Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.2587.353ON27427414510.0
Skud_12.2637.353ON27427411801e-165
YLR199C (PBA1)7.353ON27627411711e-163
Suva_10.2947.353ON27527511671e-163
KAFR0L015007.353ON2792826713e-87
TDEL0C019507.353ON2732766694e-87
NCAS0E028507.353ON2812856592e-85
Kpol_530.287.353ON2742826433e-83
ZYRO0F11770g7.353ON2722756034e-77
TPHA0F030007.353ON2822835843e-74
NDAI0E044507.353ON2212235602e-71
CAGL0A03993g7.353ON2722795331e-66
KNAG0B026007.353ON2792815262e-65
SAKL0F11440g7.353ON2722854383e-52
TBLA0E020707.353ON2522854303e-51
KLTH0H01188g7.353ON2672833773e-43
Kwal_56.246507.353ON2522592752e-28
KLLA0D12276g7.353ON2582782587e-26
Ecym_47207.353ON2612822062e-18
ACL145W7.353ON2342551938e-17
KLTH0B10318gsingletonON154854702.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.258
         (274 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825...   563   0.0  
Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825...   459   e-165
YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,...   455   e-163
Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828...   454   e-163
KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 a...   263   3e-87
TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 ...   262   4e-87
NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 ...   258   2e-85
Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, ...   252   3e-83
ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 a...   236   4e-77
TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa...   229   3e-74
NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {...   220   2e-71
CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 a...   209   1e-66
KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 ...   207   2e-65
SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 a...   173   3e-52
TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa...   170   3e-51
KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804...   149   3e-43
Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR19...   110   2e-28
KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824) ...   103   7e-26
Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [78...    84   2e-18
ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homol...    79   8e-17
KLTH0B10318g Chr2 (869187..873833) [4647 bp, 1548 aa] {ON} no si...    32   2.9  

>Smik_12.258 Chr12 complement(494861..495523,495524..495685) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/274 (100%), Positives = 274/274 (100%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60
           FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP
Sbjct: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60

Query: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSF 120
           KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSF
Sbjct: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSF 120

Query: 121 PIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMTK 180
           PIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMTK
Sbjct: 121 PIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMTK 180

Query: 181 DECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSLC 240
           DECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSLC
Sbjct: 181 DECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSLC 240

Query: 241 GQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
           GQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI
Sbjct: 241 GQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274

>Skud_12.263 Chr12 complement(494506..495168,495169..495330) [825
           bp, 274 aa] {ON} YLR199C (REAL)
          Length = 274

 Score =  459 bits (1180), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 210/274 (76%), Positives = 248/274 (90%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60
           FKQWN++PEPRH LDFPEISKNL SLE CP+P+VELPQDL+VSQYSTV+ITTKIMNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEFCPIPRVELPQDLNVSQYSTVIITTKIMNPLFP 60

Query: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSF 120
           KNLLQL ++G+++++LTV NS   QST  +SWN+DENFPNEVDP+     S ET+Y+FSF
Sbjct: 61  KNLLQLTSIGEVKSSLTVKNSSPTQSTDAYSWNYDENFPNEVDPISESETSKETQYNFSF 120

Query: 121 PIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMTK 180
           PIYSFG+TLLFSIEENF++ISPIFGNMISR IVS+L+++SP+IIVIG+SD+I+NMK MTK
Sbjct: 121 PIYSFGETLLFSIEENFINISPIFGNMISRSIVSQLIKTSPDIIVIGSSDRISNMKKMTK 180

Query: 181 DECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSLC 240
            EC+L+PPEFITGFIGSVLTQL+ G NKGM FKCL+VPSEGPNG+EK+SLSDMGSL+ +C
Sbjct: 181 SECTLQPPEFITGFIGSVLTQLIIGENKGMNFKCLIVPSEGPNGFEKISLSDMGSLIDVC 240

Query: 241 GQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
            QWLGFDHS Y +ECYRLWRCDSAAIGAQSGLYI
Sbjct: 241 SQWLGFDHSKYSQECYRLWRCDSAAIGAQSGLYI 274

>YLR199C Chr12 complement(547853..548677,548764..548769) [831 bp,
           276 aa] {ON}  PBA1Protein involved in 20S proteasome
           assembly; forms a heterodimer with Add66p that binds to
           proteasome precursors; similar to human PAC1 constituent
           of the PAC1-PAC2 complex involved in proteasome assembly
          Length = 276

