Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.2597.352ON1141145853e-79
Suva_10.2957.352ON1141145123e-68
YLR200W (YKE2)7.352ON1141145115e-68
Skud_12.2647.352ON1141144882e-64
KAFR0L014907.352ON1071063986e-51
NCAS0E028607.352ON1051033803e-48
TPHA0F029907.352ON1071063787e-48
Kpol_530.297.352ON1071073701e-46
TBLA0E004407.352ON1151113702e-46
ZYRO0F11748g7.352ON1091063657e-46
NDAI0E044607.352ON1061023612e-45
TDEL0C019607.352ON1071063613e-45
KNAG0B026107.352ON1191033615e-45
CAGL0A03971g7.352ON1061003511e-43
ACL146C7.352ON1071033501e-43
KLLA0D12298g7.352ON115993511e-43
SAKL0F11418g7.352ON1151033492e-43
Ecym_47217.352ON1071053353e-41
KLTH0H01210g7.352ON1131043259e-40
Kwal_56.246487.352ON1131053223e-39
KLTH0E11374g8.489ON21639690.37
Kpol_272.1singletonON1555104680.67
Suva_10.2248.326ON76465680.75
TBLA0G017306.289ON74974671.00
KAFR0A080502.5ON45065661.1
Smik_12.1948.326ON76975661.1
Kpol_458.5singletonON1022104661.3
YLR131C (ACE2)8.326ON77065651.6
Suva_4.1914.238ON178252642.5
KNAG0L011607.186ON117054633.4
YNL167C (SKO1)2.86ON64761633.4
Suva_9.254na 1ON23435605.9
Skud_12.2008.326ON76765616.0
TBLA0A036205.414ON97048606.5
Kpol_274.88.125ON47794606.7
KLTH0E14146gna 2ON19642606.9
KLTH0H06622g6.114ON22381607.0
KLTH0C05346g7.447ON10254578.7
SAKL0G11286g5.260ON83479599.7
YBL090W (MRP21)7.421ON17751589.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.259
         (114 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W...   229   3e-79
Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W...   201   3e-68
YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subuni...   201   5e-68
Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W...   192   2e-64
KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {O...   157   6e-51
NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.35...   150   3e-48
TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON...   150   7e-48
Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON} (74361..74...   147   1e-46
TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352 ...   147   2e-46
ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {O...   145   7e-46
NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7....   143   2e-45
TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.35...   143   3e-45
KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.35...   143   5e-45
CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {O...   139   1e-43
ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON} Synt...   139   1e-43
KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} simil...   139   1e-43
SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {O...   139   2e-43
Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar ...   133   3e-41
KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar...   129   9e-40
Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa] ...   128   3e-39
KLTH0E11374g Chr5 (1017534..1018184) [651 bp, 216 aa] {ON} some ...    31   0.37 
Kpol_272.1 s272 complement(6450..11117) [4668 bp, 1555 aa] {ON} ...    31   0.67 
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    31   0.75 
TBLA0G01730 Chr7 complement(451840..454089) [2250 bp, 749 aa] {O...    30   1.00 
KAFR0A08050 Chr1 complement(1612166..1613518) [1353 bp, 450 aa] ...    30   1.1  
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    30   1.1  
Kpol_458.5 s458 (34795..37863) [3069 bp, 1022 aa] {ON} (34795..3...    30   1.3  
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    30   1.6  
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    29   2.5  
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    29   3.4  
YNL167C Chr14 complement(319416..321359) [1944 bp, 647 aa] {ON} ...    29   3.4  
Suva_9.254 Chr9 complement(408977..409681) [705 bp, 234 aa] {ON}...    28   5.9  
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    28   6.0  
TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.4...    28   6.5  
Kpol_274.8 s274 complement(13824..15257) [1434 bp, 477 aa] {ON} ...    28   6.7  
KLTH0E14146g Chr5 complement(1251360..1251950) [591 bp, 196 aa] ...    28   6.9  
KLTH0H06622g Chr8 complement(583819..584490) [672 bp, 223 aa] {O...    28   7.0  
KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar...    27   8.7  
SAKL0G11286g Chr7 complement(963289..965792,965887..965887) [250...    27   9.7  
YBL090W Chr2 (48825..49358) [534 bp, 177 aa] {ON}  MRP21Mitochon...    27   9.7  

