Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.2607.351ON26026012131e-170
YLR201C (COQ9)7.351ON26026010981e-153
Suva_10.2967.351ON26026010351e-143
Skud_12.2657.351ON26026010321e-142
NCAS0E028707.351ON2612617473e-99
Kpol_530.307.351ON2602466926e-91
TDEL0C019707.351ON2602616865e-90
NDAI0E044707.351ON2642646743e-88
TPHA0F029807.351ON2642596727e-88
ZYRO0F11726g7.351ON2512566673e-87
TBLA0E004507.351ON2792606642e-86
CAGL0A03949g7.351ON2682496581e-85
SAKL0F11396g7.351ON2542466482e-84
KNAG0B026207.351ON2652606362e-82
KLTH0H01232g7.351ON2572476334e-82
KLLA0D12320g7.351ON2502466203e-80
KAFR0L014807.351ON2642455996e-77
Kwal_56.246447.351ON2582615928e-76
ACL147W7.351ON2462465771e-73
Ecym_47227.351ON2532585752e-73
ZYRO0F05214gsingletonON34190711.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.260
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   471   e-170
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   427   e-153
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   403   e-143
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   402   e-142
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   292   3e-99
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   271   6e-91
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   268   5e-90
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   264   3e-88
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   263   7e-88
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   261   3e-87
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   260   2e-86
CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   258   1e-85
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   254   2e-84
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   249   2e-82
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   248   4e-82
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   243   3e-80
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   235   6e-77
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   232   8e-76
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   226   1e-73
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   226   2e-73
ZYRO0F05214g Chr6 complement(436282..437307) [1026 bp, 341 aa] {...    32   1.4  

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  471 bits (1213), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 230/260 (88%), Positives = 230/260 (88%)

Query: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60
           MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE
Sbjct: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60

Query: 61  RSIVESLNELGYXXXXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTP 120
           RSIVESLNELGY                    TAVMELIKFQLVDKRYRLTEAINPDVTP
Sbjct: 61  RSIVESLNELGYPSSMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTP 120

Query: 121 QYKLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180
           QYKLPS          MDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE
Sbjct: 121 QYKLPSLEHLLLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEE 240
           KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLVRG 260
           FAWYTLMSTVNLVKSQLVRG
Sbjct: 241 FAWYTLMSTVNLVKSQLVRG 260

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  427 bits (1098), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 210/260 (80%), Positives = 217/260 (83%)

Query: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60
           MLCRN  R GC  FRLYH NPIEHVK  HIKPLTYGKESPQYKVLSLAL+++VP+HGFSE
Sbjct: 1   MLCRNTARTGCKFFRLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSE 60

Query: 61  RSIVESLNELGYXXXXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTP 120
           RSIVESLNELGY                    TAVMELIKFQLVDKRYRLTE INPDVTP
Sbjct: 61  RSIVESLNELGYPSSMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTP 120

Query: 121 QYKLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180
           QYKLPS          MDKPIGG LSELMSQLAIPS FLFETAIPELHRLSDDMIYFSNE
Sbjct: 121 QYKLPSLEHLLLKRLEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEE 240
           KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYK+TF FAK KL+RVMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLVRG 260
           FAWYTLMSTVNL+KSQLVRG
Sbjct: 241 FAWYTLMSTVNLIKSQLVRG 260

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  403 bits (1035), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/260 (75%), Positives = 210/260 (80%)

Query: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60
           M  RN +RK   S RLYH NPIEHV   HIKPL YGK+SPQYKVLSLAL++YVPKHGF+E
Sbjct: 1   MFSRNAVRKASASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTE 60

Query: 61  RSIVESLNELGYXXXXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTP 120
           RSIVESLN+LGY                    TAVMEL+KFQLVDKRYRLTE INPDVTP
Sbjct: 61  RSIVESLNKLGYPSSMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTP 120

Query: 121 QYKLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180
            YKLPS          MDKP+G  L++LMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE
Sbjct: 121 HYKLPSLEHLLLKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEE 240
           KDHHDSAWYAKRLAVSSTYIGS+LFMAQDKSH++ +TF FAK KL+RVMRLGEYYNNTEE
Sbjct: 181 KDHHDSAWYAKRLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLVRG 260
           FAWYTLMSTVNLVKSQL RG
Sbjct: 241 FAWYTLMSTVNLVKSQLARG 260

