 138

Query: 103 KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREER 143
            T RE         ++G++      IR K ++++  L D   L++ER
Sbjct: 139 LT-REIPMYKVGFSNDGKMEIHERGIRKKGEDILQYLEDPSFLKQER 184

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 71/167 (42%), Gaps = 31/167 (18%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+NM+  Y   QV VR AT  DS  P+   L+ + +  Y  V  + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVI 102
                               G  WR V K LTV++YL   V  G E N V  C      I
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLLLNVSDGDELNQVRSCLTTHKHI 138

Query: 103 KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREER 143
            + RE         ++G++      I+ K + ++ +L D + L+ ER
Sbjct: 139 LS-REVLEYRVKFSNDGKMEVHERGIKKKCEFIIQMLEDSQFLKRER 184

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFR 109
              V K+LT++ YL+  GS   + W + N  +I+ L +F+
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQ 112

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 78/171 (45%), Gaps = 41/171 (23%)

Query: 7   RSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ VR AT  D+  P+   L+ + +  +  V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYL---VRFGSE-----NCVL-----W 94
                              G  WR V K LTV++YL   V  G E     +C+L      
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLLLNVNDGDELNQIKSCLLTHKHIL 139

Query: 95  CRE--NFYVIKTLREFRHENESGFDEGQIIRVKAKELVSLLNDDERLREER 143
            RE  NF +     +F ++ +    E + IR K ++++ +L+D   L++ER
Sbjct: 140 TREVLNFKI-----KFSNDGKMEVHE-RSIRKKGEKILQMLDDSRFLKQER 184

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 51/100 (51%), Gaps = 7/100 (7%)

Query: 17  SSTQVLVRDATANDSRTPSIDTL-DDLAQRSYDSVDFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT  D  + +  TL ++++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFR 109
              V K+LT++ YL+  GS   + W + N  +++ L +F+
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQ 112

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
           {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 50/120 (41%), Gaps = 20/120 (16%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    +D +   S D  DF EI+  L  R++D    W  V KSL V  
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 82  YLVRFGSENCVLWCREN---FYVIKTLREFRHENESGFDEG---------QIIRVKAKEL 129
            L+R G ++  L    N   F+ +  +      N S F  G         Q + V+AKE 
Sbjct: 65  LLIREGEKDITLDYLSNNLDFFNLNGI------NTSKFSSGDVRALERYNQYLLVRAKEF 118

>TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {ON}
           Anc_8.335 YDR153C
          Length = 361

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 73/166 (43%), Gaps = 31/166 (18%)

Query: 7   RSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R A+NM+  Y   Q+ +R AT  D+  P+   L+ + +  Y  V  + + +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRRATNTDAWGPTPKHLEKVLRNRY-QVPLYLLTEYTLKRLVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVIK 103
                              G  WR V K L V+++L   V  G E N V  C      + 
Sbjct: 80  VATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLLLNVADGDELNQVRSCLVTHKHLL 139

Query: 104 TLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREER 143
           + RE      +  ++G++      IR K + ++ LL+D + L++ER
Sbjct: 140 S-REVAQYRVAMSNDGKMEVHERGIRKKCENILQLLDDTQYLKKER 184

>TPHA0A05210 Chr1 complement(1173573..1175471) [1899 bp, 632 aa]
           {ON} Anc_5.84 YGR241C
          Length = 632

 Score = 37.7 bits (86), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 40/96 (41%), Gaps = 2/96 (2%)

Query: 22  LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           LV+ AT      P    ++ +   + D  DF EI+  L  R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKLAPPKDKYIEPILMGTNDPHDFREIVKALHSRVNDSA--WTVVYKSLIVIH 64

Query: 82  YLVRFGSENCVLWCRENFYVIKTLREFRHENESGFD 117
            L+R G  +  +    N      L    H N S  D
Sbjct: 65  VLMREGDRDVAIKYFSNNLNYFGLAGIHHSNFSNGD 100

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 73/170 (42%), Gaps = 35/170 (20%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  DS  P+   L  + +  Y  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVI 102
                               G  WR V K L VL+YL   V  GSE + V+ C      I
Sbjct: 79  HIASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTTHKRI 138

Query: 103 --KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERS 144
             + + +FR +  +   +G++      I+ K ++++  L D   L+ ER+
Sbjct: 139 LSRDVMQFRVDFSA---DGKMEVHERGIKKKCEQILQYLEDPSYLKRERA 185

