Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.2627.345ON111803172e-38
YLR204W (QRI5)7.345ON111802261e-24
Skud_12.2677.345ON110802251e-24
Suva_10.2987.345ON112812154e-23
NOTE: 13 genes in the same pillar as Smik_12.262 were not hit in these BLAST results
LIST: Kpol_2001.72 Zrou_YGOB_Anc_7.345 KAFR0L01475 CAGL0A03883g KLTH0H01364g Kwal_56.24628 ACL153C Ecym_4728 TPHA0D04575 KLLA0D12452g KNAG0B02635 NDAI0E04490 SAKL0F11264g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.262
         (111 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.262 Chr12 (499287..499622) [336 bp, 111 aa] {ON} YLR204W...   126   2e-38
YLR204W Chr12 (552270..552605) [336 bp, 111 aa] {ON}  QRI5Mitoch...    92   1e-24
Skud_12.267 Chr12 (498907..499239) [333 bp, 110 aa] {ON} YLR204W...    91   1e-24
Suva_10.298 Chr10 (525092..525430) [339 bp, 112 aa] {ON} YLR204W...    87   4e-23

>Smik_12.262 Chr12 (499287..499622) [336 bp, 111 aa] {ON} YLR204W
          (REAL)
          Length = 111

 Score =  126 bits (317), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 64/80 (80%)

Query: 1  MLGRALRPGWLGITRAVARKPICGSCFVRTLQTEMNTGMPAMHEGMLXXXXXXXXXXXXX 60
          MLGRALRPGWLGITRAVARKPICGSCFVRTLQTEMNTGMPAMHEGML             
Sbjct: 1  MLGRALRPGWLGITRAVARKPICGSCFVRTLQTEMNTGMPAMHEGMLSTIMMTTTTGTRI 60

Query: 61 XXXVRESLSESSIVMQLDSV 80
             VRESLSESSIVMQLDSV
Sbjct: 61 SNTVRESLSESSIVMQLDSV 80

>YLR204W Chr12 (552270..552605) [336 bp, 111 aa] {ON}
          QRI5Mitochondrial inner membrane protein, required for
          accumulation of spliced COX1 mRNA; may have an
          additional role in translation of COX1 mRNA
          Length = 111

 Score = 91.7 bits (226), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 51/80 (63%)

Query: 1  MLGRALRPGWLGITRAVARKPICGSCFVRTLQTEMNTGMPAMHEGMLXXXXXXXXXXXXX 60
          MLGRALRPGWLGITR V +KP CGS F RT QT +NT MP M EGML             
Sbjct: 1  MLGRALRPGWLGITRTVVKKPSCGSYFNRTFQTAINTTMPPMQEGMLSTMMMMTATATRI 60

Query: 61 XXXVRESLSESSIVMQLDSV 80
             V E L+ S+IVMQLDSV
Sbjct: 61 TGTVSEPLNGSNIVMQLDSV 80

>Skud_12.267 Chr12 (498907..499239) [333 bp, 110 aa] {ON} YLR204W
          (REAL)
          Length = 110

 Score = 91.3 bits (225), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 51/80 (63%), Gaps = 1/80 (1%)

Query: 1  MLGRALRPGWLGITRAVARKPICGSCFVRTLQTEMNTGMPAMHEGMLXXXXXXXXXXXXX 60
          MLGRALRPGWLGITR VAR P CG+CF RT+QT  NTGM  M EGML             
Sbjct: 1  MLGRALRPGWLGITRTVARNPTCGACFNRTMQTTTNTGMSVMQEGML-SAMTIMMTTTRI 59

Query: 61 XXXVRESLSESSIVMQLDSV 80
             V E LS  +IVMQLDSV
Sbjct: 60 GSKVNEPLSGPNIVMQLDSV 79

>Suva_10.298 Chr10 (525092..525430) [339 bp, 112 aa] {ON} YLR204W
          (REAL)
          Length = 112

 Score = 87.4 bits (215), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 1  MLGRALRPGWLGITRAVARKPICGSCFVRTLQTEMNTGMPAMHEGMLXXXXXXXXXXXXX 60
          MLGRALRPGWLGITRA AR PICG+C  RT+ T   T MPAM EGML             
Sbjct: 1  MLGRALRPGWLGITRATARYPICGTCANRTMHTPTTTSMPAMQEGMLSTMMMMTTMTTTR 60

Query: 61 X-XXVRESLSESSIVMQLDSV 80
              V E L+ SSIVMQLDSV
Sbjct: 61 IGSTVSEPLTGSSIVMQLDSV 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.133    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,607,097
Number of extensions: 86519
Number of successful extensions: 147
Number of sequences better than 10.0: 4
Number of HSP's gapped: 143
Number of HSP's successfully gapped: 4
Length of query: 111
Length of database: 53,481,399
Length adjustment: 81
Effective length of query: 30
Effective length of database: 44,193,453
Effective search space: 1325803590
Effective search space used: 1325803590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)