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  402 bits (1032), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/260 (75%), Positives = 211/260 (81%)

Query: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60
           M CRN+ R GC   RLYH NPIEHVK  HIKPLTYGK+SPQYKVLSLAL +YVPKHGFSE
Sbjct: 1   MFCRNVARNGCKFHRLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSE 60

Query: 61  RSIVESLNELGYXXXXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTP 120
           RSIVESLN+LGY                    TAVMEL+KFQLVDKRYRLTE INPDVT 
Sbjct: 61  RSIVESLNKLGYPSSMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTS 120

Query: 121 QYKLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180
           +YKLPS          MDK IGG L++LMSQLA+PS  LFETAIPELHRLSDDMIYFSNE
Sbjct: 121 RYKLPSLEHLLLKRLEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNE 180

Query: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEE 240
           +DHHDSAWYAKRLAVSSTYIGSKLFMAQDKSH++K+TF FAK KL++VMRLGEYYNNTEE
Sbjct: 181 EDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEE 240

Query: 241 FAWYTLMSTVNLVKSQLVRG 260
           FAWYTLMSTVNLVKSQL RG
Sbjct: 241 FAWYTLMSTVNLVKSQLARG 260

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  292 bits (747), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 147/261 (56%), Positives = 182/261 (69%), Gaps = 1/261 (0%)

Query: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60
           ML R+IL+KG  S+R YHP+  E+VK   + PLTY KES QYK+LS AL ++VPKHGF E
Sbjct: 1   MLNRSILKKGLFSYRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFKE 60

Query: 61  RSIVESLNELGYXXXXXXXXXXXXXXXXXXXXT-AVMELIKFQLVDKRYRLTEAINPDVT 119
           ++I +SLNELG+                    + AVMELIKFQLV KRY LTE + PD T
Sbjct: 61  KAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDTT 120

Query: 120 PQYKLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179
           P+ +LPS          MDK IG  +  L ++LA PS FLF+ A+PELHRLSDDMIYFSN
Sbjct: 121 PKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFSN 180

Query: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTE 239
           EKDHHD AWY KRL VS  Y+ SKL+MAQD S +++DT  FAK KL+R+M+LGEYYNNTE
Sbjct: 181 EKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNTE 240

Query: 240 EFAWYTLMSTVNLVKSQLVRG 260
           E+AWY  M + NLV+++L R 
Sbjct: 241 EYAWYMFMVSTNLVRARLARS 261

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  271 bits (692), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 172/246 (69%), Gaps = 1/246 (0%)

Query: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYXX 74
           R YHPNP E+V    + PL YGK+S QYK+LS +L+  VP+ GF+ER+IV S+N LGY  
Sbjct: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75

Query: 75  XXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSXXXXXXXX 134
                             TA+MEL+KF LV KRY+L+E I  D TP  +LPS        
Sbjct: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLD-TPVEELPSLEDLLIKR 134

Query: 135 XXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
             MD PIG  LS+L++QL+IP  FL +T++PELHRL+DDMIYFS+EKDH D AWYAKR+ 
Sbjct: 135 LKMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMG 194

Query: 195 VSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           VS+ Y+ SKLFMAQD+S  Y DTF+FAK KL R+M+LG+YYNN EE+AWY LM+++N+ K
Sbjct: 195 VSTAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAK 254

Query: 255 SQLVRG 260
           S+  RG
Sbjct: 255 SKAARG 260

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  268 bits (686), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 140/261 (53%), Positives = 178/261 (68%), Gaps = 2/261 (0%)

Query: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIK-PLTYGKESPQYKVLSLALEQYVPKHGFS 59
           M+ + ++       R Y P   E++   + + PL YGK+SPQYKVLS  L + VP +GF+
Sbjct: 1   MISKRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFN 60

Query: 60  ERSIVESLNELGYXXXXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVT 119
           ER+IV SLNELGY                     A+MEL+KF LVDKR  LTE I+ + T
Sbjct: 61  ERAIVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLE-T 119

