Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.2617.346ON43643622990.0
YLR203C (MSS51)7.346ON43643622220.0
Suva_10.2977.346ON43643622180.0
Skud_12.2667.346ON43643622050.0
TDEL0C020207.346ON42540217850.0
Kpol_530.357.346ON42540417650.0
SAKL0F11286g7.346ON42340217520.0
TPHA0F029307.346ON43640917530.0
NCAS0E028807.346ON42941917500.0
CAGL0A03927g7.346ON43741717310.0
Kwal_56.246317.346ON42241917050.0
KLTH0H01342g7.346ON42241916990.0
ZYRO0F11616g7.346ON41541016630.0
KNAG0B026307.346ON43842716660.0
NDAI0E044807.346ON44341516590.0
Ecym_47277.346ON42941416470.0
KLLA0D12430g7.346ON41840216330.0
NCAS0A141207.346ON42742615440.0
TBLA0E005007.346ON43743715380.0
ACL152W7.346ON42840215260.0
KAFR0B008407.346ON42643315160.0
NDAI0A019307.346ON45041715130.0
KNAG0C037507.346ON42442714700.0
TBLA0H002802.406ON149887723.1
Suva_10.2438.354ON300104694.7
TBLA0C042004.87ON85151696.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.261
         (436 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {...   890   0.0  
YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON} ...   860   0.0  
Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {...   858   0.0  
Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {...   853   0.0  
TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {O...   692   0.0  
Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}...   684   0.0  
SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} simila...   679   0.0  
TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.3...   679   0.0  
NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {O...   678   0.0  
CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly...   671   0.0  
Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR2...   661   0.0  
KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {...   659   0.0  
ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} simila...   645   0.0  
KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {O...   646   0.0  
NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa] ...   643   0.0  
Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {O...   639   0.0  
KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]...   633   0.0  
NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON} Anc_7...   599   0.0  
TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346...   597   0.0  
ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homo...   592   0.0  
KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.3...   588   0.0  
NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {O...   587   0.0  
KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.3...   570   0.0  
TBLA0H00280 Chr8 complement(43650..48146) [4497 bp, 1498 aa] {ON...    32   3.1  
Suva_10.243 Chr10 complement(442966..443868) [903 bp, 300 aa] {O...    31   4.7  
TBLA0C04200 Chr3 (1013461..1016016) [2556 bp, 851 aa] {ON} Anc_4...    31   6.5  

>Smik_12.261 Chr12 complement(497673..498983) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/436 (97%), Positives = 425/436 (97%)

Query: 1   MTALYVPSGATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MTALYVPSGATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTALYVPSGATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNR 240
           AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300

Query: 301 VDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360
           VDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET
Sbjct: 301 VDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360

Query: 361 KCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>YLR203C Chr12 complement(550650..551960) [1311 bp, 436 aa] {ON}
           MSS51Specific translational activator for the
           mitochondrial COX1 mRNA; loosely associated with the
           matrix face of the mitochondrial inner membrane;
           influences both COX1 mRNA translation and Cox1p assembly
           into cytochrome c oxidase
          Length = 436

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/436 (93%), Positives = 418/436 (95%)

Query: 1   MTALYVPSGATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MT LY PSGATQLY HLLR+S HNRLV+SHQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTVLYAPSGATQLYFHLLRKSPHNRLVVSHQTRRHLMGFVRNALGLDPPPSPEDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQ QGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNR 240
           AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSL T TKNR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLPTTTKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQ+FEIHFIGPECLYKRDKQEYVKSTTPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQSFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300

Query: 301 VDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360
           VDETLKFI+RT+FFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET
Sbjct: 301 VDETLKFIYRTNFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360

Query: 361 KCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDLTDD+NLVKSKYGKEMD+LM+PV+NVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLTDDINLVKSKYGKEMDVLMEPVRNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>Suva_10.297 Chr10 complement(523465..524775) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/436 (93%), Positives = 412/436 (94%)

Query: 1   MTALYVPSGATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MTALY PSGA QLYSHLLRRS  NRLV+SHQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTALYAPSGAAQLYSHLLRRSPQNRLVVSHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQ QGYDKAVNLTNWDLF YTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFLYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNR 240
           AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRS+L  T+NR
Sbjct: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTRNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKS TPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSATPVVQR 300

Query: 301 VDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360
           +DETLKF H TDFF+VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETM ALLET
Sbjct: 301 IDETLKFFHHTDFFQVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMTALLET 360

Query: 361 KCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDL DD+NLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLMDDINLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>Skud_12.266 Chr12 complement(497291..498601) [1311 bp, 436 aa] {ON}
           YLR203C (REAL)
          Length = 436

 Score =  853 bits (2205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/436 (92%), Positives = 413/436 (94%)

Query: 1   MTALYVPSGATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENR 60
           MTALY PSGA Q+YSHLLRRS +NRLV+ HQTRRHLMGFVRNALGL           ENR
Sbjct: 1   MTALYAPSGAAQMYSHLLRRSPYNRLVVYHQTRRHLMGFVRNALGLDPPPSPDDPTPENR 60

Query: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSK 120
           FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDK YHDSK
Sbjct: 61  FHPWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKTYHDSK 120

Query: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180
           KYEILKKVNIYEHDLRSGRPFPEFDFPQ QGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA
Sbjct: 121 KYEILKKVNIYEHDLRSGRPFPEFDFPQQQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLA 180

Query: 181 AVTKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNR 240
           AVTKMLSYPITIGS+LHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRS+L  TKNR
Sbjct: 181 AVTKMLSYPITIGSVLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSVLATTKNR 240

Query: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQR 300
           AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHF+GPECLYKRDKQEYVKS TPVVQR
Sbjct: 241 AMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFVGPECLYKRDKQEYVKSATPVVQR 300

Query: 301 VDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLET 360
           VDETL+FIH TDFF+VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETM+ALLET
Sbjct: 301 VDETLRFIHHTDFFDVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMRALLET 360

Query: 361 KCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNM 420
           KCAIFTTGFNKKDL DD+N VKSKYGKEMDILMDPV+NVFGSTKWELNDMNPQEVYQFNM
Sbjct: 361 KCAIFTTGFNKKDLMDDINAVKSKYGKEMDILMDPVRNVFGSTKWELNDMNPQEVYQFNM 420

Query: 421 YIAGFRGKRYHTIKRQ 436
           YIAGFRGKRYHTIKRQ
Sbjct: 421 YIAGFRGKRYHTIKRQ 436

>TDEL0C02020 Chr3 complement(349453..350730) [1278 bp, 425 aa] {ON}
           Anc_7.346 YLR203C
          Length = 425

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/402 (78%), Positives = 356/402 (88%), Gaps = 1/402 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           RR ++GFVRNALGL           ENRFHPWDQSP  DLRERAA+IRTLA CPVTGK+I
Sbjct: 24  RRFIIGFVRNALGLDPPPSPDDPTPENRFHPWDQSPVGDLRERAARIRTLARCPVTGKEI 83