>Smik_12.259 Chr12 (496033..496377) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  229 bits (585), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 114/114 (100%), Positives = 114/114 (100%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD
Sbjct: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR 114
           QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR
Sbjct: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR 114

>Suva_10.295 Chr10 (521814..522158) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  201 bits (512), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 98/114 (85%), Positives = 107/114 (93%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           MSELG KYQHLQ ELEEFIVARQKLETQLQENKIVNEEFDQL+E+TPVYKLTGNVLLPV+
Sbjct: 1   MSELGAKYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQLKEDTPVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR 114
           QSEARGNV+KRLEFIE EI RCEKNI+ KQE+LE+VRN+L+KLNNAA A GPDR
Sbjct: 61  QSEARGNVEKRLEFIETEIKRCEKNIRGKQEELEQVRNELVKLNNAATAAGPDR 114

>YLR200W Chr12 (549012..549356) [345 bp, 114 aa] {ON}  YKE2Subunit
           of the heterohexameric Gim/prefoldin protein complex
           involved in the folding of alpha-tubulin, beta-tubulin,
           and actin
          Length = 114

 Score =  201 bits (511), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 99/114 (86%), Positives = 107/114 (93%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           MSELG KYQ LQ ELEEFIVARQKLETQLQENKIVNEEFDQLEE+TPVYKLTGNVLLPV+
Sbjct: 1   MSELGAKYQQLQNELEEFIVARQKLETQLQENKIVNEEFDQLEEDTPVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR 114
           QSEAR NVDKRLEFIE EITRCEKNI+DKQE+LEK+R++LIKLNN AA+TGP R
Sbjct: 61  QSEARTNVDKRLEFIETEITRCEKNIRDKQEELEKMRSELIKLNNTAASTGPGR 114

>Skud_12.264 Chr12 (495654..495998) [345 bp, 114 aa] {ON} YLR200W
           (REAL)
          Length = 114

 Score =  192 bits (488), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 93/114 (81%), Positives = 105/114 (92%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           MSELG +YQHLQ ELEEFIVARQKLETQLQENKIVNEEFDQ+ ++TPVYKLTGNVLLPV+
Sbjct: 1   MSELGAEYQHLQSELEEFIVARQKLETQLQENKIVNEEFDQIGDDTPVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR 114
           QSEARGNVDKRLEFIE EI RCE+NI++KQ++LEKVRN+LIKLNNA A  G +R
Sbjct: 61  QSEARGNVDKRLEFIETEIKRCERNIREKQDELEKVRNELIKLNNATAVVGAER 114

>KAFR0L01490 Chr12 complement(275355..275678) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  157 bits (398), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 78/106 (73%), Positives = 89/106 (83%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           MSEL  +YQ LQ ELEE IVARQKLETQLQENKIVN+EF  L+E T VYKLTGNVLLP++
Sbjct: 1   MSELAAQYQKLQSELEELIVARQKLETQLQENKIVNDEFKSLKEETQVYKLTGNVLLPIE 60

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNA 106
           Q EARGNVDKRLEFIE EITRCE NIK KQ ++E +RN+L+KL + 
Sbjct: 61  QDEARGNVDKRLEFIEKEITRCEGNIKSKQTEIENIRNELVKLRSG 106

>NCAS0E02860 Chr5 (561551..561868) [318 bp, 105 aa] {ON} Anc_7.352
           YLR200W
          Length = 105

 Score =  150 bits (380), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 90/103 (87%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           M++L  +YQ LQ ELE FI+ARQKLETQLQENKIV +EF+QL + T VYKLTGNVLLPV+
Sbjct: 1   MADLPAQYQSLQSELESFIIARQKLETQLQENKIVMDEFEQLVDETKVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKL 103
           Q EAR NV+KRLEFI++EIT+CEKNIK KQE+LEKVR ++IK+
Sbjct: 61  QDEARSNVEKRLEFIQSEITKCEKNIKQKQEELEKVRAEIIKM 103

>TPHA0F02990 Chr6 complement(656466..656789) [324 bp, 107 aa] {ON}
           Anc_7.352 YLR200W
          Length = 107

 Score =  150 bits (378), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 71/106 (66%), Positives = 92/106 (86%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           MS++  KYQ +QGELEE I+ARQKLETQLQENKIVN+EF+ L E+TP+YKLTGNV+LP++
Sbjct: 1   MSDVAAKYQSVQGELEELIIARQKLETQLQENKIVNDEFNDLNEDTPIYKLTGNVMLPIE 60

