Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.2637.344ON31831816870.0
YLR205C (HMX1)7.344ON31731815840.0
Skud_12.2687.344ON31831815630.0
Suva_10.2997.344ON32032015190.0
TDEL0C020307.344ON3113069881e-134
KLLA0D12474g7.344ON3123079861e-134
ZYRO0F11594g7.344ON3092719501e-128
SAKL0F11242g7.344ON3093069441e-127
Kwal_56.246247.344ON3073049141e-123
KLTH0H01386g7.344ON3073069001e-121
Ecym_47297.344ON3263218561e-114
NCAS0E028907.344ON3153148501e-113
NDAI0E045007.344ON3273327981e-105
Kpol_530.367.344ON3112977392e-96
TPHA0F029207.344ON3202897322e-95
CAGL0A03905g7.344ON2822637005e-91
ACL154W7.344ON3192766897e-89
KAFR0L014707.344ON3003126401e-81
KNAG0B026407.344ON3022815782e-72
KLLA0D19492g2.20ON49680721.5
Suva_6.518.67ON76349703.4
Smik_16.1798.517ON151131694.9
Skud_16.2258.517ON151131695.0
YPL058C (PDR12)8.517ON151131695.0
TDEL0D012101.256ON77257685.2
NDAI0G057501.319ON734218669.8
KAFR0E028208.470ON562756610.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.263
         (318 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   654   0.0  
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   614   0.0  
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   606   0.0  
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   589   0.0  
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   385   e-134
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   384   e-134
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   370   e-128
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   368   e-127
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   356   e-123
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   351   e-121
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   334   e-114
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   332   e-113
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   311   e-105
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   289   2e-96
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   286   2e-95
CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   274   5e-91
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   270   7e-89
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   251   1e-81
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   227   2e-72
KLLA0D19492g Chr4 (1643703..1645193) [1491 bp, 496 aa] {ON} simi...    32   1.5  
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    32   3.4  
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    31   4.9  
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    31   5.0  
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    31   5.0  
TDEL0D01210 Chr4 complement(225620..227938) [2319 bp, 772 aa] {O...    31   5.2  
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...    30   9.8  
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    30   10.0 

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/318 (100%), Positives = 318/318 (100%)

Query: 1   MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY
Sbjct: 1   MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60

Query: 61  VFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120
           VFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL
Sbjct: 61  VFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120

Query: 121 NEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180
           NEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF
Sbjct: 121 NEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180

Query: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240
           PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA
Sbjct: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240

Query: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSI 300
           EGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSI
Sbjct: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSI 300

Query: 301 IAIWTLYFLVKKSFLSIV 318
           IAIWTLYFLVKKSFLSIV
Sbjct: 301 IAIWTLYFLVKKSFLSIV 318

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/318 (92%), Positives = 309/318 (97%), Gaps = 1/318 (0%)

Query: 1   MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           MEDS+N IIPSPTD+GALANRINF TRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY
Sbjct: 1   MEDSSNTIIPSPTDVGALANRINFQTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60

Query: 61  VFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120
           VFDAIEQEIDRLLNDPVT +ELQTS ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL
Sbjct: 61  VFDAIEQEIDRLLNDPVTEEELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120

Query: 121 NEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180
           NEFLATF+KPP+LQQF+NNIHENI KEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF
Sbjct: 121 NEFLATFQKPPLLQQFINNIHENIHKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180

Query: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240
           PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLK EYKKNYELATRTELTEAQKLQIISVA
Sbjct: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKWEYKKNYELATRTELTEAQKLQIISVA 240

Query: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSI 300
           EGIFDWNFNIVAEIGELNRRELMGKFSFKC+TY+YEEWMFNK+SATR++ +TV+LL+LSI
Sbjct: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCITYLYEEWMFNKDSATRRALHTVMLLVLSI 300

Query: 301 IAIWTLYFLVKKSFLSIV 318
           IAIW LYFLV KSFLSIV
Sbjct: 301 IAIWVLYFLV-KSFLSIV 317

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/318 (91%), Positives = 306/318 (96%)

Query: 1   MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           MEDS N IIPSPTD+GALANRINFHTRDAHNKINTFMGI+MAIAMRHGFIYRQGILAYYY
Sbjct: 1   MEDSTNTIIPSPTDVGALANRINFHTRDAHNKINTFMGIRMAIAMRHGFIYRQGILAYYY 60

Query: 61  VFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120
           VFDAIEQEIDRLL+DPVT KELQTS ILKQFWLEDFRRSTQIYKDLKLLYSN FKSTESL
Sbjct: 61  VFDAIEQEIDRLLHDPVTEKELQTSTILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESL 120