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGY 152
           NYTCPLSGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFPQ Q +
Sbjct: 84  NYTCPLSGIPTHHSREAWEQDKQYHQSKKYEILKKVNIYEHDLRSGRPFPEFDFPQGQDF 143

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPI+I S+LH+FSPYSLNPKGP+TL
Sbjct: 144 DRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPVTL 203

Query: 213 EGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272
           EGLKSLAALRYTLYPLEN++ +++TK+R MRIFILGARAEAQLPGHVWKQLQ+LFPEQ F
Sbjct: 204 EGLKSLAALRYTLYPLENKT-ISSTKDRPMRIFILGARAEAQLPGHVWKQLQYLFPEQMF 262

Query: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFFPYDPYMDV 332
           E+HF+GPECL  ++K +YV S+TPVV+RVDET+ F++ TDFF V HEAQDFFPYDPY+DV
Sbjct: 263 ELHFVGPECLLNKEKHQYVTSSTPVVKRVDETISFVYHTDFFHVLHEAQDFFPYDPYLDV 322

Query: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYGKEMDIL 392
           FF FHPG+ +PE+  SW+ ETMK LLETKCAIFTTGFNK DL  D++ VK KYGKE+D+L
Sbjct: 323 FFCFHPGFGAPETSASWLNETMKGLLETKCAIFTTGFNKADLLRDVDAVKDKYGKEVDVL 382

Query: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M+PVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 383 MEPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>Kpol_530.35 s530 complement(83032..84309) [1278 bp, 425 aa] {ON}
           complement(83032..84309) [1278 nt, 426 aa]
          Length = 425

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/404 (78%), Positives = 357/404 (88%), Gaps = 2/404 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +R LMGFVRNALGL           ENRFHPWDQSP VDLRERAAKIRTLA CPVT KDI
Sbjct: 21  KRSLMGFVRNALGLDPPPSPDDPTPENRFHPWDQSPCVDLRERAAKIRTLAKCPVTHKDI 80

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGY 152
           NYTCPLSGIPTHH +EAW MDK YH+SK+YEILKKVNIYEHDLRSGRPFPEFDFPQ+Q Y
Sbjct: 81  NYTCPLSGIPTHHDKEAWLMDKDYHESKRYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ +NLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLH+FSPYSLNPKGP+TL
Sbjct: 141 DRLINLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHQFSPYSLNPKGPVTL 200

Query: 213 EGLKSLAALRYTLYPLENRS--LLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQ 270
           EGLKSLAALRYTLYP +N+S  +   T++R MRIFILGARAEAQLPGHVWKQ Q+LFPEQ
Sbjct: 201 EGLKSLAALRYTLYPYQNKSQNVKVNTRDRPMRIFILGARAEAQLPGHVWKQFQYLFPEQ 260

Query: 271 NFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFFPYDPYM 330
            FEIHFIGPEC   ++K +Y+ S+TP+V++VD+TLK +   D+F VFHEAQDFFPYDP++
Sbjct: 261 EFEIHFIGPECYLNKEKNQYITSSTPIVKKVDDTLKLVFHPDYFHVFHEAQDFFPYDPFL 320

Query: 331 DVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYGKEMD 390
           DVFFTFHPGYA PE+   W+GETMKALL+TKCAIFTTGF+K+DL  D+++VK++YG E+D
Sbjct: 321 DVFFTFHPGYAYPETTEIWLGETMKALLDTKCAIFTTGFSKQDLLRDIDVVKNRYGNELD 380

Query: 391 ILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           +LMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 381 MLMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 424

>SAKL0F11286g Chr6 (880536..881807) [1272 bp, 423 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 423

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/402 (76%), Positives = 351/402 (87%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           +RH++GFVRNALGL           +NRFHPWDQSPS DLR RAA IR LA CPVTGK+I
Sbjct: 21  KRHIIGFVRNALGLDPPPSPDDPTPDNRFHPWDQSPSPDLRTRAATIRALARCPVTGKEI 80

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGY 152
           NYTCP SGIPTHHSREAWE D  YH +KKYEILKKVNIYEHDLRSGRPFPEFDFPQ+Q Y
Sbjct: 81  NYTCPQSGIPTHHSREAWEQDTMYHATKKYEILKKVNIYEHDLRSGRPFPEFDFPQDQDY 140

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP T+GS+LH+FSPY+LNPKGPITL
Sbjct: 141 DRMVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPTTVGSVLHEFSPYALNPKGPITL 200

Query: 213 EGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272
           EGLKSLAALRYTLYP ++R +  ATK+R MRIFILGARAEAQLPGHVWKQ QFLFPE NF
Sbjct: 201 EGLKSLAALRYTLYPQQHRKVSAATKDRPMRIFILGARAEAQLPGHVWKQFQFLFPEINF 260

Query: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFFPYDPYMDV 332
           E+HFIGPE  Y R+K+EY+ S+TP+V+RVDETL F++ TD+F VFHEAQDFFPYDPY+D+
Sbjct: 261 ELHFIGPESFYDREKREYITSSTPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYLDI 320

Query: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYGKEMDIL 392
           FF FHPG+A+PES   WMG+TM+ LLETKCAIFTTGFN++DL  D+  V+ KYG EMD+L
Sbjct: 321 FFCFHPGFAAPESTEHWMGKTMEGLLETKCAIFTTGFNEQDLVRDMTAVREKYGNEMDML 380

Query: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M+PV+N+FGSTKWELNDMNPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 381 MEPVRNLFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHAIE 422

>TPHA0F02930 Chr6 (647081..648391) [1311 bp, 436 aa] {ON} Anc_7.346
           YLR203C
          Length = 436

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/409 (76%), Positives = 358/409 (87%), Gaps = 1/409 (0%)

Query: 28  LSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPV 87
           L    +R LMGFV+NALGL           ENRFHPWDQSPS DLRERAA+IRTLA CPV
Sbjct: 28  LPSSQKRSLMGFVKNALGLDPSPSPDDPTPENRFHPWDQSPSPDLRERAARIRTLAKCPV 87

Query: 88  TGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFP 147
           T K+INYTCPLSGIPTHHSREAWE DK YH SK+YEILKKVNIYEHDLRSGRPFPEFDFP
Sbjct: 88  TKKEINYTCPLSGIPTHHSREAWEADKDYHQSKRYEILKKVNIYEHDLRSGRPFPEFDFP 147

Query: 148 QNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPK 207
            +Q +D+ VNLTNWDLFFYTR+FYSMDTEFQLAAVTKMLSYP+TIGS+LH+FSPYSLNPK
Sbjct: 148 LDQIHDRVVNLTNWDLFFYTRNFYSMDTEFQLAAVTKMLSYPMTIGSILHQFSPYSLNPK 207

Query: 208 GPITLEGLKSLAALRYTLYPLENRSLLT-ATKNRAMRIFILGARAEAQLPGHVWKQLQFL 266
           GPITLEGLKSLAALRY+LYP + +S ++    +R MRIFILGARAEAQLPGHVWKQLQFL
Sbjct: 208 GPITLEGLKSLAALRYSLYPFQRKSNISLKLHDRPMRIFILGARAEAQLPGHVWKQLQFL 267