Query: 120 PQYKLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179
           P  +LPS          M+ P+   LS+L+SQL+IP  FL + ++PELHRLSDDMIYFS 
Sbjct: 120 PVDQLPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFST 179

Query: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTE 239
           EKDH+D AWY+KRLAVS  Y+ S+LFMAQD+S +YK+TF+FA+ KL+RV  LGEYYNNTE
Sbjct: 180 EKDHNDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTE 239

Query: 240 EFAWYTLMSTVNLVKSQLVRG 260
           EFAWYTL+ST+NLVKSQL RG
Sbjct: 240 EFAWYTLLSTINLVKSQLARG 260

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  264 bits (674), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 136/264 (51%), Positives = 171/264 (64%), Gaps = 4/264 (1%)

Query: 1   MLCRNILRKGC--TSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGF 58
           ML   IL K    +  R +H N +E+ K+  + PLTY K+S QYK+LS AL ++VPK GF
Sbjct: 1   MLLNRILSKNVKLSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGF 60

Query: 59  SERSIVESLNELGYXXXXXXXXXXXXXXXXXXXXT-AVMELIKFQLVDKRYRLTEAINPD 117
           ++ +I  SLNEL                      + AVMEL+KFQLV KRY+LTE I P 
Sbjct: 61  TDEAITSSLNELDLSSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPY 120

Query: 118 V-TPQYKLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIY 176
           + T + KLPS          MD+P+   LS L +QL IPS  LF  A+PEL  LSDD+IY
Sbjct: 121 IETAKDKLPSLETLLIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIY 180

Query: 177 FSNEKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYN 236
           FSNEKDHHD AWYAKRL VS  Y+ SKL+M ++   N+  T DFAK KL+R+M LGEYYN
Sbjct: 181 FSNEKDHHDMAWYAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYN 240

Query: 237 NTEEFAWYTLMSTVNLVKSQLVRG 260
           NTEE+AWYTLM ++NLVK++L RG
Sbjct: 241 NTEEYAWYTLMVSMNLVKARLARG 264

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  263 bits (672), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 135/259 (52%), Positives = 172/259 (66%), Gaps = 2/259 (0%)

Query: 4   RNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSI 63
           R I RK   + R +HP   E+V  + + P TY K+SPQ+K+LS A++  V K GFSER+I
Sbjct: 6   RLIFRKSGVNARFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTVTKFGFSERAI 65

Query: 64  VESLNELGYXXXXXXXXXXXXXXXXXXXXTA--VMELIKFQLVDKRYRLTEAINPDVTPQ 121
           +E++ EL                      ++  VMEL+KF LV KRYR+ E ++P    Q
Sbjct: 66  IEAMKELKIENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMIEGLDPLTMQQ 125

Query: 122 YKLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEK 181
            +LPS          MD PIG  +S  MSQL IP  FL ++A+PELHRL+DDMIYFSNEK
Sbjct: 126 EELPSLESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLADDMIYFSNEK 185

Query: 182 DHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEF 241
           DHHD AWY+KRL VSS YI SKLFMAQD S NYK+T  FAK KL +VMRLG+YYNNTEE+
Sbjct: 186 DHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRLGDYYNNTEEY 245

Query: 242 AWYTLMSTVNLVKSQLVRG 260
           AWY L+++VN+VKS++ R 
Sbjct: 246 AWYVLLNSVNMVKSRMSRA 264

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  261 bits (667), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 130/256 (50%), Positives = 173/256 (67%), Gaps = 6/256 (2%)

Query: 6   ILRKGC-TSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIV 64
           + ++ C  S R YHP+  EH+ S  + PL YG +SPQY VLS AL+  VP  GF+ER+IV
Sbjct: 1   MFKRLCQVSLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIV 60

Query: 65  ESLNELGYXXXXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTPQYKL 124
            SLN+L Y                     AVMEL+KF LV KR +L++    D++ + K 
Sbjct: 61  HSLNQLNYPSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQ----DLSSEEK- 115

Query: 125 PSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHH 184
           PS          ++ PI G LS+L+S +++P  F  +TA+PELHRLSDD+IY+SNEKDHH
Sbjct: 116 PSLEDLFIKRLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHH 175