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNA 106
           Q EA+ NV+KRLEFIE EI RCE+NIK KQ++L+K+R +L+K+  A
Sbjct: 61  QFEAKSNVEKRLEFIENEIKRCEENIKTKQDELDKLRGELMKMRGA 106

>Kpol_530.29 s530 (74361..74684) [324 bp, 107 aa] {ON}
           (74361..74684) [324 nt, 108 aa]
          Length = 107

 Score =  147 bits (370), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           MS+L  KYQ +QGELEE IVAR++LETQLQENKIVNEEF+ L+E+T VYKLTGNVLLPV+
Sbjct: 1   MSDLANKYQKIQGELEEVIVARRQLETQLQENKIVNEEFEGLKEDTQVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAA 107
           Q EAR NV+KRLEFIEAEI +CE NIK KQ +L K+R++L+K    A
Sbjct: 61  QFEARSNVEKRLEFIEAEIKKCEDNIKSKQTELNKLRDELMKGRGGA 107

>TBLA0E00440 Chr5 (82880..83227) [348 bp, 115 aa] {ON} Anc_7.352
           YLR200W
          Length = 115

 Score =  147 bits (370), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 73/111 (65%), Positives = 89/111 (80%), Gaps = 5/111 (4%)

Query: 2   SELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQ 61
           +EL TKYQ  Q ELE FIV RQKLETQLQENKIVN+EF++L+E T V+KLTGNVLLP++Q
Sbjct: 4   NELATKYQTFQNELEGFIVTRQKLETQLQENKIVNDEFEKLKEETKVFKLTGNVLLPIEQ 63

Query: 62  SEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGP 112
            EAR N+DKRLEFI+ EI RCEKNIK KQ ++EK+R++L+     A A  P
Sbjct: 64  DEARSNIDKRLEFIQTEIDRCEKNIKAKQAEMEKIRSELM-----ATAPAP 109

>ZYRO0F11748g Chr6 complement(960734..961063) [330 bp, 109 aa] {ON}
           highly similar to uniprot|P52553 Saccharomyces
           cerevisiae YLR200W YKE2 Yeast nuclear gene
          Length = 109

 Score =  145 bits (365), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 73/106 (68%), Positives = 88/106 (83%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           MSEL  +YQ LQGELE FIVARQKLETQLQENKIV++EF+ L+ ++ VYKLTGNVLLPV+
Sbjct: 1   MSELAAQYQKLQGELENFIVARQKLETQLQENKIVDDEFNGLKSDSKVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNA 106
           Q +AR NV KRLEFI+ EI RCE NIK KQE+ E+V+ +LIKL + 
Sbjct: 61  QDDARTNVSKRLEFIQTEIDRCENNIKGKQEEQERVKAELIKLRSG 106

>NDAI0E04460 Chr5 (1005674..1005994) [321 bp, 106 aa] {ON} Anc_7.352
           YLR200W
          Length = 106

 Score =  143 bits (361), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 71/102 (69%), Positives = 87/102 (85%)

Query: 2   SELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQ 61
           S L +KYQ LQGELE+ I+ARQKLETQLQENKIV EEF+QL   + VYKLTGNVLLPVDQ
Sbjct: 3   SNLPSKYQVLQGELEDLIMARQKLETQLQENKIVIEEFNQLPSESQVYKLTGNVLLPVDQ 62

Query: 62  SEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKL 103
            EA  NVDKRLEFI+ EI+RCE NIK+KQ++L+ VR++++K+
Sbjct: 63  EEAHSNVDKRLEFIQTEISRCENNIKNKQQELDNVRSEILKM 104

>TDEL0C01960 Chr3 (343261..343584) [324 bp, 107 aa] {ON} Anc_7.352
           YLR200W
          Length = 107

 Score =  143 bits (361), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 72/106 (67%), Positives = 86/106 (81%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           MS+L   YQ LQ ELE  ++ARQKLETQLQENKIV+EEF +L+E+T VYKLTGNVLLPV+
Sbjct: 1   MSDLAAAYQALQSELEVLVIARQKLETQLQENKIVSEEFSELKEDTQVYKLTGNVLLPVE 60