Query: 267 FPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFFPY 326
           FP+Q FEIHFIG ECL   +K +Y+KS  PVV+++DET+K I+ +D+F V+HEAQDF PY
Sbjct: 268 FPDQTFEIHFIGTECLLNNEKNKYIKSAIPVVKKIDETMKLIYHSDYFHVYHEAQDFVPY 327

Query: 327 DPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYG 386
           DPY+DVFFTFHPG+A+PE+   WMG+TMKALLETKCAIFTTGFNK+D+T+D+ +VK++YG
Sbjct: 328 DPYLDVFFTFHPGFAAPETSDLWMGDTMKALLETKCAIFTTGFNKQDITNDVEIVKARYG 387

Query: 387 KEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435
           KEMD LMDP+KN +GSTKWELNDMNPQE++QFNMY+AGFRGKRYHTIKR
Sbjct: 388 KEMDTLMDPIKNSYGSTKWELNDMNPQEIFQFNMYVAGFRGKRYHTIKR 436

>NCAS0E02880 Chr5 complement(563006..564295) [1290 bp, 429 aa] {ON}
           Anc_7.346 YLR203C
          Length = 429

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/419 (75%), Positives = 360/419 (85%), Gaps = 3/419 (0%)

Query: 17  LLRRSSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERA 76
           LL R++ N  V  +QTR HLMGFVRNALGL           ENRFHPWDQSPS DLRERA
Sbjct: 14  LLPRNAFN--VAGNQTR-HLMGFVRNALGLDPPTSPDDPTPENRFHPWDQSPSPDLRERA 70

Query: 77  AKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLR 136
           A+IRTLA CPVTGK+INYTCP+SGIPTHHSREAWE DK YH SK+YE+LKKVNIYEHDLR
Sbjct: 71  ARIRTLARCPVTGKEINYTCPISGIPTHHSREAWEQDKEYHASKRYELLKKVNIYEHDLR 130

Query: 137 SGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLL 196
           SGRPFPEFDFP++QG D+ VN+TNWDLF YTR+FYSMDTEFQ+AAVTKMLSYPITIGS+L
Sbjct: 131 SGRPFPEFDFPRDQGQDRMVNMTNWDLFLYTRAFYSMDTEFQMAAVTKMLSYPITIGSVL 190

Query: 197 HKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLP 256
           H+FSPYSL PKGPI+LEGLKSLAALRYTLYP++NR +++ TK R MRIFILGARAE+QLP
Sbjct: 191 HQFSPYSLQPKGPISLEGLKSLAALRYTLYPMQNRLVISTTKARPMRIFILGARAESQLP 250

Query: 257 GHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEV 316
           GHVWKQLQ+LFPEQ FEIHFIGPE  Y +DK++Y++ TTP+ + VDETLK I+ T++F  
Sbjct: 251 GHVWKQLQYLFPEQTFEIHFIGPESYYDKDKKKYIQLTTPITESVDETLKLIYHTEYFHK 310

Query: 317 FHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTD 376
            HEAQDFFPYDPYMDVFF FHPG+AS E    WM +TMK LL+TKCAIFTTGF K DL +
Sbjct: 311 LHEAQDFFPYDPYMDVFFIFHPGFASAEIGEHWMKDTMKGLLDTKCAIFTTGFTKNDLLE 370

Query: 377 DLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIKR 435
           D+ +V+ KYGKE+DILM P KNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRY TIKR
Sbjct: 371 DIAVVQDKYGKELDILMKPTKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYPTIKR 429

>CAGL0A03927g Chr1 (397179..398492) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203c MSS51
          Length = 437

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/417 (74%), Positives = 351/417 (84%), Gaps = 14/417 (3%)

Query: 32  TRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91
           ++R LMGFVRNALGL           +NRFHPWDQSP+VDLRERAA+I+TLA CPVT K 
Sbjct: 20  SKRQLMGFVRNALGLDPPPSPDEPTEQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKP 79

Query: 92  INYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQG 151
           I YTCP+SGIPTHHSREAWE DK YH SKKYEILKKVNIYEHDLRSGRPFPEFDFP++QG
Sbjct: 80  IQYTCPISGIPTHHSREAWEQDKEYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQG 139

Query: 152 YDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPIT 211
            D+ VNLTNWDLF YTRSFYSMDTEFQLAAVTKMLSYPITIGS+LH+FSPYSLNPKGPIT
Sbjct: 140 PDRTVNLTNWDLFLYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPIT 199

Query: 212 LEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271
           LEGLKSLAALRYTLYPL+NR++ T  KN+ MRIFILGARAEAQLPGHVWKQLQFLFP+QN
Sbjct: 200 LEGLKSLAALRYTLYPLQNRAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQN 259

Query: 272 FEIHFIGPECLYKRDKQEYVKSTT--------------PVVQRVDETLKFIHRTDFFEVF 317
           FEIHFIGPE LY R++ EY++S T              PV +R+DET+KF + TD+F   
Sbjct: 260 FEIHFIGPESLYDRERNEYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTL 319

Query: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDD 377
           H AQDFFPYDPY DVFF FHPG ASPES  +WM +T+K LL+TKCAIFTTGFNKKD+ DD
Sbjct: 320 HTAQDFFPYDPYQDVFFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADD 379

Query: 378 LNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           + +++  YGKEMD+LM+PVKNVFGSTKWEL+D +P  VYQFNMYIAGFRGKRYH IK
Sbjct: 380 IQILQDTYGKEMDMLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIK 436

>Kwal_56.24631 s56 (1080985..1082253) [1269 bp, 422 aa] {ON} YLR203C
           (MSS51) - involved in maturation of COX1 and COB mRNA
           [contig 161] FULL
          Length = 422

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/419 (73%), Positives = 353/419 (84%), Gaps = 1/419 (0%)

Query: 16  HLLRRSSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRER 75
           ++L RSS      S Q +RH+MGFVRNALGL           ENRFHPWDQSPS DLRER
Sbjct: 4   YILNRSSLRNSHCSLQ-KRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRER 62

Query: 76  AAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDL 135
           AA IR LA CPVTG++INYTCP SGIPTHHSREAWE D  Y  SK+ EILKKVNIYEHDL
Sbjct: 63  AATIRALAKCPVTGREINYTCPKSGIPTHHSREAWEKDLDYQQSKRPEILKKVNIYEHDL 122

Query: 136 RSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSL 195
           RSGRPFPEFDFP +Q +D+ VNLTNWDLFFYTR F+SMDTEFQLAAVTKMLSYPITIGS+
Sbjct: 123 RSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFFSMDTEFQLAAVTKMLSYPITIGSV 182

Query: 196 LHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQL 255
           LH+FSPYSLNPKGPITLEGLKSLAALRYTLYP +NR + +  KN  +RIF+LGARAEAQL
Sbjct: 183 LHQFSPYSLNPKGPITLEGLKSLAALRYTLYPDQNRRVTSIAKNSPLRIFVLGARAEAQL 242