Query: 185 DSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWY 244
           D AWY+KRL +S  Y+ S+LFMAQDKSHNY++TF FA+ KL R M+LGEYYNNTEE+ WY
Sbjct: 176 DFAWYSKRLGISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWY 235

Query: 245 TLMSTVNLVKSQLVRG 260
           TL++++NL KSQ+ RG
Sbjct: 236 TLLNSINLAKSQMARG 251

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  260 bits (664), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 173/260 (66%), Gaps = 6/260 (2%)

Query: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60
           +L ++I   G    R Y+    +  KS H++PL YGK+S QY++L  A++  VP  GF+E
Sbjct: 26  LLSKHIKNNG---IRTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTE 82

Query: 61  RSIVESLNELGYXXXXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTP 120
           R+I+ S+N+LGY                     AV+EL+KF LV KR +L+E I+P+   
Sbjct: 83  RAIINSINKLGYNSSMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGIDPETK- 141

Query: 121 QYKLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNE 180
              LPS          MDK I   L+E++++L+IP  FL ET+IPEL RLSDDMIYFSNE
Sbjct: 142 --DLPSLEYLLLKRLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNE 199

Query: 181 KDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEE 240
           KDHHD AWY+KRLAVS+TYI S++FMAQD S +   T +FA+ KLN+VM LGEYYNNTEE
Sbjct: 200 KDHHDMAWYSKRLAVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEE 259

Query: 241 FAWYTLMSTVNLVKSQLVRG 260
           F W+TLM++VN+VKSQL R 
Sbjct: 260 FLWFTLMTSVNIVKSQLARS 279

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  258 bits (658), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 164/249 (65%), Gaps = 1/249 (0%)

Query: 11  CTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNEL 70
            ++ R YHP   E+V     +PLTY  ESP++K+LS  +E  VP+HGF+E++IV SLN +
Sbjct: 20  LSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAM 79

Query: 71  GYXXXXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSXXXX 130
                                  AVMELIKFQLV+KR+R+ E I  ++    KLPS    
Sbjct: 80  KMPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGIT-EIAEASKLPSLESL 138

Query: 131 XXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYA 190
                 MD PI   L+++ +QL +PS F+   ++PEL RL+DDMIY+SNEKDHHD AWY 
Sbjct: 139 LLKRLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYT 198

Query: 191 KRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTV 250
           KR A+++TY+ SK FMAQDKSHN+ +T +FA+ KL++VM LG+YYNN EEF W+TLMS V
Sbjct: 199 KRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAV 258

Query: 251 NLVKSQLVR 259
           NL KSQ+ R
Sbjct: 259 NLTKSQMAR 267

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  254 bits (648), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 166/246 (67%), Gaps = 3/246 (1%)

Query: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYXX 74
           R YHPN +EH  S  + PL Y K+SPQ+K+L+ AL++ VPK+GF+ER++  S ++LGY  
Sbjct: 12  RGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGYSS 71

Query: 75  XXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSXXXXXXXX 134
                              AV+EL+KF LV KRY LT+ +  D T +   PS        
Sbjct: 72  SFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGV-ADGTLES--PSLENLFLKR 128

Query: 135 XXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
             M+KPI   LS+L+S LA+P  FL E AIPELHRLSDDM+YFSNE DH+D AWY+KRLA
Sbjct: 129 LEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRLA 188

Query: 195 VSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           +S+ Y+ S+LFMAQDKS +Y+DT  FAK KL  + +LGE YNN EE+AWYTL+S+++L K
Sbjct: 189 ISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLAK 248

Query: 255 SQLVRG 260
           SQ+ R 
Sbjct: 249 SQMTRS 254

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  249 bits (636), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 124/260 (47%), Positives = 165/260 (63%), Gaps = 1/260 (0%)

Query: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60
           +L  ++ R+   S RLYHPNPIE+  S  + PLTY  +SPQ ++L+  L+  VP  GF+E
Sbjct: 5   LLKNSVSRRALLSTRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHWGFTE 64

Query: 61  RSIVESLNELGYXXXXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINP-DVT 119
           R++++S+  +GY                     AVMEL+KF LV KR+ LTE++    + 
Sbjct: 65  RALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAAAGLG 124