Query: 121 NEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180
           NEFLA FEKPP+LQQFVN+IHENI+KEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF
Sbjct: 121 NEFLAKFEKPPLLQQFVNDIHENIRKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180

Query: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240
           PNFE+LSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA
Sbjct: 181 PNFERLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240

Query: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSI 300
            GIFDWNF+IVAEIGELNRRELMGKFSFKCVTYVYEEWM +K+SA RK+FNT +LL+LSI
Sbjct: 241 GGIFDWNFHIVAEIGELNRRELMGKFSFKCVTYVYEEWMSDKDSAFRKAFNTAMLLMLSI 300

Query: 301 IAIWTLYFLVKKSFLSIV 318
           IA+W +Y LVKK+FLSIV
Sbjct: 301 IAVWVIYLLVKKNFLSIV 318

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/320 (87%), Positives = 304/320 (95%), Gaps = 2/320 (0%)

Query: 1   MEDSNNK--IIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAY 58
           MEDS +   IIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAY
Sbjct: 1   MEDSTSTSTIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAY 60

Query: 59  YYVFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE 118
           YYVFDAIEQEIDRLLND V+ KELQ   ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE
Sbjct: 61  YYVFDAIEQEIDRLLNDAVSEKELQACGILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE 120

Query: 119 SLNEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLG 178
           SLNEFLATFEKPP+LQQFV++IH+NI++EPCTILSYCHVLYLALFAGGKLIRSNLYRRLG
Sbjct: 121 SLNEFLATFEKPPLLQQFVDDIHDNIRQEPCTILSYCHVLYLALFAGGKLIRSNLYRRLG 180

Query: 179 LFPNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIIS 238
           LFPNFEKL+QKELVKKGTNFFTFS+LGPTEETRLK EYKKNYELATRTELTEAQKL+IIS
Sbjct: 181 LFPNFEKLTQKELVKKGTNFFTFSELGPTEETRLKWEYKKNYELATRTELTEAQKLKIIS 240

Query: 239 VAEGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLIL 298
           VAEGIFDWNFNIVAEIGELNRRELM KFSFKCVTYVYEEWMF+K SA+RK+F+T +LL+L
Sbjct: 241 VAEGIFDWNFNIVAEIGELNRRELMSKFSFKCVTYVYEEWMFSKGSASRKAFSTTMLLML 300

Query: 299 SIIAIWTLYFLVKKSFLSIV 318
           SI A+W LY+ V+++FLS+V
Sbjct: 301 SITAVWILYYFVRQNFLSVV 320

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  385 bits (988), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 174/306 (56%), Positives = 235/306 (76%), Gaps = 2/306 (0%)

Query: 7   KIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIE 66
           K IP+PTD+GALANRINFHTRDAHNK+N +M +++A A++HGFIYRQGILA+Y++FDA+E
Sbjct: 6   KTIPAPTDVGALANRINFHTRDAHNKVNAYMSVRLAFALKHGFIYRQGILAFYHIFDAVE 65

Query: 67  QEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLAT 126
           QE+DRLLNDP   +E Q   +L+QFWLE+FRR+ +I+KDL++LYS  +  +ESL  F+  
Sbjct: 66  QELDRLLNDPQNDEERQMQHVLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEH 125

Query: 127 FEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKL 186
               P LQ FV++IH  +Q++ CTIL+YCHVLYLALFAGGK++RSNLYR  GLFP FE L
Sbjct: 126 QPLAPQLQSFVDSIHSTVQQDSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYL 185

Query: 187 SQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDW 246
           + KELV +GTNFFTFSD G   E +L+ +YK+ YELATR EL+E+QK +I+ V+  IFDW
Sbjct: 186 TPKELVIRGTNFFTFSDEGSDAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDW 245

Query: 247 NFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSIIAIWTL 306
           N +++ EIGE+NR ELM KFSFK +TY+ EEW ++   + R   + +++ IL  I     
Sbjct: 246 NMDVIGEIGEMNRNELMSKFSFKLLTYLSEEWKYSTILSKRSKDSIIVMAIL--IQFLVA 303

Query: 307 YFLVKK 312
           Y +++K
Sbjct: 304 YIVLRK 309

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  384 bits (986), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 180/307 (58%), Positives = 236/307 (76%), Gaps = 1/307 (0%)

Query: 1   MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           M   +   IPSPTD+GALANRINF TRD HNKIN +M +KMA AMRHGFIYRQGI+AYYY
Sbjct: 1   MSVEHATTIPSPTDVGALANRINFQTRDMHNKINAYMSMKMAFAMRHGFIYRQGIVAYYY 60