Query: 256 PGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFE 315
           PGHVWKQLQF+FPE   EIHF+GPE  Y R+K+EYV S  P+++RVDETL F++ TD+F 
Sbjct: 243 PGHVWKQLQFMFPETQMEIHFVGPESYYDRNKREYVHSAAPIIRRVDETLNFVYHTDYFH 302

Query: 316 VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLT 375
           VFHEAQDFFPYDPY D+FF FHPG+A+PES  +WMG+TM+ALLETKCAIFTTGFN+ DL 
Sbjct: 303 VFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAIFTTGFNEVDLQ 362

Query: 376 DDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
            DL+ V ++YGKE+DI+MDP KN FGSTKWELND+NPQEVYQFNM++AGFRGKRYH I+
Sbjct: 363 RDLDAVVAEYGKELDIIMDPAKNAFGSTKWELNDVNPQEVYQFNMFMAGFRGKRYHAIE 421

>KLTH0H01342g Chr8 complement(125673..126941) [1269 bp, 422 aa] {ON}
           similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 422

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/419 (73%), Positives = 352/419 (84%), Gaps = 9/419 (2%)

Query: 25  RLVLSHQT---------RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRER 75
           R +LS  T         +RH+MGFVRNALGL           ENRFHPWDQSPS DLRER
Sbjct: 3   RCILSRNTVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPENRFHPWDQSPSPDLRER 62

Query: 76  AAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDL 135
           AA IR LA CPVTG++INYTCP SGIPTH+SREAWE D  Y  SK+ EILKKVNIYEHDL
Sbjct: 63  AATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQQSKRPEILKKVNIYEHDL 122

Query: 136 RSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSL 195
           RSGRPFPEFDFP +Q +D+ VNLTNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TIGS+
Sbjct: 123 RSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIGSV 182

Query: 196 LHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQL 255
           LH+FSPYSLNPKGP+TLEGLKSLAALRYTLYP +NR + + TKN  +RIFILGARAEAQL
Sbjct: 183 LHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTSITKNSPLRIFILGARAEAQL 242

Query: 256 PGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFE 315
           PGHVWKQLQF+FPE N E+HF+GPE  Y R+K+EYV S++P+V+RVDETL F++ TD+F 
Sbjct: 243 PGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSSSPIVRRVDETLSFVYHTDYFH 302

Query: 316 VFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLT 375
           VFHEAQDFFPYDPY D+FF FHPG+A+PES  +WMG+TM+ALLETKCA+FTTGFN+ DL 
Sbjct: 303 VFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKTMEALLETKCAVFTTGFNELDLR 362

Query: 376 DDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
            D+  V  K+GKE+D+LM+PV N FGSTKWELNDMNPQEVYQFNM+IAGFRGKRYH I+
Sbjct: 363 RDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNPQEVYQFNMFIAGFRGKRYHAIE 421

>ZYRO0F11616g Chr6 (953577..954824) [1248 bp, 415 aa] {ON} similar
           to uniprot|P32335 Saccharomyces cerevisiae YLR203C MSS51
           Protein required for the maturation and translation of
           COX1 mRNA involved in maturation of COX1 and COB mRNA
          Length = 415

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/410 (72%), Positives = 344/410 (83%), Gaps = 1/410 (0%)

Query: 25  RLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAH 84
           RL      RR ++GFVRNALGL           ENRFH WDQSP+ DLRERAA+IR LA 
Sbjct: 6   RLCRPITQRRTIIGFVRNALGLDPPPSPDDPTPENRFHLWDQSPAGDLRERAARIRALAQ 65

Query: 85  CPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEF 144
           CPVTGK+INYTCPLSGIPTHHS+EAWE DK YH+SKK+E+LKKVNIYEHDLRSGRPFPEF
Sbjct: 66  CPVTGKEINYTCPLSGIPTHHSKEAWEQDKKYHESKKWELLKKVNIYEHDLRSGRPFPEF 125

Query: 145 DFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSL 204
           DFPQ+  +D+ VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYPITI S+L++FSPYSL
Sbjct: 126 DFPQDLEFDRTVNMTNWDLFFYTRQFYSMDTEFQLAAVTKMLSYPITIASVLNQFSPYSL 185

Query: 205 NPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQ 264
           NPKGPITLEGLKSLAALRYTLYP EN++ + ATK+R MR+FILGARAEA LPGHVWKQLQ
Sbjct: 186 NPKGPITLEGLKSLAALRYTLYPFENKT-VAATKDRPMRLFILGARAEALLPGHVWKQLQ 244

Query: 265 FLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFF 324
           FLFPE  FE+HFIGPECL  ++K +YV S  PVV+R+DETL F++ TD+F V+H+AQDFF
Sbjct: 245 FLFPETAFELHFIGPECLVNKEKHQYVSSPAPVVKRIDETLSFVYHTDYFHVYHDAQDFF 304

Query: 325 PYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSK 384
           PYDPY+D FF FHPG+ +PES   W+ +T+  LLETKCAIF TG NK  L  D+N V  K
Sbjct: 305 PYDPYLDAFFCFHPGFGAPESTKLWLEKTIPGLLETKCAIFATGVNKSALLRDINAVMDK 364

Query: 385 YGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           + KE+DILM+P KN++GSTKWELND+NPQEVYQFNMYIAGFRGKRYH I+
Sbjct: 365 HSKEIDILMEPTKNIYGSTKWELNDVNPQEVYQFNMYIAGFRGKRYHAIE 414

>KNAG0B02630 Chr2 complement(508645..509961) [1317 bp, 438 aa] {ON}
           Anc_7.346 YLR203C
          Length = 438

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/427 (72%), Positives = 346/427 (81%), Gaps = 11/427 (2%)

Query: 20  RSSHNRLVLSHQ---TRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERA 76
           RS+H  L  S      RR LMGFVRNALGL           ENRFHPWDQSP   LRERA
Sbjct: 12  RSAHRALRASGLPCIARRQLMGFVRNALGLEPPPSPMDPTPENRFHPWDQSPVDALRERA 71

Query: 77  AKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLR 136
           A+I+TLA CPVTG ++ YTCPLSGIPTHHSREAWE D  YH +K+YE LKKVNIYEHDLR
Sbjct: 72  ARIKTLAKCPVTGLNVEYTCPLSGIPTHHSREAWEQDTQYHATKRYETLKKVNIYEHDLR 131

Query: 137 SGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLL 196
           SGRPFPEFDFPQ QGYDK VN+TNWDLFFYTR FYSMDTEFQLAAVTKMLSYP+TI SLL
Sbjct: 132 SGRPFPEFDFPQEQGYDKVVNMTNWDLFFYTRGFYSMDTEFQLAAVTKMLSYPVTIASLL 191

Query: 197 HKFSPYSLNPKGPITLEGLKSLAALRYTLYPLE-NRSLLT-------ATKNRAMRIFILG 248
            +FSPYSLNPKGPITLEGLKSLAA+RYTLY    N S          A KNR MR+F+LG
Sbjct: 192 AQFSPYSLNPKGPITLEGLKSLAAVRYTLYSQSFNNSARAGGVTTGGALKNRPMRLFVLG 251