 Score =  455 bits (1171), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/274 (78%), Positives = 244/274 (89%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60
           FKQWN++PEP+HLLD PEISKNL SLE CPVPKVE PQDLDV QYST VITTKIMNPLFP
Sbjct: 3   FKQWNDLPEPKHLLDLPEISKNLQSLEVCPVPKVEFPQDLDVPQYSTAVITTKIMNPLFP 62

Query: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSF 120
           KNLLQL ++G+I+TTLTV +    QS+G HSWN+DENFPNEVDP  +   +DET Y FSF
Sbjct: 63  KNLLQLTSIGEIKTTLTVKSPSLPQSSGKHSWNYDENFPNEVDPDQKNDTADETVYGFSF 122

Query: 121 PIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMTK 180
           PIYSFGKTLLFS+EENF+SISPIFGNMISR I+S+L + SP+IIVIGTSDKIA+MKVMT+
Sbjct: 123 PIYSFGKTLLFSMEENFISISPIFGNMISRSIISQLAQFSPDIIVIGTSDKIASMKVMTE 182

Query: 181 DECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSLC 240
           +EC+L+PPEFITGFIGSVLTQL+ G +KG+KFKCLV PSEGPNG+EKLSLSDMGSLV LC
Sbjct: 183 NECTLQPPEFITGFIGSVLTQLIVGPSKGLKFKCLVAPSEGPNGFEKLSLSDMGSLVDLC 242

Query: 241 GQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
           GQWLGF+ S Y EECYRLWRCDSAAIGAQSGLYI
Sbjct: 243 GQWLGFEPSRYSEECYRLWRCDSAAIGAQSGLYI 276

>Suva_10.294 Chr10 complement(520639..521304,521305..521466) [828
           bp, 275 aa] {ON} YLR199C (REAL)
          Length = 275

 Score =  454 bits (1167), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 211/275 (76%), Positives = 245/275 (89%), Gaps = 1/275 (0%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60
           FKQWN++PEPRH LDFPEISKNL SLE CPVPKVELPQDLDVSQYS VVITTKIMNPLFP
Sbjct: 1   FKQWNDLPEPRHQLDFPEISKNLQSLEVCPVPKVELPQDLDVSQYSRVVITTKIMNPLFP 60

Query: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMS-DETKYDFS 119
           KNLL+LI++G+I+T+L V     +Q T  HSWN+DENFPNE++P  R A S +ET Y+FS
Sbjct: 61  KNLLKLISIGEIKTSLMVKELNPIQPTDAHSWNYDENFPNEINPNSRTATSNEETLYNFS 120

Query: 120 FPIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMT 179
           FPIYSFGKTLLFSIEENF++ISPIFGNMISR I S+LV++SP++I+IGTSD+I+NMK+MT
Sbjct: 121 FPIYSFGKTLLFSIEENFINISPIFGNMISRSIASQLVKTSPDVIIIGTSDRISNMKIMT 180

Query: 180 KDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSL 239
           +DEC+L+PPEF+TGFIGSVLTQL+ G NKGMKFKCLVVPSEGPNG+EK SLSDMGSL+ +
Sbjct: 181 EDECTLQPPEFVTGFIGSVLTQLITGANKGMKFKCLVVPSEGPNGFEKFSLSDMGSLIDV 240

Query: 240 CGQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
           C QW G DHS Y EEC+RLWRCDSAAIGAQSGLYI
Sbjct: 241 CSQWFGLDHSKYSEECHRLWRCDSAAIGAQSGLYI 275

>KAFR0L01500 Chr12 (275836..275841,275908..276741) [840 bp, 279 aa]
           {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  263 bits (671), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 138/282 (48%), Positives = 188/282 (66%), Gaps = 13/282 (4%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60
           FKQWNE+ EPRH LD P I KN  SL+  P+P+VE+P  ++ S Y  +++TTK+MNPLFP
Sbjct: 3   FKQWNELVEPRHQLDSPVILKNEESLQESPLPQVEIPSTVNFSDYKKIILTTKVMNPLFP 62

Query: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDH-SWNFDENFPNEVDPVPRGAMSDETKYDFS 119
           KNLL++  +G IETTL +  S       +H SW+F+ENFPNE +P    A  +   + F 
Sbjct: 63  KNLLKMEDLGNIETTLLLTESKMTDDEQNHYSWDFNENFPNEFNPSMESATGN-NNFSFK 121