Query: 61  VFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120
           VF AIEQEIDRLL  PVT ++ +   IL+QFW E+FRRS ++  DL++LY++ +  +E L
Sbjct: 61  VFHAIEQEIDRLLEHPVTVQDEKVKGILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQL 120

Query: 121 NEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF 180
            EFL  F+ P  LQ+FV+ IH N+QKEP TIL+YCHVLYLALFAGG++++SNLYR +GLF
Sbjct: 121 QEFLDGFQLPAKLQEFVDEIHSNVQKEPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLF 180

Query: 181 PNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVA 240
           P F  LS KELV++ TNFFTFS+ G  +E RL+ +YKK YELATRTELTEA+KL+II V+
Sbjct: 181 PKFGHLSPKELVRRATNFFTFSEEGVDDENRLRWQYKKGYELATRTELTEAEKLRIIEVS 240

Query: 241 EGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFN-KESATRKSFNTVLLLILS 299
           + IF  N  +VAEIGE+NR ELMGKFS+K ++++ EEW ++ K +   K      L++ +
Sbjct: 241 QTIFQRNMEVVAEIGEINRAELMGKFSYKLISFLSEEWKYSEKLTPEVKKLIVFALIVFN 300

Query: 300 IIAIWTL 306
           ++ ++T+
Sbjct: 301 MVFVYTI 307

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  370 bits (950), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 166/271 (61%), Positives = 216/271 (79%), Gaps = 1/271 (0%)

Query: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           IP+PTD+GALANRINFHTRDAHNKIN +M +++A A++HG+I+RQGILAYYY+F AIEQE
Sbjct: 4   IPAPTDVGALANRINFHTRDAHNKINAYMSVRLAFALKHGWIFRQGILAYYYIFQAIEQE 63

Query: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 128
           +DR+++     KE+Q   +L +FW+ DFRR+ +I++DL LLYS  F +  SL +FL +  
Sbjct: 64  LDRIMDHARNEKEMQMQNVLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGN 123

Query: 129 K-PPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLS 187
              P LQ FV++IH+N+Q+EPCTIL+YCHVLYLALFAGGK++RSNLYR  GLFP F+ LS
Sbjct: 124 HLAPTLQAFVDSIHKNVQEEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLS 183

Query: 188 QKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWN 247
            +ELV++GTNFFTFS+ G   E +L+  YK+ YELATR ELTE QK +IISV+  IF WN
Sbjct: 184 PRELVQRGTNFFTFSEEGSEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWN 243

Query: 248 FNIVAEIGELNRRELMGKFSFKCVTYVYEEW 278
              +AEIGELNR+ELMG  SF+ +TY++EEW
Sbjct: 244 METIAEIGELNRQELMGSVSFRLLTYLHEEW 274

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  368 bits (944), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 173/306 (56%), Positives = 230/306 (75%), Gaps = 2/306 (0%)

Query: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           IPSPTD+GALANRINFHTRD+HNKIN  M +K+A AM+HG IYRQGILA+YY+F A+EQE
Sbjct: 6   IPSPTDVGALANRINFHTRDSHNKINADMSVKLAFAMKHGHIYRQGILAFYYIFAAVEQE 65

Query: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 128
           ID LL +  T  ELQT  IL QFW E+FRRS  I++DL+LLYS  + +   L+ FL    
Sbjct: 66  IDNLLQNASTPLELQTQKILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDDNV 125

Query: 129 KPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQ 188
            PP  Q FV  IH+ ++++P TIL+YCHVLYLALFAGGKL++SN+YR  GLFP F+ L+ 
Sbjct: 126 LPPQQQAFVEYIHQTVREKPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHLTP 185

Query: 189 KELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWNF 248
           +++V++GTNFFTFS+ G   E +L+ EYKK YELATR ELTE QK +II V+  IFDWN 
Sbjct: 186 EQIVRRGTNFFTFSEEGADAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDWNM 245

Query: 249 NIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSIIAIWTLYF 308
           +++ E+GE+NR ELMGKFSFK V+++ EEW ++++ +  K     +L+I +I+     Y+
Sbjct: 246 DVIGELGEINRNELMGKFSFKLVSFILEEWKYSEKLS--KENKITILVIFAILQFLLAYW 303

Query: 309 LVKKSF 314
           L++K F
Sbjct: 304 LLRKLF 309

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  356 bits (914), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 168/304 (55%), Positives = 226/304 (74%), Gaps = 2/304 (0%)

Query: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           IPSPTD+GALANRINF+TRD HNKI+  M +K A AM+HGFIYRQG+LA++YVF AIEQE
Sbjct: 4   IPSPTDVGALANRINFYTRDEHNKIDKQMSVKFAFAMKHGFIYRQGLLAFFYVFQAIEQE 63