Query: 249 ARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFI 308
           ARAEAQLPGHVWKQL +LFPEQ+FE+ FIGPE  Y R + +YV+S TPVV++VDETLKFI
Sbjct: 252 ARAEAQLPGHVWKQLSYLFPEQSFEMVFIGPESYYDRARGQYVRSPTPVVEKVDETLKFI 311

Query: 309 HRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTG 368
           H TD+F V HE+QDFFPYDPY D FFTFHPG+ASPE+  +W+  T+ ALL+TKCAIFTTG
Sbjct: 312 HYTDYFHVLHESQDFFPYDPYFDCFFTFHPGFASPENRDTWLSNTLPALLDTKCAIFTTG 371

Query: 369 FNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGK 428
           F++ DL +D+ L+  K+G EMDILM+P KNVFGSTKWELND+NP EVYQFNMYIAGFRGK
Sbjct: 372 FDRDDLMNDVALLNEKFGSEMDILMEPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGK 431

Query: 429 RYHTIKR 435
           RYHTIKR
Sbjct: 432 RYHTIKR 438

>NDAI0E04480 Chr5 complement(1007346..1008677) [1332 bp, 443 aa]
           {ON} Anc_7.346 YLR203C
          Length = 443

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/415 (70%), Positives = 347/415 (83%)

Query: 20  RSSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKI 79
           R+  N   +SH + R LMGFVRNALGL           ENRFHPWDQSP  DLRERAAKI
Sbjct: 28  RNFRNNAHVSHHSSRSLMGFVRNALGLDPKSSPDDPTPENRFHPWDQSPCQDLRERAAKI 87

Query: 80  RTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGR 139
           RTLAHCPVT K+INYTCP+SGIPTHHS+ AWEMD+ YH +K YEILKKVNIYEHDLRSGR
Sbjct: 88  RTLAHCPVTNKEINYTCPISGIPTHHSKNAWEMDENYHSNKIYEILKKVNIYEHDLRSGR 147

Query: 140 PFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKF 199
           PFPEF FPQ+Q +D+ +N+TNWDLF YTRSFYSMDTEFQ+AAVTKMLSYPITIGS+LH+F
Sbjct: 148 PFPEFVFPQDQDFDRMINMTNWDLFLYTRSFYSMDTEFQMAAVTKMLSYPITIGSILHQF 207

Query: 200 SPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHV 259
           SPYSL PKGPITLEGLKS+AALRYTLYP  N+S +T TKNR MRIF+LGARAEAQLPGH+
Sbjct: 208 SPYSLQPKGPITLEGLKSMAALRYTLYPFHNKSFMTLTKNRPMRIFLLGARAEAQLPGHI 267

Query: 260 WKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHE 319
           WKQLQ+LFPEQ FE+ FIGPE  Y ++K++Y+K   P++Q +D+TLK    T++F   HE
Sbjct: 268 WKQLQYLFPEQKFELFFIGPEAYYDKEKKQYLKLDKPLIQTIDDTLKLTFITEYFHTLHE 327

Query: 320 AQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLN 379
           +QD FPYDPYMDVFF FHPG+++ E+   WM +TMK+LLET+CAIF TGF++ D+ +D+N
Sbjct: 328 SQDLFPYDPYMDVFFIFHPGFSAIETTEHWMNDTMKSLLETQCAIFNTGFSRNDMLNDMN 387

Query: 380 LVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           ++  KY  ++DILM PVKNVFGSTKWELND+NPQ+VYQFNMYIAGFRGKRY T++
Sbjct: 388 ILDEKYKNDLDILMKPVKNVFGSTKWELNDLNPQDVYQFNMYIAGFRGKRYPTVE 442

>Ecym_4727 Chr4 complement(1420885..1422174) [1290 bp, 429 aa] {ON}
           similar to Ashbya gossypii ACL152W
          Length = 429

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/414 (70%), Positives = 346/414 (83%), Gaps = 1/414 (0%)

Query: 21  SSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIR 80
           SS +  V   Q RR +MGFVRNALGL           +NRFHPWDQSPS +LRERAA+I+
Sbjct: 16  SSSSSRVCGKQQRRQIMGFVRNALGLDPPTSPDEPTVDNRFHPWDQSPSPELRERAARIK 75

Query: 81  TLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRP 140
            LA CPVTGK+I ++C  SGIPTHHS EAW+ D  YH+SK+Y +LKKVNIYEHDLRSGRP
Sbjct: 76  ALAKCPVTGKNIQFSCKYSGIPTHHSEEAWKNDSEYHESKRYRLLKKVNIYEHDLRSGRP 135

Query: 141 FPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFS 200
           F EFDFP+ Q YD+ VN+ NWDL+FYTRSF+SMDTEFQLAAVTKMLSYPITIGS+LH++S
Sbjct: 136 FLEFDFPEQQDYDRMVNMMNWDLYFYTRSFFSMDTEFQLAAVTKMLSYPITIGSILHQYS 195

Query: 201 PYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVW 260
           PYSLNPKGPITLEGLKSLAALRYTLYP +NR  + + +++ +R+FILGARAEAQLPGHVW
Sbjct: 196 PYSLNPKGPITLEGLKSLAALRYTLYPEQNRR-VRSIQDKPLRVFILGARAEAQLPGHVW 254

Query: 261 KQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEA 320
           KQLQ+LFPE   E+HF+GPE  Y R+K+EYV S+ PVV+R+D+T+K  + TD+F VFHEA
Sbjct: 255 KQLQYLFPESLIELHFVGPESNYDREKREYVTSSIPVVKRIDDTMKMHYHTDYFHVFHEA 314

Query: 321 QDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNL 380
           QDFFPYDPY D+FF FHPG+ SPE+  +WM  T++ALL+TKCAIFTTGFNKKDL DDL  
Sbjct: 315 QDFFPYDPYNDIFFCFHPGFGSPETRDTWMNSTLQALLQTKCAIFTTGFNKKDLMDDLQA 374

Query: 381 VKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           VK KYG E+D+L+DP KNVFGSTKWELND+NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 375 VKEKYGDELDMLVDPTKNVFGSTKWELNDLNPHEVYQFNMYIAGFRGKRYHAIE 428

>KLLA0D12430g Chr4 complement(1055878..1057134) [1257 bp, 418 aa]
           {ON} similar to uniprot|P32335 Saccharomyces cerevisiae
           YLR203C MSS51 Protein required for the maturation and
           translation of COX1 mRNA involved in maturation of COX1
           and COB mRNA
          Length = 418

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/402 (72%), Positives = 341/402 (84%), Gaps = 2/402 (0%)

Query: 34  RHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDIN 93
           R +MGFVRNALGL           ENRFHPWDQSPS DLRERAA+I+ +A CPVT KDI 
Sbjct: 17  RPIMGFVRNALGLDPPASPDDPTPENRFHPWDQSPSPDLRERAARIKAMATCPVTHKDIQ 76

Query: 94  YTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGYD 153
           +TCPLSGIPTHHSREAWE D  YH SK+YE+LKKVNIYEHDLRSGRPFPEFDFPQ+Q YD
Sbjct: 77  FTCPLSGIPTHHSREAWEKDTEYHKSKRYELLKKVNIYEHDLRSGRPFPEFDFPQDQDYD 136