Query: 120 PQYKLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179
               LPS          MD P+   L +L +QLA+PS F+   A+PEL RLSDDMIYFSN
Sbjct: 125 SPAALPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMIYFSN 184

Query: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTE 239
           EKDH D+AWY+KRL VS  Y  SKLFMAQD S N +DT +FA+ KL+R+M LGEYYNN E
Sbjct: 185 EKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYYNNVE 244

Query: 240 EFAWYTLMSTVNLVKSQLVR 259
           E+AWY++M+TVN  K+   R
Sbjct: 245 EYAWYSIMTTVNRAKAGFSR 264

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  248 bits (633), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 123/247 (49%), Positives = 164/247 (66%), Gaps = 1/247 (0%)

Query: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYXX 74
           RLYHP+ +EH  +H   PLTYG  S Q+KVL  AL ++VP +GF+ER++V SLN+L    
Sbjct: 11  RLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDLGP 70

Query: 75  XXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTPQ-YKLPSXXXXXXX 133
                              AV+ELIKF LV KRY LT+ ++P  T    + P+       
Sbjct: 71  SLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLFHR 130

Query: 134 XXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRL 193
              ++KPI   L++L+S L+IP  FL +TA+PELHRLSDDM+YFS E D +D AWY+KR+
Sbjct: 131 RLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSKRI 190

Query: 194 AVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLV 253
           A+S  ++ S+LFMAQD+S NY DTF+FA  KL+ V +LG+YYNNTEE+ WYTL+ +VNL 
Sbjct: 191 ALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVNLA 250

Query: 254 KSQLVRG 260
           KSQL R 
Sbjct: 251 KSQLTRS 257

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  243 bits (620), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 118/246 (47%), Positives = 168/246 (68%), Gaps = 2/246 (0%)

Query: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYXX 74
           RLYHPN +EH     IKPLTYG +S Q+KVLS AL ++VP++GF+ER+IV+SLNELG   
Sbjct: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGMGS 66

Query: 75  XXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSXXXXXXXX 134
                              +V+EL+KF LV KR +L   +  D      LP         
Sbjct: 67  SYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLPLD--SDKPLPDLKTLFLQR 124

Query: 135 XXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
             +++ +   LS+L+S +++P  FL  TA+ ELH+L+DDMI++SNE+DH+D AWY+KR+A
Sbjct: 125 LKLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRIA 184

Query: 195 VSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           +S+ Y+ S+LFMAQDKSHN+++T +FA+ KLN+V +LG  YNNTEE+ W+TL+S++NL K
Sbjct: 185 LSTAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLAK 244

Query: 255 SQLVRG 260
           SQ+ RG
Sbjct: 245 SQITRG 250

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  235 bits (599), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 120/245 (48%), Positives = 157/245 (64%), Gaps = 5/245 (2%)

Query: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYXX 74
           RLYHP   E+V    I PLTY  +S Q K+LS +L++YVP  GF+E+SI++S+N+LGY  
Sbjct: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83

Query: 75  XXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSXXXXXXXX 134
                              AV+ELIK+ LV KR  LT+      T      +        
Sbjct: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKRIELTKD-----TNDNTTTTLKELLLKR 138

Query: 135 XXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
             MD PI   L  L +QLA P  F+F+ ++PEL +L+DDMI+FSNEKDHHD AWY+KRLA
Sbjct: 139 LEMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLA 198

Query: 195 VSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           VS  Y+ SK+FM QD S+N++ T DFA  K++RVM LGEYYNN EE+AW+TLM+++NLVK
Sbjct: 199 VSMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVK 258

Query: 255 SQLVR 259
           SQ  R
Sbjct: 259 SQFSR 263

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  232 bits (592), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 164/261 (62%), Gaps = 4/261 (1%)

Query: 1   MLCRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSE 60
           ML R+    G    R Y PNP+E+  +  + PL YG +S Q+KVL  AL+ +VP +GF+E
Sbjct: 1   MLARSFRTLGR---RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNE 57

Query: 61  RSIVESLNELGYXXXXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAIN-PDVT 119
           R++V SLN+LG                      AV+EL+KF LV KRY LT+ ++     
Sbjct: 58  RALVASLNDLGLGSQVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCA 117