Query: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 128
           IDRLL +  T +E+QT  IL QFW+  F R+ +IY+DLKLLY+  F S E L+ FL    
Sbjct: 64  IDRLLQNAQTAEEVQTRDILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQQNT 123

Query: 129 KPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQ 188
            PP  Q FV+ +HE+++  P +IL++CHVLYLALFAGG+++RS +YR  GLFP F  L+ 
Sbjct: 124 LPPEQQGFVDFVHESVRARPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPDLTP 183

Query: 189 KELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWNF 248
           +E+V+KGTNFFTFSD G   E +L+ EYK+ YELATR  LTE QKL I+ VA   F+WN 
Sbjct: 184 EEVVRKGTNFFTFSDDGVQAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEWNT 243

Query: 249 NIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSIIAIWTLYF 308
            +++EIGE+NR+ELMGK SFK V++  +EW  + E  TR+   +++L   ++I I  +Y+
Sbjct: 244 RVISEIGEINRQELMGKLSFKLVSFAIDEWK-HTEKLTRRQ-KSIVLATGAVIQILVMYW 301

Query: 309 LVKK 312
           +++K
Sbjct: 302 MLRK 305

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  351 bits (900), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 167/306 (54%), Positives = 223/306 (72%), Gaps = 2/306 (0%)

Query: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           IPSPTD+GALANRINFHTRD HNKI+  M  K A AM+HGFIYRQG+LA++YVF AIEQE
Sbjct: 4   IPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQE 63

Query: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 128
           +DRL  +  T +E QT  IL QFW E+FRR+ +I +DL+LLY+  F ++ SL  FL    
Sbjct: 64  LDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEETT 123

Query: 129 KPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQ 188
             P LQ FV+ +H +I+  P  IL+YCHVLYLALFAGG+++RS +YR  GLFP F  L+ 
Sbjct: 124 LAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLTT 183

Query: 189 KELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWNF 248
           +E+V++GTNFFTFSD G   E +L+  YK+ YELATR  LTE QKL I+ V+  IF+WN 
Sbjct: 184 EEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNT 243

Query: 249 NIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSIIAIWTLYF 308
            +V EIGE+NR+ELMGK SF+ +T+V EEW ++ +  TRK   +++L    ++ I  +Y+
Sbjct: 244 RVVTEIGEINRQELMGKLSFRLLTFVIEEWQYS-DKLTRKQ-KSLVLATGVVLQILMMYW 301

Query: 309 LVKKSF 314
           +++K F
Sbjct: 302 VLRKFF 307

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  334 bits (856), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 167/321 (52%), Positives = 223/321 (69%), Gaps = 9/321 (2%)

Query: 1   MEDSNNKI-------IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQ 53
           M DS+++I       IPSPTD+GALANRINF TRD H K + F+  KMA+AMRHGFIYRQ
Sbjct: 7   MNDSDSEIHSPAVGMIPSPTDVGALANRINFCTRDMHTKADAFVMGKMALAMRHGFIYRQ 66

Query: 54  GILAYYYVFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNT 113
           GILA+YY+F A+EQ+IDRLL  P T +ELQ SAIL+QFW E+FRRS ++ +DL+  Y + 
Sbjct: 67  GILAFYYIFHAVEQQIDRLLETPSTKEELQISAILRQFWCEEFRRSGRLLRDLEFFYHHE 126

Query: 114 FKSTESLNEFLATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNL 173
           + +   L +FL  FE PP LQ+FV+ I +   + P TIL+YCHVLY ALFAGGK++RSN+
Sbjct: 127 YPTQNELQQFLNDFELPPKLQRFVDFIRDKTMENPSTILAYCHVLYNALFAGGKVMRSNI 186

Query: 174 YRRLGLFPNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQK 233
           YR +GLFP  + +S  E  + GTNFFTFSD G  EE +L+ +YKKNYELATR  L E QK
Sbjct: 187 YRNIGLFPKPKGISAAESSRNGTNFFTFSDDGVDEENKLRWQYKKNYELATREGLDENQK 246

Query: 234 LQIISVAEGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTV 293
           L+II V+   F    +I+ EIGE N++ELM  FSFK +T++  EW +N++ ++       
Sbjct: 247 LEIIDVSIANFQAVMDILGEIGETNKKELMNIFSFKLLTFLSNEWRYNQKLSS--EVKQA 304

Query: 294 LLLILSIIAIWTLYFLVKKSF 314
           L + +  I    +YF ++  F
Sbjct: 305 LAIAVFFINFLMIYFTLRTIF 325

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  332 bits (850), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 218/314 (69%), Gaps = 3/314 (0%)