Query: 154 KAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITLE 213
           + VN++NWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGS+LH++SPYSLNPKGPITLE
Sbjct: 137 RMVNMSNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSVLHQYSPYSLNPKGPITLE 196

Query: 214 GLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFE 273
           GLKSLAALRYTLYP E      A ++  +RIFILG RAEAQLPGHVWKQLQ+L P+ + E
Sbjct: 197 GLKSLAALRYTLYP-EQSGRFRAGQDTPIRIFILGTRAEAQLPGHVWKQLQYLIPDTSIE 255

Query: 274 IHFIGPECLYKRDKQEYVKSTTP-VVQRVDETLKFIHRTDFFEVFHEAQDFFPYDPYMDV 332
           +HF+GPE  Y R+K+ YV+S+T  +V+R+DE ++  + TDFF VFHEAQDFFPYDPY DV
Sbjct: 256 LHFVGPESFYDREKRSYVQSSTETIVKRIDEKMQLFYHTDFFHVFHEAQDFFPYDPYNDV 315

Query: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYGKEMDIL 392
           FF FHPG+A+PE+   WMG+TMKAL++TKCA+FTTGF+K+DL  D+++V+ KYG E+D+L
Sbjct: 316 FFCFHPGFAAPETEEYWMGDTMKALMQTKCAVFTTGFSKEDLLRDISIVQDKYGSELDML 375

Query: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M+PV NVFGSTKWELND NP EVYQFNMYIAGFRGKRYH I+
Sbjct: 376 MEPVPNVFGSTKWELNDTNPHEVYQFNMYIAGFRGKRYHAIE 417

>NCAS0A14120 Chr1 (2777017..2778300) [1284 bp, 427 aa] {ON}
           Anc_7.346 YLR203C
          Length = 427

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/426 (66%), Positives = 339/426 (79%), Gaps = 7/426 (1%)

Query: 9   GATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSP 68
            ATQL  H +   + +  + SH+T   L+GFV+NALG+            NRF+PWD+SP
Sbjct: 8   AATQLSLHPVSLFAIDSRISSHRT---LVGFVKNALGIDPPPLPTEPVFANRFYPWDESP 64

Query: 69  SVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKV 128
           S  +RERAA+I+  A CPVTGK+I +TCPLSGIPTH+S+EAWE D  YH +K YE L+KV
Sbjct: 65  SPAIRERAARIKAQAKCPVTGKEIRFTCPLSGIPTHYSKEAWENDTNYHKNKIYEKLRKV 124

Query: 129 NIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSY 188
           NIYEHDLRSGRPFPEFDFP  Q  D  VN+TNWDLFFYTR FYSMDTEFQLA VTKMLSY
Sbjct: 125 NIYEHDLRSGRPFPEFDFPGEQARDSTVNMTNWDLFFYTRQFYSMDTEFQLATVTKMLSY 184

Query: 189 PITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILG 248
           PITIGS+L+K+SPY+L PKGP+TLEGLKSLAALRYTL    N +  T TK R MRIFILG
Sbjct: 185 PITIGSILYKYSPYNLIPKGPVTLEGLKSLAALRYTL---RNNAFAT-TKTRPMRIFILG 240

Query: 249 ARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFI 308
           ARAE+QLP H+WKQLQFLFP Q FEI+FIGPEC        Y+ S + +V+RVDE+L   
Sbjct: 241 ARAESQLPIHIWKQLQFLFPAQAFEINFIGPECSLLEQDSNYLSSDSRIVKRVDESLTLA 300

Query: 309 HRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTG 368
           +  D+F+ FH+AQDFFPYDPY D+FFTFHPG+ASPES  +WMG+TMKALL+TKCAIFTTG
Sbjct: 301 YYPDYFDKFHKAQDFFPYDPYNDIFFTFHPGFASPESSKTWMGDTMKALLDTKCAIFTTG 360

Query: 369 FNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGK 428
           F++ D+  D+  V+  YG+E+D+LM+P+KNVFGSTKWELND+NPQ+VYQFNMYIAGFRGK
Sbjct: 361 FSQDDIMKDITSVQDTYGEEVDMLMNPIKNVFGSTKWELNDLNPQQVYQFNMYIAGFRGK 420

Query: 429 RYHTIK 434
           RYHT+K
Sbjct: 421 RYHTVK 426

>TBLA0E00500 Chr5 (91769..93082) [1314 bp, 437 aa] {ON} Anc_7.346
           YLR203C
          Length = 437

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/437 (64%), Positives = 340/437 (77%), Gaps = 18/437 (4%)

Query: 11  TQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSV 70
           T LY+      S N +  S+ ++R+LMGFVR+ LGL           ENRFHPW+ SP  
Sbjct: 2   TLLYNTTKPILSKNIIACSNYSKRNLMGFVRSTLGLDPPPSPNDPTPENRFHPWETSPCD 61

Query: 71  DLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNI 130
           DLRERAA+I+T+A CPV+  DINYTCP+SGIPTHHSR+ WEMD  YH +   +ILKKVNI
Sbjct: 62  DLRERAARIKTMAKCPVSNLDINYTCPISGIPTHHSRKEWEMDTNYHKNHIADILKKVNI 121

Query: 131 YEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPI 190
           YEHDLRSGRPFPEFDFP+ Q YD  +NL NWDL+FYTR+F+SMDTEFQLAAVTKMLSYP+
Sbjct: 122 YEHDLRSGRPFPEFDFPREQEYDTVINLINWDLYFYTRNFFSMDTEFQLAAVTKMLSYPM 181

Query: 191 TIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSL------------LTAT- 237
           TI S+LH+FSPYSL PKGP+TLEGLKSLAALRYT   L N SL            +TAT 
Sbjct: 182 TIASVLHQFSPYSLTPKGPVTLEGLKSLAALRYT---LNNNSLSDTSSGNSDSTTITATS 238

Query: 238 KNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPV 297
           KNR MRIFILGARAEAQLP HVWKQLQ+LFP  NFEIHFIGPE L  +DK  YV STTP+
Sbjct: 239 KNRPMRIFILGARAEAQLPPHVWKQLQYLFPNSNFEIHFIGPESLLSKDKSHYVTSTTPI 298

Query: 298 VQRVDETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKAL 357
            +R+D+++  ++ TD+F V+H+AQDF+PYDPY D+FF FHPG A+ +   +W+ ETM+ L
Sbjct: 299 TKRIDDSMSLVYHTDYFHVYHKAQDFYPYDPYFDIFFMFHPGLAATKE--TWLNETMQGL 356

Query: 358 LETKCAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQ 417
           L++KC IF TGF++KD+T D++++   + K+MDILM PVKNVFGSTKWELND NPQEVYQ
Sbjct: 357 LDSKCPIFMTGFHEKDITADISVLNKNFSKDMDILMKPVKNVFGSTKWELNDSNPQEVYQ 416