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNA 106
           QSEA  NV KRLEFI+ EI RCE N+K KQ++ EK+R +LIKL  A
Sbjct: 61  QSEANSNVAKRLEFIQTEIGRCENNLKAKQQEQEKLRAELIKLRGA 106

>KNAG0B02610 Chr2 (507118..507477) [360 bp, 119 aa] {ON} Anc_7.352
           YLR200W
          Length = 119

 Score =  143 bits (361), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 84/103 (81%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           MS    KYQ  Q  LEE IVARQKLETQLQENKIV EEFD L+E++ VYKLTG+VLLPVD
Sbjct: 1   MSNPAAKYQKAQSALEELIVARQKLETQLQENKIVIEEFDALKEDSKVYKLTGSVLLPVD 60

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKL 103
           Q EAR NVDKRLEFI  EI RCE+NIK+KQE LE +R++L+KL
Sbjct: 61  QDEARTNVDKRLEFINGEIDRCEENIKEKQETLEGLRSELMKL 103

>CAGL0A03971g Chr1 complement(400291..400611) [321 bp, 106 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200w YKE2 Gim complex component
          Length = 106

 Score =  139 bits (351), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%)

Query: 2   SELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQ 61
           +ELG KYQ LQ ELEE + ARQKLETQLQENKIVNEEF  L+E+T VYKLTGNVLLPV+ 
Sbjct: 3   AELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLKEDTVVYKLTGNVLLPVEH 62

Query: 62  SEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLI 101
            +A+ NVDKRLEFI  EI RCE NI+ KQ++LE +R  LI
Sbjct: 63  DDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI 102

>ACL146C Chr3 complement(93269..93592) [324 bp, 107 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR200W
           (YKE2)
          Length = 107

 Score =  139 bits (350), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 70/103 (67%), Positives = 79/103 (76%)

Query: 3   ELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQS 62
           ++ TKY  LQGELEE +V RQKLETQLQENKIVNEE   L+  T VYKLTG VLLPV+Q 
Sbjct: 5   QVATKYTQLQGELEELVVTRQKLETQLQENKIVNEELQALQPETQVYKLTGGVLLPVEQE 64

Query: 63  EARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNN 105
           EA GNV KRLEFIE EI RCE+NIK KQE++E  R  L+KL  
Sbjct: 65  EAEGNVSKRLEFIEGEIRRCEQNIKQKQEEMEGARAALVKLRG 107

>KLLA0D12298g Chr4 (1048089..1048436) [348 bp, 115 aa] {ON} similar
           to uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 115

 Score =  139 bits (351), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 69/99 (69%), Positives = 83/99 (83%)

Query: 7   KYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQSEARG 66
           KY  LQGELEE IVARQKLETQLQENKIV++EF  L+++  VYKLTG VLLPV+Q EA+G
Sbjct: 9   KYTKLQGELEELIVARQKLETQLQENKIVSDEFSSLKDDATVYKLTGGVLLPVEQFEAKG 68

Query: 67  NVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNN 105
           NV+KRLEFIE EI RCE NIK KQ++LE  R++L+KL +
Sbjct: 69  NVEKRLEFIEIEIKRCETNIKSKQQELEVARSELMKLRS 107

>SAKL0F11418g Chr6 complement(887825..888172) [348 bp, 115 aa] {ON}
           similar to uniprot|P52553 Saccharomyces cerevisiae
           YLR200W YKE2 Yeast nuclear gene
          Length = 115

 Score =  139 bits (349), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 86/103 (83%)

Query: 4   LGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQSE 63
           L  +Y  +Q ELE+ ++ARQKLETQLQENKIV +EFD L + + VYKLTG VLLPV+Q E
Sbjct: 9   LSMQYTTMQSELEDLVIARQKLETQLQENKIVQDEFDTLRDESQVYKLTGGVLLPVEQEE 68

Query: 64  ARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNA 106
           A+GNV+KRL+FI+ EITRCE+NIK+KQ QLE++RN+L++L  A
Sbjct: 69  AKGNVEKRLQFIKNEITRCEENIKEKQTQLERLRNELVRLRTA 111

>Ecym_4721 Chr4 (1413362..1413685) [324 bp, 107 aa] {ON} similar to
           Ashbya gossypii ACL146C
          Length = 107