Query: 120 FPIY--SFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIA-NMK 176
           FPIY  S   TLL SI+ENFL +SPIF N+IS+ + S +      I+++G SDKI+ N+K
Sbjct: 122 FPIYRISSTDTLLISIDENFLKVSPIFLNLISKKLTSSINNDKSSILLLGASDKISNNIK 181

Query: 177 VMTKDECSLKPPEFITGFIGSVLTQL--VGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMG 234
            +T   CS+ PPEFITGFIGS+L +L  +G  N    F+C++VPSEGP G+EKLSLS M 
Sbjct: 182 TVTNKNCSINPPEFITGFIGSLLYELLEIGTDN----FECIIVPSEGPIGFEKLSLSTME 237

Query: 235 SLVSLCGQWLG--FDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
            L++     LG   D  +Y++EC+R W+ + +A   QSGLYI
Sbjct: 238 ELINQFFHELGSQMDFKTYYDECHRNWKLEGSATSTQSGLYI 279

>TDEL0C01950 Chr3 complement(342242..343057,343116..343121) [822 bp,
           273 aa] {ON} Anc_7.353 YLR199C
          Length = 273

 Score =  262 bits (669), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 131/276 (47%), Positives = 183/276 (66%), Gaps = 7/276 (2%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60
           FKQWNEI EPRH LD P I  N  +L+   +P+V LP  +D+  +S V++T+ IMNPLFP
Sbjct: 3   FKQWNEIAEPRHQLDSPVIIANEGTLQTSVLPQVTLP-PIDLQNFSRVILTSAIMNPLFP 61

Query: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSF 120
           + LL+   +G ++  L + +         HSWNFDENFPNEVDP        +T ++   
Sbjct: 62  EKLLKSTILGDLKVILDLSSGKMALDHPMHSWNFDENFPNEVDPAYVVEERSKT-FELCA 120

Query: 121 PIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESS--PEIIVIGTSDKIANMKVM 178
           PI SFG+TLL S++ENFL  SPIF N I++ +V +L + +   E++V+GTSD+I  +K +
Sbjct: 121 PIVSFGRTLLISVKENFLKTSPIFLNQIAKSVVCKLAQGAFEGEVVVLGTSDQITELKPV 180

Query: 179 TKDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVS 238
           +  E +L PPEF+T F+G+V+TQL+    K + F+ L+ PSEGP G+EKL+L  M  L++
Sbjct: 181 SDKETTLNPPEFVTSFVGAVITQLI---EKSLPFQGLIAPSEGPVGFEKLNLVTMEELIT 237

Query: 239 LCGQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
           LC QW+  +   Y  ECYR WR D AA+GAQSGLYI
Sbjct: 238 LCHQWVDSNKEIYRNECYRRWRLDGAALGAQSGLYI 273

>NCAS0E02850 Chr5 complement(560339..561178,561273..561278) [846 bp,
           281 aa] {ON} Anc_7.353 YLR199C
          Length = 281

 Score =  258 bits (659), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 132/285 (46%), Positives = 185/285 (64%), Gaps = 17/285 (5%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60
           FKQWNE  EPRH LDFP +SKN  SL+A P+PKV  P  +    Y  ++ITT++MNPLFP
Sbjct: 3   FKQWNEFIEPRHQLDFPILSKNDESLQASPIPKVLFP-SIAFQNYEKIIITTQLMNPLFP 61

Query: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSF 120
           + L++   +GKIET LT+    +  +   HSWNF+ENFPNE DP      + +  ++F F
Sbjct: 62  EKLIESKNLGKIETQLTLTEDQNAVNEDGHSWNFNENFPNEFDPDNEDRENQQQAFNFEF 121

Query: 121 PIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEII---VIGTSDKIANMKV 177
           P+++ GK ++ SI++NFL ISPIF N+IS+    +L+E  P  I   ++G+SD+IA++K 
Sbjct: 122 PVFAVGKVVIISIQDNFLKISPIFSNIISK----KLIEQLPRTIKPLILGSSDRIASVKE 177

Query: 178 MTKDECSLKPPEFITGFIGSVLTQLV-------GGVNKGMKFKCLVVPSEGPNGYEKLSL 230
           +    C+L PPEFITGFI S+LT+L         G NK  +F  ++VPSEGP G+EKL+L
Sbjct: 178 INDHTCTLVPPEFITGFIASLLTELTIHNETLQNGENK-FQFDAILVPSEGPLGFEKLNL 236