Query: 418 FNMYIAGFRGKRYHTIK 434
           FNMYIAG+RGKRYH  +
Sbjct: 417 FNMYIAGYRGKRYHATE 433

>ACL152W Chr3 (85701..86987) [1287 bp, 428 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR203C (MSS51)
          Length = 428

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/402 (71%), Positives = 328/402 (81%), Gaps = 2/402 (0%)

Query: 33  RRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKDI 92
           RR +MGFVRNALGL           ENRFH W+QSPS DLRERAA+IR LA CPVTGKDI
Sbjct: 28  RRPIMGFVRNALGLDPPASPDEPTDENRFHVWEQSPSPDLRERAARIRALARCPVTGKDI 87

Query: 93  NYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQGY 152
            Y+C  SGIPTHHSREAWE D+ YH SK++  L+KVN+YEHDLRSGRPF EFDFPQ QG 
Sbjct: 88  RYSCERSGIPTHHSREAWEQDEEYHRSKRWATLRKVNVYEHDLRSGRPFAEFDFPQEQGR 147

Query: 153 DKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPITL 212
           D+ VN+ NWDLF YTR FYSMDT+FQLAAVTKMLSYPITIGSLLH+FSPY+L P+GPITL
Sbjct: 148 DRMVNMLNWDLFLYTRQFYSMDTDFQLAAVTKMLSYPITIGSLLHQFSPYALEPRGPITL 207

Query: 213 EGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQNF 272
           EGLKSLAALRYTLYP E+ S   A +++ MRIFILGARAEAQLPGHVWKQLQ+LFP  N 
Sbjct: 208 EGLKSLAALRYTLYP-ESES-ARAVRSKPMRIFILGARAEAQLPGHVWKQLQYLFPGSNM 265

Query: 273 EIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKFIHRTDFFEVFHEAQDFFPYDPYMDV 332
           EIHFIGPE LY R ++EYV S+TPV +RVD TLK +H TD+  VFHEAQDFFPYDPY DV
Sbjct: 266 EIHFIGPEALYDRQRKEYVHSSTPVSKRVDGTLKLVHHTDYLHVFHEAQDFFPYDPYNDV 325

Query: 333 FFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKYGKEMDIL 392
           FF FHPG+AS E   SWM +T+ ALLETKCAIF TGF++ D+  D   +++ +  EMD+L
Sbjct: 326 FFCFHPGFASAEGRSSWMDKTVPALLETKCAIFVTGFHRDDMFGDFEALRASHDAEMDVL 385

Query: 393 MDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           M P KN+FGSTKWELNDMNP EVYQFNMYIAGFRGKRYH I+
Sbjct: 386 MHPTKNIFGSTKWELNDMNPHEVYQFNMYIAGFRGKRYHAIQ 427

>KAFR0B00840 Chr2 (159480..160760) [1281 bp, 426 aa] {ON} Anc_7.346
           YLR203C
          Length = 426

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/433 (65%), Positives = 338/433 (78%), Gaps = 17/433 (3%)

Query: 8   SGATQLYS-----HLLRRSSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFH 62
           SGA  +Y+     HL RR      VLS    R L+GFVRNALGL            NRF+
Sbjct: 4   SGAPHVYARGRLQHLQRR------VLS----RTLVGFVRNALGLEPPPTPDEPRVSNRFY 53

Query: 63  PWDQSPSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKY 122
           PWDQSPS +LRERAAKI+ +A CP+TGK+INYTCP+SGIPTHHSREAWE D+AYH +K  
Sbjct: 54  PWDQSPSPELRERAAKIKAMARCPITGKEINYTCPISGIPTHHSREAWEQDEAYHRNKIP 113

Query: 123 EILKKVNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAV 182
           +ILKKVNIYEHDLRSGR FPEFDFP +Q +D+AVNL NWDL+FYTRSFYSMDTEFQLA V
Sbjct: 114 DILKKVNIYEHDLRSGRSFPEFDFPSDQTFDRAVNLANWDLYFYTRSFYSMDTEFQLATV 173

Query: 183 TKMLSYPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTA-TKNRA 241
           TKMLSYPITI S+LH++SPYSL P GPITLEGLKS+AALRY+LYP +++S  +   K R 
Sbjct: 174 TKMLSYPITIASVLHQYSPYSLYPHGPITLEGLKSIAALRYSLYPSQHKSSRSVLNKTRP 233

Query: 242 MRIFILGARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRV 301
           MRIFILGARAE+QLPGHVWKQ Q+LFP Q FEI FIGPEC   R+    V     +V+R+
Sbjct: 234 MRIFILGARAESQLPGHVWKQFQYLFPLQTFEIIFIGPECQL-REPSNSVGGANNIVKRI 292

Query: 302 DETLKFIHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETK 361
           D+T+  ++    F   H+AQDFFPYDPY DVFF FHPG+ASPE+   WM +T+KALL+TK
Sbjct: 293 DDTISLVYHPKLFHDIHKAQDFFPYDPYNDVFFVFHPGFASPETKELWMNDTVKALLDTK 352

Query: 362 CAIFTTGFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMY 421
           CA+F TGF+KKDL++D+ L+   YG ++D LM PVKN+FGSTKWELND+NPQEVYQFNMY
Sbjct: 353 CAVFHTGFSKKDLSNDVKLLNKMYGDKLDTLMTPVKNLFGSTKWELNDLNPQEVYQFNMY 412

Query: 422 IAGFRGKRYHTIK 434
           I+ FRGKRYH I+
Sbjct: 413 ISAFRGKRYHPIE 425

>NDAI0A01930 Chr1 complement(430531..431883) [1353 bp, 450 aa] {ON}
           Anc_7.346 YLR203C
          Length = 450

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/417 (66%), Positives = 325/417 (77%), Gaps = 18/417 (4%)

Query: 32  TRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQSPSVDLRERAAKIRTLAHCPVTGKD 91
           + RH +GFV+NALG+           ENRFHPWDQSPS DLRERAA+IR LA CPVTGK+
Sbjct: 37  SNRHFVGFVKNALGMEPPPSPNEPAFENRFHPWDQSPSPDLRERAARIRALAKCPVTGKE 96

Query: 92  INYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQNQG 151
           INYTCP+SGIPTHHS+EAWE D  YH +K Y+ILKKVN++EHDLRSGR FPEF+FPQ+Q 
Sbjct: 97  INYTCPISGIPTHHSKEAWENDTNYHQNKIYDILKKVNVFEHDLRSGRSFPEFEFPQSQD 156

Query: 152 YDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLSYPITIGSLLHKFSPYSLNPKGPIT 211
           +D AV++ NWD+FFYTR F SMD+EFQLA VTKMLSYPITI S+LHK+ PY+L P GPIT
Sbjct: 157 HDCAVSMNNWDMFFYTRQFVSMDSEFQLATVTKMLSYPITIASILHKYCPYALEPNGPIT 216

Query: 212 LEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQLPGHVWKQLQFLFPEQN 271
           LEGLKS+AAL+Y+L   E       TK R MRIFILGARAE+QLP H+WKQ  +LFP QN
Sbjct: 217 LEGLKSIAALKYSLRHNE----FETTKERPMRIFILGARAESQLPEHIWKQFSYLFPFQN 272