Query: 1   MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           M    N IIPSPTD  ALANRINF TRDAHNKIN  M IK+AIA+RHGFIYRQGIL YYY
Sbjct: 1   MSSHTNTIIPSPTDTKALANRINFQTRDAHNKINKKMSIKLAIALRHGFIYRQGILTYYY 60

Query: 61  VFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESL 120
           +F  +E+EI +L   P T +E++   +L + W+ +F R+  + KDL+LLY + + + E+L
Sbjct: 61  IFKVVEEEIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEAL 120

Query: 121 NEFLAT--FEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLG 178
             FL T   E PPVL  F+  IH++I + PC+I +YCHVLYLALFAGGK+IRS +Y+ LG
Sbjct: 121 QLFLETNATELPPVLDSFIKYIHQSILENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLG 180

Query: 179 LFPNFEKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIIS 238
             PNF  LS KE+ +KGTNFF F   G  EET+LKLE+KKNYEL TR  L E +K  II 
Sbjct: 181 FLPNFNHLSSKEVFEKGTNFFKFGSDGVIEETKLKLEFKKNYELNTRESLNEKEKSIIIE 240

Query: 239 VAEGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLIL 298
            ++ IFD+N   + E+G +N+ +LM K +FK VTY+ EEW FN    +++    ++++++
Sbjct: 241 TSKKIFDYNLMAMEELGSINKEQLMSKLNFKMVTYLLEEWKFNDNFLSKRG-KHLIMVVM 299

Query: 299 SIIAIWTLYFLVKK 312
            ++ +   +F++K+
Sbjct: 300 VLLHMLFAFFILKR 313

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  311 bits (798), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 220/332 (66%), Gaps = 21/332 (6%)

Query: 1   MEDSNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYY 60
           M  S   IIPSPTD  ALANRINFHTRDAHNKI+  M +K+A+A+RHG IYRQGIL YYY
Sbjct: 1   MSSSTVTIIPSPTDTEALANRINFHTRDAHNKIDKKMTLKLAVALRHGDIYRQGILTYYY 60

Query: 61  VFDAIEQEIDRLL--NDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE 118
           +F A+E EI+ LL  N   T ++ +T ++L + WL +F R+ +++KDLKLLYS+ F++ +
Sbjct: 61  IFQAVESEINYLLSFNTDATKEQKRTGSLLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQ 120

Query: 119 SLNEF------LATFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSN 172
            L  F      L    K   L QFVN IH +IQ  PC IL+YCHVLYLALFAGGK+I+S 
Sbjct: 121 DLLNFINEEFKLIHQNKNSKLYQFVNFIHISIQTNPCCILAYCHVLYLALFAGGKIIKSK 180

Query: 173 LYRRLGLFPNFEKLSQKELVKKGTNFFTFSDLGP--------TEETRLKLEYKKNYELAT 224
           +Y+ LG  PNF  LS KEL    TNFF F++           + E +LKL++K+N+EL T
Sbjct: 181 IYKNLGFLPNFNHLSSKELFNNATNFFQFTENSDSLEGINSISNENKLKLKFKRNFELNT 240

Query: 225 RTELTEAQKLQIISVAEGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKES 284
           R+ L E +KL II +A+ IF WN   + E+G+ N++ELM  FSFK + Y++EEW FN   
Sbjct: 241 RSNLNENEKLTIIEIAKQIFQWNLESMEELGQRNQKELMNLFSFKLINYLFEEWKFN--D 298

Query: 285 ATRKSFNTVLLLILSIIAIWTLYFLVKKSFLS 316
           + +K+F  +L+ ++ ++ I    F V +S  +
Sbjct: 299 SIKKNFKAILMFVILLLLIQ---FFVSRSLFT 327

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  289 bits (739), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 205/297 (69%), Gaps = 11/297 (3%)

Query: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           IPSPTD+GALANRINF TRD HNK++ FMGI++A+A++HGFIYR+G++ +Y++F+ IE E
Sbjct: 5   IPSPTDVGALANRINFETRDFHNKVSAFMGIRLALALKHGFIYREGLVVFYHIFNTIETE 64

Query: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTE-SLNEFLAT- 126
           ID +LN+     + Q   IL  F+L++FRR  +I KDL+LLY   F++    L EF+ + 
Sbjct: 65  IDLVLNN---QDDSQMKLILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINSD 121

Query: 127 --FEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE 184
                   LQ FV  I  N  ++PCT+L+YCHVLYLALFAGGK+++SN+ + LG+FP FE
Sbjct: 122 RFTNDSEQLQNFVKYIQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPKFE 181