 Score =  133 bits (335), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 67/105 (63%), Positives = 82/105 (78%)

Query: 1   MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVD 60
           + ++  KY  LQGELE+ IV RQKLETQLQENKIVNEE   L+E+  VYKLTG VLLPV+
Sbjct: 3   VEQVAAKYTQLQGELEQLIVTRQKLETQLQENKIVNEELQSLKEDKQVYKLTGGVLLPVE 62

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNN 105
             EA  NV KRLEFI+ EI RCE NIK+KQ++LE+ R++LIKL +
Sbjct: 63  HEEANSNVSKRLEFIQGEIDRCEGNIKNKQQELEQARDELIKLRS 107

>KLTH0H01210g Chr8 (119243..119584) [342 bp, 113 aa] {ON} similar to
           uniprot|P52553 Saccharomyces cerevisiae YLR200W YKE2
           Yeast nuclear gene
          Length = 113

 Score =  129 bits (325), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (75%)

Query: 3   ELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQS 62
           +L   Y   Q ELEE ++ARQKLETQLQENKIV +EFD L E T VYKLTGNVLLPV+Q 
Sbjct: 7   DLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDGLREETQVYKLTGNVLLPVEQF 66

Query: 63  EARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNA 106
           EA+ NV KRLEFI AEI RCE+NIK KQ  LEK+R +L++   A
Sbjct: 67  EAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAELLQTQQA 110

>Kwal_56.24648 s56 complement(1088138..1088479) [342 bp, 113 aa]
           {ON} YLR200W (YKE2) - Polypeptide 6 of a Yeast
           Non-native Actin Binding Complex, homolog of a component
           of the bovine NABC complex [contig 161] FULL
          Length = 113

 Score =  128 bits (322), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 66/105 (62%), Positives = 78/105 (74%)

Query: 3   ELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQS 62
           EL   Y   Q ELEE + ARQ+LETQLQENKIV +EFD L+E T VYKLTG VLLPV+Q 
Sbjct: 7   ELTMNYTTAQQELEELVTARQRLETQLQENKIVQDEFDSLKEETQVYKLTGKVLLPVEQF 66

Query: 63  EARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAA 107
           EA+ NV KRLEFI  EI RCE NIK+KQ  LEK+R +L++   A+
Sbjct: 67  EAKSNVSKRLEFINTEIKRCEDNIKNKQSLLEKLRAELLQAQEAS 111

>KLTH0E11374g Chr5 (1017534..1018184) [651 bp, 216 aa] {ON} some
           similarities with uniprot|Q6LE92 Saccharomyces
           cerevisiae YPL041C Hypothetical ORF
          Length = 216

 Score = 31.2 bits (69), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 24/39 (61%)

Query: 19  IVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLL 57
           ++++ KL T+L +   +   FD+L E +PV  ++  ++L
Sbjct: 69  LISKSKLLTRLSKRPAIGHYFDKLAETSPVSTISSFLIL 107

>Kpol_272.1 s272 complement(6450..11117) [4668 bp, 1555 aa] {ON}
            complement(6450..11117) [4668 nt, 1556 aa]
          Length = 1555

 Score = 30.8 bits (68), Expect = 0.67,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 51/104 (49%), Gaps = 9/104 (8%)

Query: 5    GTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQSEA 64
            GT  + + GE+ +F+  RQ L   + +NK  N  +    +N P+ ++    +L  D+SE+
Sbjct: 987  GTVGKSMMGEVTKFLGYRQDLTYDVTDNK--NILWYNFVKNVPLSRIDKEFILTKDRSES 1044

Query: 65   RGNVDKRLEFIEAEITRCEKN----IKDKQEQLEKVRNDLIKLN 104
               +   L+ +E  I   +      ++ ++E +E +  +L+  N
Sbjct: 1045 ---ITLTLQLVEGIIKSIDNPKIILVRKEREMVEIINQNLVNNN 1085

>Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {ON}
           YLR131C (REAL)
          Length = 764

 Score = 30.8 bits (68), Expect = 0.75,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 36  NEEFDQLEENTPVYKLTGNVLLPVDQSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEK 95
           NE+F Q+EEN         VLL   Q E R  ++++ E  E    + EK ++D Q Q EK
Sbjct: 166 NEDFAQIEENDGENNHLSQVLLK-QQEELRIALERQKEVNE----KLEKQLRDNQVQQEK 220