Query: 272 FEIHFIGPEC----LYKRDKQEYVKSTTP----------VVQRVDETLKFIHRTDFFEVF 317
           FEI+FIGPEC           E   +TT           +V+R+DE L  ++ TDFF   
Sbjct: 273 FEINFIGPECSVLMNNNNMNAEETNTTTSGSMTEIRPNRIVKRIDERLNLVYHTDFFHTL 332

Query: 318 HEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDD 377
           H A+DFFPYD Y DVFFTFHPG+ASPE+  SWMGETMKALL+TKCAIFTTGFNK+DL  D
Sbjct: 333 HNARDFFPYDSYNDVFFTFHPGFASPENTKSWMGETMKALLDTKCAIFTTGFNKQDLLKD 392

Query: 378 LNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRGKRYHTIK 434
           +++V+  YGKE+D+LM P KNVFGSTKWELNDM+PQEVYQ+NMYIAGFRGKRYH +K
Sbjct: 393 IDIVQETYGKEVDMLMKPTKNVFGSTKWELNDMDPQEVYQYNMYIAGFRGKRYHAVK 449

>KNAG0C03750 Chr3 (740426..741700) [1275 bp, 424 aa] {ON} Anc_7.346
           YLR203C
          Length = 424

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/427 (63%), Positives = 323/427 (75%), Gaps = 7/427 (1%)

Query: 8   SGATQLYSHLLRRSSHNRLVLSHQTRRHLMGFVRNALGLXXXXXXXXXXXENRFHPWDQS 67
           S    L  H    S H  +V  +   R +MG+VRNA GL            NRFHPW++S
Sbjct: 4   SRVLTLGKHAPYESFHTEIV-RYTFHRTIMGYVRNAFGLEPRDSPDTPQISNRFHPWEES 62

Query: 68  PSVDLRERAAKIRTLAHCPVTGKDINYTCPLSGIPTHHSREAWEMDKAYHDSKKYEILKK 127
           P  DLR+RAA+I+TLA CPVTGK+INYTCP+SGIPTHHSR+AWE D  YH +K YE LKK
Sbjct: 63  PCADLRDRAARIKTLARCPVTGKNINYTCPISGIPTHHSRKAWEDDTDYHKNKTYEKLKK 122

Query: 128 VNIYEHDLRSGRPFPEFDFPQNQGYDKAVNLTNWDLFFYTRSFYSMDTEFQLAAVTKMLS 187
           VNIYEHDLRSGR FPEFDFP  QG D+AVNL NWDLF YTR FYSMDTEF LA VTKMLS
Sbjct: 123 VNIYEHDLRSGRSFPEFDFPAEQGRDRAVNLQNWDLFLYTRQFYSMDTEFHLATVTKMLS 182

Query: 188 YPITIGSLLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFIL 247
           YPITI S+LH+FSPY L P+GP+TLEGLKS+AALRYTLYP   ++ L  + N  MRIFI+
Sbjct: 183 YPITIASVLHEFSPYKLQPRGPVTLEGLKSIAALRYTLYPKLGKTSL--SNNSPMRIFIV 240

Query: 248 GARAEAQLPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVVQRVDETLKF 307
           G RAE+QLPGHVWKQLQ+LF E+ FEIHFIGPEC  K  K     ++TP++++VD+TL  
Sbjct: 241 GTRAESQLPGHVWKQLQYLFSERIFEIHFIGPECQLKEPKN----TSTPLIKKVDDTLSL 296

Query: 308 IHRTDFFEVFHEAQDFFPYDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTT 367
           I+   +F   H++ D FPY+PY DVFF FHPG+A P++   W+ ET+  LLETKCAIF T
Sbjct: 297 IYHPQYFHELHKSGDLFPYNPYKDVFFIFHPGFAYPDTRKLWLDETIPNLLETKCAIFHT 356

Query: 368 GFNKKDLTDDLNLVKSKYGKEMDILMDPVKNVFGSTKWELNDMNPQEVYQFNMYIAGFRG 427
           GFN+ D+T+D+ L+   Y  E+D+LM P+KNVFGS KWELND+NPQEVYQFNMYIAGFRG
Sbjct: 357 GFNEGDITNDVTLIDKCYRNEIDVLMKPIKNVFGSVKWELNDINPQEVYQFNMYIAGFRG 416

Query: 428 KRYHTIK 434
           KRYH IK
Sbjct: 417 KRYHPIK 423

>TBLA0H00280 Chr8 complement(43650..48146) [4497 bp, 1498 aa] {ON}
           Anc_2.406 YMR129W
          Length = 1498

 Score = 32.3 bits (72), Expect = 3.1,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 7/87 (8%)

Query: 326 YDPYMDVFFTFHPGYASPESHGSWMGETMKALLETKCAIFTTGFNKKDLTDDLNLVKSKY 385
           ++P+ D F  F+P +A+PE    ++   ++  + +  +I     N KDL+ + N     +
Sbjct: 371 FNPFHDSFCQFNPTFATPE----FINVPIR--INSTSSIKFIQLNYKDLSKNSNEQLLNF 424

Query: 386 -GKEMDILMDPVKNVFGSTKWELNDMN 411
             K+  ++ DP K +   TK +L  +N
Sbjct: 425 TNKDFKLIKDPTKLLSKKTKQQLQQIN 451

>Suva_10.243 Chr10 complement(442966..443868) [903 bp, 300 aa] {ON}
           YLR146C (REAL)
          Length = 300

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 42/104 (40%), Gaps = 13/104 (12%)

Query: 195 LLHKFSPYSLNPKGPITLEGLKSLAALRYTLYPLENRSLLTATKNRAMRIFILGARAEAQ 254
           LLH    ++LNP G + ++  +++           N   L   KN A R+F         
Sbjct: 193 LLH----HALNPNGIVIMQSSENIWL---------NLDYLRDLKNTAKRVFPNTEYCYTM 239

Query: 255 LPGHVWKQLQFLFPEQNFEIHFIGPECLYKRDKQEYVKSTTPVV 298
           +P +   QL  +    N  I  I P+ L    +QE +K   P +
Sbjct: 240 VPTYTSGQLGLIVCSNNDSIPLIAPQRLLSGQEQEQLKYYNPQI 283

>TBLA0C04200 Chr3 (1013461..1016016) [2556 bp, 851 aa] {ON} Anc_4.87
           YGR150C
          Length = 851

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 99  SGIPTHHSREAWEMDKAYHDSKKYEILKKVNIYEHDLRSGRPFPEFDFPQN 149
           + +PT ++  +  +D  Y  S K++IL+  NIYE  L++   F ++D   N
Sbjct: 698 NSVPTSNNSLSKNID--YLGSLKHKILRNENIYEVTLKAAMKFNDYDMATN 746

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,372,754
Number of extensions: 2077440
Number of successful extensions: 4409
Number of sequences better than 10.0: 27
Number of HSP's gapped: 4480
Number of HSP's successfully gapped: 27
Length of query: 436
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 323
Effective length of database: 40,524,141
Effective search space: 13089297543
Effective search space used: 13089297543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)