Query: 185 KLSQKELVKKGTNFFTFSDLGPTEETRLKLE--YKKNYELATRTELTEAQKLQIISVAEG 242
            LS KE++ +GTNF+ F+D    E T +KL   YKKNYEL+TR EL E QKL +I  ++ 
Sbjct: 182 HLSHKEIIARGTNFYQFTDSTNPETTDVKLRWLYKKNYELSTRDELLEQQKLTVIKTSKD 241

Query: 243 IFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESAT--RKSFNTVLLLI 297
           +F    N +AE+G  NR ELM  FS+K  T++ EEW +N   +   +KS   +L++I
Sbjct: 242 VFVMLENCIAEVGTRNRNELMNIFSYKLFTFIVEEWKYNSSISPFLKKSLMFILIII 298

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  286 bits (732), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 144/289 (49%), Positives = 203/289 (70%), Gaps = 9/289 (3%)

Query: 4   SNNKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFD 63
           SN KIIPSPTD+ ALANRINF TRD HNKI  FM I++A+A+RHGFIYRQG++A+Y++F 
Sbjct: 2   SNVKIIPSPTDVKALANRINFETRDFHNKIGAFMSIRLALALRHGFIYRQGLVAFYHIFG 61

Query: 64  AIEQEIDRLLN---DPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKST-ES 119
            IE EID LLN     +   ++QT  ILK F++ +FRR   + +DL +LY   FK   + 
Sbjct: 62  TIENEIDNLLNTLDSELDSVQIQTKKILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQD 121

Query: 120 LNEFL--ATFEKP--PVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYR 175
           + +FL   TF K   P L  F + I +  +++P TI++YCHVLYLALFAGGK+++SN+ +
Sbjct: 122 VLDFLNSETFNKENYPELNFFTDYIKDTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLK 181

Query: 176 RLGLFPNFEKLSQKELVKKGTNFFTFSDLGPTE-ETRLKLEYKKNYELATRTELTEAQKL 234
            +GLFP F+ +S +E+  +G+NFF F+     + +++L+ EYKKNYEL+TR EL E QK 
Sbjct: 182 NVGLFPKFDHMSHEEVTNQGSNFFRFTQEDTADFDSKLRFEYKKNYELSTRDELNEMQKN 241

Query: 235 QIISVAEGIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKE 283
            II V++ IF    N++AEIG  NR +LMG F+ K +TY+ EEW +N++
Sbjct: 242 DIIEVSKNIFVMLENVIAEIGAKNRTKLMGGFTLKTITYLVEEWKYNEK 290

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  274 bits (700), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 183/263 (69%), Gaps = 12/263 (4%)

Query: 37  MGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLN-DPVTG---------KELQTSA 86
           M ++ A+A+RHG +YRQGILA+YYVF AIEQEID LL+ D  TG         ++L  S 
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 87  ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPVLQQFVNNIHENIQK 146
           I+KQFW+ +FRR+ Q+YKDL LLYS  + ++  L+  L   + PP LQ FV+ +H  +++
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 147 EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQKELVKKGTNFFTFSDLGP 206
            P T+L+YCHV+YLALFAGGK++RS LYR  GLFP FE LS KEL +KGTNFFTFSD G 
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180

Query: 207 TEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWNFNIVAEIGELNRRELMGKF 266
             E +LK +YKKNYELATR  L E  KL+II VA+ IF+ N +I+ EIG+LN+  L    
Sbjct: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239

Query: 267 SFKCVTYVYEEWMF-NKESATRK 288
               + YV+EE  F NK+ + ++
Sbjct: 240 KLDLLQYVFEELKFYNKDRSHQQ 262

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  270 bits (689), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 126/276 (45%), Positives = 185/276 (67%), Gaps = 1/276 (0%)

Query: 6   NKIIPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAI 65
           + ++P PTD GALANRINFHTR+ H+K + F+  K A+A+RH  IYRQG+LA YY+F ++
Sbjct: 15  SPVVPLPTDTGALANRINFHTRELHSKADAFVSAKFAVALRHPSIYRQGLLAMYYIFRSV 74

Query: 66  EQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLA 125
           EQ IDRLL  P T  E +   IL+ FW  +F R+  + +D ++ Y+  + ++  L++FL 
Sbjct: 75  EQHIDRLLRAPATADEARIGEILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLD 134

Query: 126 TFEKPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEK 185
           ++E PP L   V +I     ++P TIL++CHVLYLALFAGG+++RS L R+LGL P    
Sbjct: 135 SYELPPRLAAAVADIEAAALRQPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAG 194