Query: 96  VRNDL 100
           +R  L
Sbjct: 221 LRKVL 225

>TBLA0G01730 Chr7 complement(451840..454089) [2250 bp, 749 aa] {ON}
           Anc_6.289 YMR198W
          Length = 749

 Score = 30.4 bits (67), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 45/74 (60%), Gaps = 7/74 (9%)

Query: 31  ENKIVNEEFD--QLEENTPVYKLTGNVLLPVDQ----SEARGNVDKRLEFIEAEITRCEK 84
           ENK+  EEF+  +LE++ P+  LT      ++Q    +E + N+ K +E ++++I+    
Sbjct: 311 ENKL-KEEFELFKLEKSMPLQNLTNESYSLIEQIKQLNEQKSNLLKEIESLDSQISDVNN 369

Query: 85  NIKDKQEQLEKVRN 98
           NI+DK +++E + N
Sbjct: 370 NIEDKNKKIEDLSN 383

>KAFR0A08050 Chr1 complement(1612166..1613518) [1353 bp, 450 aa]
           {ON} Anc_2.5 YNL239W
          Length = 450

 Score = 30.0 bits (66), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 30  QENKIVNEEFDQLEENTPVY--KLTGNVLLPVDQSEARGNVDKRLEFIEAEITRCEKNIK 87
           Q+N++ N   D  ++ TPV   + +G   L    ++ RGNV K L   E EI++      
Sbjct: 46  QDNRVFNISLD--DDTTPVTNQRASGRCWLFAATNQLRGNVIKNLNLKEFEISQAYLFFY 103

Query: 88  DKQEQ 92
           DK E+
Sbjct: 104 DKLEK 108

>Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {ON}
           YLR131C (REAL)
          Length = 769

 Score = 30.0 bits (66), Expect = 1.1,   Method: Composition-based stats.
 Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 26  ETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQSEARGNVDKRLEFIEAEITRCEKN 85
           E + Q  K  NE+F Q+ E          VLL   Q E R  ++K+ E  E    + EK 
Sbjct: 160 EFKTQTAKANNEDFAQIREKDGENSYLSQVLLK-QQEELRIALEKQKEVNE----KLEKQ 214

Query: 86  IKDKQEQLEKVRNDL 100
           ++D Q Q EK+R  L
Sbjct: 215 LRDNQLQQEKLRRVL 229

>Kpol_458.5 s458 (34795..37863) [3069 bp, 1022 aa] {ON}
           (34795..37863) [3069 nt, 1023 aa]
          Length = 1022

 Score = 30.0 bits (66), Expect = 1.3,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 51/104 (49%), Gaps = 9/104 (8%)

Query: 5   GTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQSEA 64
           GT  +++ GE+ +F+  RQ L     +NK  N  +    +N P+ ++    +L  D+SE+
Sbjct: 367 GTVGENMMGEVTKFLGYRQDLTYYATDNK--NILWYNFVKNVPLSRIDKEFILTKDRSES 424

Query: 65  RGNVDKRLEFIEAEITRCEKN----IKDKQEQLEKVRNDLIKLN 104
              +   L+ +E  I   +      ++ ++E +E +  +L+  N
Sbjct: 425 ---ITLALQLVEGIINTIDNPKIILVRKEREMVEIINQNLVNNN 465

>YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON}
           ACE2Transcription factor required for septum destruction
           after cytokinesis; phosphorylation by Cbk1p blocks
           nuclear exit of Ace2p during the M-to-G1 transition,
           causing its specific localization to daughter cell
           nuclei, and also increases Ace2p activity;
           phosphorylation by Cdc28p and Pho85p prevents nuclear
           import during cell cycle phases other than cytokinesis;
           part of the RAM network that regulates cellular polarity
           and morphogenesis
          Length = 770

 Score = 29.6 bits (65), Expect = 1.6,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 36  NEEFDQLEENTPVYKLTGNVLLPVDQSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEK 95
           N++FD + EN         VLL   Q E R  ++K+ E  E    + EK ++D Q Q EK
Sbjct: 171 NDDFDHIRENDGENSYLSQVLLK-QQEELRIALEKQKEVNE----KLEKQLRDNQIQQEK 225

Query: 96  VRNDL 100
           +R  L
Sbjct: 226 LRKVL 230

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
            (REAL)
          Length = 1782