Query: 231 SDMGSLVSLCG-QWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
           + +  L+ L   +W   D   Y EE YR W+   + +GAQSGLYI
Sbjct: 237 TVIQDLIDLFKEEWPNLDPKVYAEESYRNWKLAGSVLGAQSGLYI 281

>Kpol_530.28 s530 complement(73093..73911,74024..74029) [825 bp, 274
           aa] {ON} complement(73093..73911,74024..74029) [825 nt,
           275 aa]
          Length = 274

 Score =  252 bits (643), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 132/282 (46%), Positives = 186/282 (65%), Gaps = 18/282 (6%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60
           FKQWNE   PRH LD P I++N  SL+   +P+V +P+  D+S+Y  VV+TTKIM+PLFP
Sbjct: 3   FKQWNEFVAPRHELDSPIIARNDDSLQLLSLPEVHMPE-TDLSKYKNVVLTTKIMDPLFP 61

Query: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEV----DPVPRGAMSDETKY 116
             LL    +  I TTL +  S  V  + +HSW+++ENFPNEV    D   R  +S     
Sbjct: 62  SKLLSAEKIADITTTLKIDESQDVGESENHSWDYEENFPNEVGFKRDSNNRRLLS----- 116

Query: 117 DFSFPIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSR-LVESSPEI--IVIGTSDKIA 173
            FS PI++F  T++  IEENF+ +S IF N+I+  +++  L+  +P++  I IGTSD+I 
Sbjct: 117 -FSSPIFAFKDTIIIMIEENFIKMSAIFSNVIAEQVINHLLINGNPDLNFIAIGTSDRIL 175

Query: 174 NMKVMTKDECSLKPPEFITGFIGSVLTQLVGG-VNKGMKFKCLVVPSEGPNGYEKLSLSD 232
           N+K +T+D CSL+PPEF+TGFIGS+LTQL+   VN    F  ++ PSEGP G+EK++L  
Sbjct: 176 NIKKLTQDHCSLEPPEFVTGFIGSILTQLISKEVN---VFTGILAPSEGPIGFEKMTLDV 232

Query: 233 MGSLVSLCGQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
           +  L+ +C + L    + Y  +C R+WR D AAIGAQSGLYI
Sbjct: 233 IKELIDICQELLDIKSTEYSVDCQRMWRLDGAAIGAQSGLYI 274

>ZYRO0F11770g Chr6 (961232..961237,961318..962130) [819 bp, 272 aa]
           {ON} weakly similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 272

 Score =  236 bits (603), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 120/275 (43%), Positives = 175/275 (63%), Gaps = 6/275 (2%)

Query: 1   FKQWNEIPEPRHLLDFP-EISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLF 59
           FKQWNEI EPRH LD P  +  +  SL+   +P VELP +++ +++  + +TT IM+PLF
Sbjct: 3   FKQWNEIAEPRHHLDSPLAVGIDDESLQKGSLPLVELP-NINWNKFHKIFLTTGIMDPLF 61

Query: 60  PKNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFS 119
           PK LL ++ +G I TTLT+ +       G++SWNF+ENFPNEV+        D     F 
Sbjct: 62  PKELLGVMKLGDIRTTLTI-DRNQQHENGEYSWNFEENFPNEVNLNGGQDNDDGQSLTFV 120

Query: 120 FPIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMT 179
             + +FG  LL  ++ENFL +SPI  N I++ ++S    +  E+ V+GTSD+I  +K ++
Sbjct: 121 TTVEAFGDCLLVGVKENFLKVSPIIYNRIAQVLLSVFDGTHHELKVLGTSDRITELKSIS 180

Query: 180 KDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSL 239
                L+PPEF+TGFIGS+LTQL     K + F+  + PSEG  G+EK+S++ M  L+ +
Sbjct: 181 HLRSDLQPPEFVTGFIGSILTQL---TVKNIPFEGFIAPSEGAIGFEKMSMNTMPELIDI 237

Query: 240 CGQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
           CGQW+  +   Y  ECYR WR DS A+G+ SGLY+
Sbjct: 238 CGQWINGNSEKYRSECYRHWRLDSGAVGSLSGLYV 272