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT  DS  P+   L  + +  Y  V  + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K L V++YL+
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 68/166 (40%), Gaps = 29/166 (17%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L  + +  Y  V  + + + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLVRFGSENCVL-WCRENFYVIKTL 105
                               G  WR V K LTV+++L+    E   L   R +    K +
Sbjct: 79  HIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLMLNVDEGDELNQIRSSLQTHKHI 138

Query: 106 --REFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREER 143
             RE         ++G++      IR K + +V  + D   L+ ER
Sbjct: 139 LTREVAQYRVKFSNDGKMEVHERGIRKKGETIVQFMEDPHFLKRER 184

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 73/172 (42%), Gaps = 39/172 (22%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  DS  P+   L  + +  Y  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-----NCVLWCREN 98
                               G  WR V K L VL+YL   V  GSE     +C+L     
Sbjct: 79  HIASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCLL--THK 136

Query: 99  FYVIKTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERS 144
             + + + +FR +  +   +G++      I+ K ++++  + D   L+ ER+
Sbjct: 137 HILTRDVMQFRVDFSA---DGKMEVHERGIKKKCEQMIQYIEDPAYLKRERA 185

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 71/167 (42%), Gaps = 31/167 (18%)

Query: 6   VRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT  D+  P+   L  + +  Y  V  + + + + KR+ D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVI 102
                               G  WR V K L V+D+L   V  G E N V  C      I
Sbjct: 79  HIAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSCMLTHKHI 138

Query: 103 KTLR------EFRHENESGFDEGQIIRVKAKELVSLLNDDERLREER 143
            T +       F ++ +    E + IR K++ ++  ++D   LREER
Sbjct: 139 LTSQVASYKIPFSNDGKMEIHE-RGIRKKSELILQYMDDPRFLREER 184

>KNAG0E00610 Chr5 complement(102826..104640) [1815 bp, 604 aa]
          {ON} Anc_5.84 YGR241C
          Length = 604

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 31/72 (43%), Gaps = 2/72 (2%)

Query: 22 LVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
          LV+ AT      P    +D +   +    DF EI+  L  R+ D    W  V KSL V  
Sbjct: 7  LVKGATKIKMAPPKAKYVDPILLGTAQRDDFREIVGALRTRVGDSA--WTVVYKSLLVCH 64

Query: 82 YLVRFGSENCVL 93
           + R G E  VL
Sbjct: 65 LMFREGDEQIVL 76

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ VR A+  D+  P+   L  + +  Y SV  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 73/169 (43%), Gaps = 35/169 (20%)

Query: 7   RSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT  DS  P+   L  + +  Y  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWCRENFYVI- 102
                              G  WR V K L VL+YL   V  GSE + V+ C      I 
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGCLTTHKRIL 139

Query: 103 -KTLREFRHENESGFDEGQI------IRVKAKELVSLLNDDERLREERS 144
            + + +FR +  +   +G++      I+ K ++++  L D   L+ ER+
Sbjct: 140 SRDVMQFRVDFSA---DGKMEVHERGIKKKCEQILQYLEDPSYLKRERA 185

>NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.84
          YGR241C
          Length = 473

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 17 SSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRLNDKGKYWRHVAKS 76
          +S + LV+ AT      P    +D +   + ++++F +I+  L  R+N+    W  + K+
Sbjct: 2  TSYKKLVKGATKIKMAPPKQKYVDPILLGTSNNIEFQQIVSELTSRINN-CNIWSVIYKT 60

Query: 77 LTVLDYLVRFGSENCVL 93
          L V+  ++  G  N  L
Sbjct: 61 LIVVHLMISIGEPNVTL 77

>TDEL0B00320 Chr2 complement(59154..61067) [1914 bp, 637 aa] {ON}
           Anc_8.863 YML088W
          Length = 637

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 23/31 (74%), Gaps = 1/31 (3%)

Query: 178 NDLEKALEESRITAQEDEQRRRELAQYDDED 208
           +DLE+A+EESR+ AQE++Q     A  DDED
Sbjct: 548 DDLERAIEESRL-AQENQQFVESFADEDDED 577

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,970,271
Number of extensions: 1209171
Number of successful extensions: 3828
Number of sequences better than 10.0: 93
Number of HSP's gapped: 3821
Number of HSP's successfully gapped: 122
Length of query: 612
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 496
Effective length of database: 40,180,143
Effective search space: 19929350928
Effective search space used: 19929350928
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)