 Score = 29.3 bits (64), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 5/52 (9%)

Query: 60   DQSEARGNVDKRLEFIEAEITRCEKNIKDK----QEQLEKVRNDLIKLNNAA 107
            +QSE   N+DK  E  EAE+ R +K   D+    +EQL K+RN+ IK+ + A
Sbjct: 1312 NQSEKIANLDKLREKTEAELCRLKKTSTDEKSNLEEQLGKLRNE-IKIKSQA 1362

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 28.9 bits (63), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%)

Query: 61  QSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPDR 114
           QS     + ++ E +E+EI +C++ IKDK  Q+++++  + K+   A     D+
Sbjct: 736 QSNTAAQLIRKNEELESEIAQCKEEIKDKTSQIKQLKKQIAKIEKDADEFSHDK 789

>YNL167C Chr14 complement(319416..321359) [1944 bp, 647 aa] {ON}
           SKO1Basic leucine zipper transcription factor of the
           ATF/CREB family; forms a complex with Tup1p and Cyc8p to
           both activate and repress transcription; cytosolic and
           nuclear protein involved in osmotic and oxidative stress
           responses
          Length = 647

 Score = 28.9 bits (63), Expect = 3.4,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 8/61 (13%)

Query: 40  DQLEENTPVYKLTGNVLLPVDQSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRND 99
           D +E N    K++ NV L  ++ + R    KR EF+E       K  K K+E ++K+ ND
Sbjct: 409 DDVENN----KISNNVTLDENEEQER----KRKEFLERNRVAASKFRKRKKEYIKKIEND 460

Query: 100 L 100
           L
Sbjct: 461 L 461

>Suva_9.254 Chr9 complement(408977..409681) [705 bp, 234 aa] {ON}
           YIR038C (REAL)
          Length = 234

 Score = 27.7 bits (60), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 47  PVYKLTGNVLLPVDQSEARGNVDKRLEFIEAEITR 81
           P+  L G V   + Q+ + G +  +L+F+EAEI +
Sbjct: 135 PISYLAGKVADKISQAYSSGEMKNQLDFLEAEIKK 169

>Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {ON}
           YLR131C (REAL)
          Length = 767

 Score = 28.1 bits (61), Expect = 6.0,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 5/65 (7%)

Query: 36  NEEFDQLEENTPVYKLTGNVLLPVDQSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEK 95
           NE+F Q+ E          VLL   Q E R  ++K+ E  E    + EK ++D Q Q EK
Sbjct: 170 NEDFAQIREKDGENSYLSQVLLK-QQEELRIALEKQKEVNE----KLEKQLRDNQVQQEK 224

Query: 96  VRNDL 100
           +R  L
Sbjct: 225 LRRVL 229

>TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.414
           YDR356W
          Length = 970

 Score = 27.7 bits (60), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 57  LPVDQSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLN 104
           L   Q+E   N D+++E ++ +I    K   D Q QL+K +ND I+LN
Sbjct: 326 LKTQQNENINNNDEQIEKLKQDIAELSKKNLDFQNQLKKSQNDRIRLN 373

>Kpol_274.8 s274 complement(13824..15257) [1434 bp, 477 aa] {ON}
           complement(13824..15257) [1434 nt, 478 aa]
          Length = 477

 Score = 27.7 bits (60), Expect = 6.7,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 40/94 (42%), Gaps = 3/94 (3%)

Query: 20  VARQKLETQLQENKIVNEEFDQLEENTPVYKLTGNVLLPVDQSEARGNVDKRLEFIEAEI 79
           + +Q L   L++   + E  DQ   NT  + +    LL  D   +   +DK   F + +I
Sbjct: 330 ITKQTLSQDLRKIAFIKETTDQSISNTQQFTILFQQLLTPDSKVSSIELDK---FFQQKI 386

Query: 80  TRCEKNIKDKQEQLEKVRNDLIKLNNAAAATGPD 113
              +K + D    L  + + +  +N+    TG +
Sbjct: 387 QLYQKKLDDYFRVLSDIESTVNGINDDLFGTGSN 420

>KLTH0E14146g Chr5 complement(1251360..1251950) [591 bp, 196 aa]
          {ON} conserved hypothetical protein
          Length = 196

 Score = 27.7 bits (60), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 1/42 (2%)