Query: 186 LSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFD 245
           LS +E   +GT+FFTF   G  EE + ++ YK+ YELATRT L+EA+K  +I  A   FD
Sbjct: 195 LSARETQLRGTHFFTFG-AGAGEENKARVAYKRAYELATRTALSEAEKADVIDAARADFD 253

Query: 246 WNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFN 281
               ++AE+   NR+EL+G  S++ +T++ EEW + 
Sbjct: 254 HIQAVMAELAVRNRQELLGSPSYRLLTFLGEEWRYR 289

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  251 bits (640), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 134/312 (42%), Positives = 196/312 (62%), Gaps = 18/312 (5%)

Query: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           +PSPTD  ALANRINFHTRD HN I+  M IK   A+RH FIY+  +L+YYYVF  +E E
Sbjct: 5   VPSPTDTDALANRINFHTRDLHNVIDKTMSIKATFALRHSFIYKDILLSYYYVFRTLEDE 64

Query: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 128
           ID +    ++        IL+ F+ + FRR  QI KDLK L  N  +  +S +++L++  
Sbjct: 65  IDFI----ISNDRSHIGEILRGFFNDKFRRKDQILKDLKFL--NVIQD-QSDDQWLSS-- 115

Query: 129 KPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLF--PNFEKL 186
             P L +F+N I  N+ + P  +L+YCHVLYLALFAGG+++R+++ + L  F  P F+K+
Sbjct: 116 -RPELCKFLNFIKSNLHEHPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKM 174

Query: 187 SQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDW 246
           S  +++   TNFF F D     E +LK EYK+NY++ T+ +L E +KL+II ++  IF +
Sbjct: 175 SHTDVIMNATNFFKF-DKDIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKF 233

Query: 247 NFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNKESATRKSFNTVLLLILSIIAIWTL 306
           NFN++ EIG +N+ ELM  F++K VTYV EEW F K    +      ++L L I  ++  
Sbjct: 234 NFNLLQEIGTVNKDELMKNFNYKMVTYVVEEWKFRKPQIKK-----YVILFLIIFHLFVF 288

Query: 307 YFLVKKSFLSIV 318
             L KK +L  +
Sbjct: 289 INLFKKFYLQAI 300

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  227 bits (578), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 171/281 (60%), Gaps = 18/281 (6%)

Query: 9   IPSPTDIGALANRINFHTRDAHNKINTFMGIKMAIAMRHGFIYRQGILAYYYVFDAIEQE 68
           IPSPTD  ALANRINFHTRD HN+++    +K  +A+RH FIY   +  +Y VF  +EQ 
Sbjct: 5   IPSPTDTDALANRINFHTRDLHNEVDKAFSVKFMMALRHSFIYTDILKTFYTVFGTVEQR 64

Query: 69  IDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFE 128
           ID L+     G +    AIL +F++ +FRR+ +I +DL  L    + + ES       + 
Sbjct: 65  IDELIAS--EGGD-GVGAILGEFYVPEFRRADKIKRDLVFL--GEWDTVES-----GQWT 114

Query: 129 KPPVLQQFVNNIHENIQKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNF----- 183
            PP L  F+  +   + ++P T+L+ CHVLYLALFAGG++ +S+L++ LG  PNF     
Sbjct: 115 PPPQLAGFLQYLRSEMDRDPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKNG 174

Query: 184 --EKLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYELATRTELTEAQKLQIISVAE 241
             E++S   LV   TNFF F++    +E +L+  YK+NYELATR  LTE QKL +I+ + 
Sbjct: 175 PGEEMSDHTLVSNATNFFQFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASR 233

Query: 242 GIFDWNFNIVAEIGELNRRELMGKFSFKCVTYVYEEWMFNK 282
            +F   F ++ EI + N  ELM   SFK VTY  EEW FNK
Sbjct: 234 DVFRHTFAVIEEICQQNHDELMSFRSFKIVTYFLEEWKFNK 274

>KLLA0D19492g Chr4 (1643703..1645193) [1491 bp, 496 aa] {ON} similar
           to uniprot|Q07729 Saccharomyces cerevisiae YDL238C GUD1
           Guanine deaminase a catabolic enzyme of the guanine
           salvage pathway producing xanthine and ammonia from
           guanine activity is low in exponentially-growing
           cultures but expression is increased in post-diauxic and
           stationary-phase cultures
          Length = 496

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 12/80 (15%)

Query: 145 QKEPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQK--ELVKKGTNFFTF- 201
           +KE C  LS   VLYLA   G K++  NL  ++G F   ++   +  +L  KG+N   F 
Sbjct: 391 RKEECK-LSVAEVLYLATMGGAKVL--NLSDKIGSFDVGKEFDAQLIDLSTKGSNVSIFP 447