Query: 120 PQYKLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSN 179
              + P+          ++ PI   +++L++ LA+P  FL ++A+PELHRLSDDMIYFS 
Sbjct: 118 SPAEPPALETLFHKRLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSK 177

Query: 180 EKDHHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTE 239
           E D +D AWY+KR A+S  ++ S+LFMAQDKS NY DTF+FA  KL+ V +LG+YY NTE
Sbjct: 178 EPDANDFAWYSKRAAISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTE 237

Query: 240 EFAWYTLMSTVNLVKSQLVRG 260
           E+ WYTL+ +VNL KSQ+ R 
Sbjct: 238 EYMWYTLLMSVNLAKSQITRS 258

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  226 bits (577), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 113/246 (45%), Positives = 152/246 (61%), Gaps = 6/246 (2%)

Query: 15  RLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNELGYXX 74
           RLYHPN +EH   + ++PL Y ++SPQYKVL  ALE +VP  GF+ER+IV +  +LGY  
Sbjct: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGS 66

Query: 75  XXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSXXXXXXXX 134
                             +AV+EL+KF LV KR  L +A         +L          
Sbjct: 67  AVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALADAAAQGNVSMEQL------FLQR 120

Query: 135 XXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194
              D+P+ G L++L+S L++P  FL  TA+PEL RLSDD+IY+S EKDH D AWY+KR A
Sbjct: 121 VEADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAA 180

Query: 195 VSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTVNLVK 254
           V+  Y+ + LFMA+D+S   ++T  FA+ +L +V  LG  YNN EEFAWY L+  +NLVK
Sbjct: 181 VAMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVK 240

Query: 255 SQLVRG 260
           SQL RG
Sbjct: 241 SQLTRG 246

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  226 bits (575), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 157/258 (60%), Gaps = 9/258 (3%)

Query: 3   CRNILRKGCTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERS 62
           C  I+  G    R YH N  E+   + ++PL YG+ SPQYKVL+ ALE+YVP  GF + +
Sbjct: 5   CHRIMLGGFR--RFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSA 62

Query: 63  IVESLNELGYXXXXXXXXXXXXXXXXXXXXTAVMELIKFQLVDKRYRLTEAINPDVTPQY 122
           IV++ NELGY                    T+V EL+KF LV KRY L E        Q 
Sbjct: 63  IVDAANELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRYGLQE-------DQE 115

Query: 123 KLPSXXXXXXXXXXMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKD 182
              +           +K +G  L E++S LAIP  FL  T +PEL +L+DDMIY+S EKD
Sbjct: 116 GTKTLEELFLKRLEANKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKD 175

Query: 183 HHDSAWYAKRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFA 242
            +D AWY+KRLAVS  YI ++LFMA+D S N++ T +FAK ++N++  +G  YNN EEFA
Sbjct: 176 FNDLAWYSKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFA 235

Query: 243 WYTLMSTVNLVKSQLVRG 260
           W+ L++TVNL +SQLVRG
Sbjct: 236 WFQLLTTVNLARSQLVRG 253

>ZYRO0F05214g Chr6 complement(436282..437307) [1026 bp, 341 aa] {ON}
           similar to uniprot|Q12068 Saccharomyces cerevisiae
           YOL151W and similar to uniprot|Q03049 Saccharomyces
           cerevisiae YDR541C
          Length = 341

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 7/90 (7%)

Query: 146 SELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLAVSSTYIGSKLF 205
           S+ + +L I S F    AI +  +L+D    F+ EK  + + W   +  VS+ Y GSK F
Sbjct: 116 SQTVKRLVITSSF---AAILDPSKLADKDAVFT-EKSWNPTTWEGAQSDVSNAYRGSKKF 171

Query: 206 ---MAQDKSHNYKDTFDFAKHKLNRVMRLG 232
               A +     KD+ +F    +N V+  G
Sbjct: 172 AEKTAWEFLEENKDSVNFKLTTVNPVLVFG 201

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,554,797
Number of extensions: 923195
Number of successful extensions: 2185
Number of sequences better than 10.0: 22
Number of HSP's gapped: 2201
Number of HSP's successfully gapped: 22
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)