Query: 30 QENKIVNEEF-DQLEENTPVYKLTGNVLLPVDQSEARGNVDK 70
           ENKI   EF D  E    ++ L GN    V Q +  GN+ K
Sbjct: 19 SENKISTSEFLDASESLVKLFDLLGNSAFTVVQKDLTGNITK 60

>KLTH0H06622g Chr8 complement(583819..584490) [672 bp, 223 aa] {ON}
           similar to uniprot|P53168 Saccharomyces cerevisiae
           YGL061C DUO1 Essential mitotic spindle protein required
           to maintain spindle integrity and kinetochore function
           part of the multisubunit DASH complex which binds
           microtubules and is transferred to the kinetochore prior
           to mitosis
          Length = 223

 Score = 27.7 bits (60), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 41/81 (50%), Gaps = 14/81 (17%)

Query: 32  NKIVNEEFDQLEENTPVYKLTGNVLLPVDQSEARGNVDKRLEFIEAEITRCEKNIKDKQE 91
           NK++ E FDQ+  N  +  L G +  P   S++  N+               +++ ++ +
Sbjct: 12  NKLIPEIFDQMRSNLSLAPLAGGI-KPFVSSKSSSNL-------------TTQSLLEENK 57

Query: 92  QLEKVRNDLIKLNNAAAATGP 112
            L+K+   + KLN++ +++GP
Sbjct: 58  CLDKIIPVIQKLNSSLSSSGP 78

>KLTH0C05346g Chr3 (460241..460549) [309 bp, 102 aa] {ON} similar
          to uniprot|P47128 Saccharomyces cerevisiae YJR082C EAF6
          Esa1p-associated factor subunit of the NuA4
          acetyltransferase complex
          Length = 102

 Score = 26.6 bits (57), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 7/54 (12%)

Query: 1  MSELGTKYQHLQGELEEFIVARQKLETQLQENKIVNEEFDQLEENTPVYKLTGN 54
          M E    YQ L+ EL+E +V R+ LE Q   ++I  E FD+       Y LTGN
Sbjct: 1  MDEAHQHYQKLKQELQEALVDRETLEKQW--DQIQQEIFDK----ESAY-LTGN 47

>SAKL0G11286g Chr7 complement(963289..965792,965887..965887) [2505
           bp, 834 aa] {ON} similar to uniprot|P14907 Saccharomyces
           cerevisiae YJL041W NSP1 Essential component of the
           nuclear pore complex which mediates nuclear import and
           export
          Length = 834

 Score = 27.3 bits (59), Expect = 9.7,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 44/79 (55%), Gaps = 5/79 (6%)

Query: 38  EFDQL--EENTPVYKLTGNVLLPVDQSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEK 95
           E+DQ+  +    + +L  + L+  +Q++ R  +D+ L++IE + T  E  +   + + E 
Sbjct: 675 EWDQVLVQGGEQISQLYSDTLI-AEQTQNR--IDQSLQYIERQQTELETFLDTYERKTES 731

Query: 96  VRNDLIKLNNAAAATGPDR 114
           + ++++  NN ++A   D+
Sbjct: 732 LLSEMLSSNNGSSANTNDQ 750

>YBL090W Chr2 (48825..49358) [534 bp, 177 aa] {ON}
           MRP21Mitochondrial ribosomal protein of the small
           subunit; MRP21 exhibits genetic interactions with
           mutations in the COX2 and COX3 mRNA 5'-untranslated
           leader sequences
          Length = 177

 Score = 26.9 bits (58), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 57  LPVDQSEARGNVDKRLEFIEAEITRCEKNIKDKQEQLEKVRNDLIKLNNAA 107
           +PVD  ++ G ++KR    EAEI R   ++++ Q +    ++ ++  NN A
Sbjct: 66  IPVDMMQSAGRINKRELLSEAEIARS--SVENAQMRFNSGKSIIVNKNNPA 114

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.130    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,383,464
Number of extensions: 521530
Number of successful extensions: 3182
Number of sequences better than 10.0: 297
Number of HSP's gapped: 3164
Number of HSP's successfully gapped: 323
Length of query: 114
Length of database: 53,481,399
Length adjustment: 84
Effective length of query: 30
Effective length of database: 43,849,455
Effective search space: 1315483650
Effective search space used: 1315483650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)