Query: 202 ------SDLGPTEETRLKLE 215
                   + P  + R+KLE
Sbjct: 448 WQKVTNDKIQPNGKDRIKLE 467

>Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)
          Length = 763

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 88  LKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEF-LATFEKPPVLQQ 135
           + Q W +  ++ST ++K  KLL S  F S+ES N F L   EK P L Q
Sbjct: 285 VSQSWNKVIKKSTSLWK--KLLVSENFVSSESFNSFNLKLSEKYPKLPQ 331

>Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] {ON}
            YPL058C (REAL)
          Length = 1511

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 183  FEKLSQKELVKKGTNFFTFSDLGPTEETRLK 213
            FE+  +  L+KKG     F D+GP  ET LK
Sbjct: 1048 FEQFDRLLLLKKGGKMVYFGDIGPNSETLLK 1078

>Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] {ON}
            YPL058C (REAL)
          Length = 1511

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 183  FEKLSQKELVKKGTNFFTFSDLGPTEETRLK 213
            FE+  +  L+KKG     F D+GP  ET LK
Sbjct: 1048 FEQFDRLLLLKKGGKMVYFGDIGPNSETLLK 1078

>YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}
            PDR12Plasma membrane ATP-binding cassette (ABC)
            transporter, weak-acid-inducible multidrug transporter
            required for weak organic acid resistance; induced by
            sorbate and benzoate and regulated by War1p; mutants
            exhibit sorbate hypersensitivity
          Length = 1511

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 183  FEKLSQKELVKKGTNFFTFSDLGPTEETRLK 213
            FE+  +  L+KKG     F D+GP  ET LK
Sbjct: 1048 FEQFDRLLLLKKGGKMVYFGDIGPNSETLLK 1078

>TDEL0D01210 Chr4 complement(225620..227938) [2319 bp, 772 aa] {ON}
           Anc_1.256 YJL105W
          Length = 772

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 99  STQIYKDLKLLYSNTFKSTESLNEFLATFEK-PPVLQQFVNNIHENIQKEPCTILSY 154
           S  +YK +K   +N +K  E LN++     + PP+L +    + EN ++ P  +  Y
Sbjct: 558 SQSLYKTVKSKMNNRYKLNEILNQYQGKKRRQPPILSRMAKEVLENEERAPKVLADY 614

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 92/218 (42%), Gaps = 42/218 (19%)

Query: 80  KELQTSAILKQFWLE------DFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPVL 133
           K+LQ +  L+  +LE      D  R+    KDLKL+          L   L  F+ P  +
Sbjct: 254 KQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKLILD------VDLEYRLVNFQGPFTI 307

Query: 134 QQFVNNIHENIQKEP-CTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFE-------- 184
             F N ++    KE  C  ++  + L +  F  G +  + L+R L L  +++        
Sbjct: 308 SPFPNELYSATAKESQCMKINENNELLIMTFDDGSV--ALLFRDLELTMSWDIANYIHDN 365

Query: 185 KLSQKELVKKGTNFFTFSDLGPTEETRLKLEYKKNYE----LATRTELTEAQKLQIISVA 240
             +  EL+K          L PT+  RL + Y+ N+     L+    +          +A
Sbjct: 366 SFALVELIK----------LKPTDIGRLII-YQDNFGKFFLLSDDVIMLVHTNSWSDKLA 414

Query: 241 EGIFDWNFNIVAEIG---ELNRRELMGKFSFKCVTYVY 275
           + I D N NI++EIG   E+   ++MGKF+  C    Y
Sbjct: 415 KAIDDSNLNILSEIGFESEITWFDVMGKFN-NCTPCKY 451

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 30.0 bits (66), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%)

Query: 58  YYYVFDAIEQEIDRLLNDPVTGKELQTSAILKQFWLEDFRRSTQIYKDLKLLYSNTFKST 117
           + +V+D+++Q+ D L+N    G  +  +AI       +++ +   YK   +L  N  K +
Sbjct: 221 FQHVWDSLQQDQDELINTRKYGTRIHENAIYNFATENEYKDNVNAYKIGCILMENGAKLS 280

Query: 118 ESLNEFLATFEKPPV 132
           E+   F A  ++ P 
Sbjct: 281 EAAMAFEAAVQQNPT 295

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,775,185
Number of extensions: 1468587
Number of successful extensions: 4583
Number of sequences better than 10.0: 39
Number of HSP's gapped: 4689
Number of HSP's successfully gapped: 39
Length of query: 318
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 209
Effective length of database: 40,982,805
Effective search space: 8565406245
Effective search space used: 8565406245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 66 (30.0 bits)