>TPHA0F03000 Chr6 (657195..657200,657311..658153) [849 bp, 282 aa]
           {ON} Anc_7.353 YLR199C
          Length = 282

 Score =  229 bits (584), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 115/283 (40%), Positives = 179/283 (63%), Gaps = 12/283 (4%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60
           FKQWN++ EPRH L  P +S N+ SL+   +P+V +  +L    +  V++TTK MN LFP
Sbjct: 3   FKQWNDLAEPRHQLMSPSLSTNIESLQLQNIPEVSM-TNLKYEDFENVIVTTKTMNALFP 61

Query: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDE------T 114
              L L  VG++ ++L +  +  V +   +SW++ ENFPNEVD   + A+  E       
Sbjct: 62  NKTLNLTKVGELSSSLVLNENEKVPTAEHYSWDYKENFPNEVDIYSQEAIESEIGSNESK 121

Query: 115 KYDFSFPIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLV---ESSPEIIVIGTSDK 171
           KY+F  PI ++ KTLL SIEENF+ +SPIF N+ +  I+  ++    S+  I+ +GTSD+
Sbjct: 122 KYNFQIPIMAYDKTLLISIEENFIKMSPIFSNLTAEKILKVILTFCNSNIGILTLGTSDR 181

Query: 172 IANMKVMTKDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLS 231
           +A ++ +T +  +L  PEFITGF+GS ++QLV  + +   +K ++VPSEGP G+EKLS+ 
Sbjct: 182 VAAIRKLTPENSTLVAPEFITGFVGSFISQLV--ILEVPNYKAVIVPSEGPIGFEKLSIE 239

Query: 232 DMGSLVSLCGQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
            +  L+ +C + L  +   Y  E +RLW+   +A+GAQ+GLYI
Sbjct: 240 TISELIDICKENLNINDPKYSNESHRLWKVAGSAMGAQTGLYI 282

>NDAI0E04450 Chr5 complement(1004080..1004745) [666 bp, 221 aa] {ON}
           Anc_7.353 YLR199C
          Length = 221

 Score =  220 bits (560), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 110/223 (49%), Positives = 155/223 (69%), Gaps = 5/223 (2%)

Query: 55  MNPLFPKNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDET 114
           MNPLFP++LL L++V  I TTLT+     + + G HSWN++ENFPNE DP  +   S E 
Sbjct: 1   MNPLFPEDLLPLVSVSNISTTLTLNPDQLMGNEGKHSWNYNENFPNEFDPSDKDMKSSEK 60

Query: 115 KYDFSFPIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIAN 174
            YDF+FPI++  +TL+ SI+ENFL ISPIF N+IS+ +V  L   + EI+++GTSD++A 
Sbjct: 61  SYDFNFPIFAIDRTLVISIQENFLKISPIFSNVISQTLVQAL-PLNKEILILGTSDRVAV 119

Query: 175 MKVMTKDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMG 234
           M+ ++ +  +L+PPEF+TGFIGS++T+L    N    F  ++VPSEGP G+EKL+L+ M 
Sbjct: 120 MRKISNEIDTLEPPEFVTGFIGSLITEL-NLHNAKYNFDAIIVPSEGPTGFEKLNLTIMQ 178

Query: 235 SLVSLC-GQW--LGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
            L+ +   +W  L  D   Y E+CYR W+   AAIGAQSGLYI
Sbjct: 179 DLIDIFKNEWNYLNIDSKVYTEQCYRHWKLAGAAIGAQSGLYI 221

>CAGL0A03993g Chr1 (400841..400846,400992..401804) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  209 bits (533), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 112/279 (40%), Positives = 171/279 (61%), Gaps = 14/279 (5%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDL-DVSQYSTVVITTKIMNPLF 59
           FKQWNE+ EPR+ LD P +  N  SL+  P+P V +P +L +      V++TTK M+  F
Sbjct: 3   FKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFEGGNVKRVILTTKTMDTFF 62

Query: 60  P-KNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDF 118
                +++  +  I  +L +  +        H+W+F ENFPNEV+P     + DE +  F
Sbjct: 63  LLDKTMKVKKLADITCSLEIPKNLQTHE-ATHTWDFGENFPNEVEP-----LQDEEQRTF 116

Query: 119 S--FPIYSF-GKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANM 175
           S  FPIY    +TL  SI+ENFL++SPIF   IS  ++S+ +    EI+++G SD+I + 
Sbjct: 117 SLRFPIYLLEDQTLYVSIDENFLTVSPIFTAQISD-VISKKLNRGHEIVILGCSDRIEDT 175

Query: 176 KVMTKDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGS 235
           K+ T + CSL PPEF+TGF+GS+++ L    ++   F   + PSEGP G+EKLS + + S
Sbjct: 176 KICTNNNCSLVPPEFVTGFLGSLMSDLTKTNDQ--LFTAAIFPSEGPQGFEKLSSTTVDS 233

Query: 236 LVSLCGQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
           ++  C Q +  D S Y EECY+ W+ ++++ GAQSGLY+
Sbjct: 234 IIDFCSQLVSTDKSRYTEECYKRWKRNASSNGAQSGLYL 272

>KNAG0B02600 Chr2 complement(505952..506785,506899..506904) [840 bp,
           279 aa] {ON} Anc_7.353 YLR199C
          Length = 279

 Score =  207 bits (526), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 168/281 (59%), Gaps = 11/281 (3%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60
           FK WNE  EPRH LD P +  N  SL+A P+P V +P   D  +        KIMNPLF 
Sbjct: 3   FKHWNEFVEPRHHLDAPVMVPNQESLQALPLPTVTVPAGFDWGKVRDCDPDHKIMNPLFN 62

Query: 61  KNLLQLIAVGKIETTLTVVNSGSVQSTGDHS--WNFDENFPNEVDPVPRGAMSDETKYDF 118
            +    +  G++ T+L +  S   Q+  + S  W++ ENFPNE DP       D      
Sbjct: 63  TSHTHAMTRGELVTSLQLNESVVSQAATELSQHWDYRENFPNEFDPA-SDTREDTKSIVL 121

Query: 119 SFPIYSFG--KTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMK 176
             PI       TLL S++ENFL +SPIF N+++R + + L+ +  +I+++G+SDKI + K
Sbjct: 122 RLPIVELNGMNTLLISVDENFLKVSPIFTNVVARKLRT-LLNTQTKILLVGSSDKIYSTK 180

Query: 177 VMTKDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSL 236
           +++ +EC+L+PPEFITGF+G ++ +LV   N+   FK  +V SEGP G+EKLSL  M  L
Sbjct: 181 MVSLNECTLQPPEFITGFLGGMIDELVK--NRFSNFKGFIVQSEGPTGFEKLSLESMDEL 238

Query: 237 VS-LCGQWLGF--DHSSYHEECYRLWRCDSAAIGAQSGLYI 274
           +  +  +W  +  +  ++ E C++LW+ D AA+ AQSGLYI
Sbjct: 239 IDFIIDEWSSYNINADAFRENCHKLWKLDGAAMSAQSGLYI 279

>SAKL0F11440g Chr6 (888319..888324,888382..889194) [819 bp, 272 aa]
           {ON} similar to uniprot|Q05778 Saccharomyces cerevisiae
           YLR199c
          Length = 272

 Score =  173 bits (438), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 158/285 (55%), Gaps = 26/285 (9%)

Query: 1   FKQWNEIPEPRHLLDFPEISK-NLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLF 59
           FK WNE  EPRH LD P     N  SL+  P+P V L + +D+SQ++ +V+ TK++ PLF
Sbjct: 3   FKHWNEQAEPRHQLDTPYAPNVNYESLQKTPLPTVILTEPIDISQFNQIVLCTKVLRPLF 62

Query: 60  PKNLLQLIAVGKIETTL----TVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETK 115
           P  +  +  + + + T+    T +      S GD  +   E+ P   D  P   +     
Sbjct: 63  PSTICPMTTISEFQVTIPPQPTAIKKAHGSSYGDEDYE-QESLP---DKKPEEII----- 113

Query: 116 YDFSFPIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVES--SPEIIVIGTSDKIA 173
              SF +  F   L   IEENFL +SPI  N++S+ I+ RL +S  + + IV+GTSD+I 
Sbjct: 114 --VSFQVEKFNDILFICIEENFLHVSPIAWNLLSQQII-RLCKSKNTLQTIVLGTSDRIT 170

Query: 174 NMKVM--TKDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLS 231
            +K +  T     L+PPEF+T    S++T L+      + FK L+ PSEGP+G+EKLSL 
Sbjct: 171 TLKSVGSTLGLPDLEPPEFVTNCTASLITTLIL---HDLPFKSLIAPSEGPSGFEKLSLV 227

Query: 232 DMGSLVSLCGQWLG--FDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
            M  L   C + +    + SSY EEC+R WR    A+GAQ+GLYI
Sbjct: 228 SMDQLAESCFELVKPVENVSSYIEECHRAWRLQGTAMGAQTGLYI 272

>TBLA0E02070 Chr5 (504410..504415,504472..505224) [759 bp, 252 aa]
           {ON} Anc_7.353 YLR199C
          Length = 252

 Score =  170 bits (430), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 102/285 (35%), Positives = 152/285 (53%), Gaps = 46/285 (16%)

Query: 1   FKQWNEIPEPRHLLD----FPEISKNLHSLEACPVPKVELPQDL-DVSQYSTVVITTKIM 55
           FKQW+E  EPRH +D     P   +N  SL+  P+P V++P  L D++ Y  +++ T+++
Sbjct: 3   FKQWDEWAEPRHHVDSLAAIPPNHRNADSLQEAPLPLVKVPDTLQDITIYEQIIVATRVL 62

Query: 56  NPLFPKNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETK 115
            PLFPK +L   ++G IE  L V                                S+ T 
Sbjct: 63  MPLFPKEILNFTSLGNIEVKLNV--------------------------------SEATA 90

Query: 116 YDFSFPIYSFG-KTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIAN 174
           +    PIY    +TL+  ++EN + + PIF N+IS+ I + +  +  + ++ GTSD+I+ 
Sbjct: 91  HLVKTPIYKCNERTLIIIVDENVMQVCPIFLNVISKTICT-MFGNQLKFLIFGTSDRISK 149

Query: 175 MKVMTKDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMG 234
           +K +    C+L PPEFITGFIGS+++ L    N   KF   +VPSEGP G+EKL+L  M 
Sbjct: 150 IKTINHLNCTLIPPEFITGFIGSIISDLSLTANS--KFNGFLVPSEGPLGFEKLTLETME 207

Query: 235 SLVSLCGQWLGFDHSS-----YHEECYRLWRCDSAAIGAQSGLYI 274
            L+   G+ +    S+     Y +ECYR WR     IG QSGLYI
Sbjct: 208 FLIKEGGRIVKTIDSNLNLELYEKECYRNWRLTGTTIGTQSGLYI 252

>KLTH0H01188g Chr8 complement(118222..119019,119088..119093) [804
           bp, 267 aa] {ON} similar to uniprot|Q05778 Saccharomyces
           cerevisiae YLR199C Hypothetical ORF
          Length = 267

 Score =  149 bits (377), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 99/283 (34%), Positives = 150/283 (53%), Gaps = 27/283 (9%)

Query: 1   FKQWNEIPEPRHLLDFP-EISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLF 59
           FKQWNE  EPRH LD P E + +L SL+  P+P+V L + +D + +    I T I   LF
Sbjct: 3   FKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDTAGFKRAFIVTNIFRSLF 62

Query: 60  PKNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFS 119
              L +   +    ++  VV     Q+ G     + E++  + D       +DETK    
Sbjct: 63  EDRLARAEQI----SSFVVV----WQTKGREQHLYREDYQTQED----SRSTDETKR-LE 109

Query: 120 FPIYSFGK-TLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVM 178
           FP++     TL   + E+FL + PI  N++SR I    +    E+++ G+SD++  +K +
Sbjct: 110 FPVHKLDDGTLFICVREDFLHVPPISINLLSREIAK--LCGGLEVLLFGSSDRVERVKYV 167

Query: 179 T------KDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSD 232
                  K    L PPE IT F  S++TQL+   NK ++F   V PSEGP+GYEKLS+  
Sbjct: 168 GFPGNVGKGLPLLTPPELITNFTASIMTQLLS--NK-VRFDGYVAPSEGPSGYEKLSMET 224

Query: 233 MGSLVSLCGQWLGF-DHSSYHEECYRLWRCDSAAIGAQSGLYI 274
           M  L+ LC   + F +   Y + C+R WR +   +GAQ+GLY+
Sbjct: 225 MDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL 267

>Kwal_56.24650 s56 (1089568..1090326) [759 bp, 252 aa] {ON} YLR199C
           - Hypothetical ORF [contig 161] FULL
          Length = 252

 Score =  110 bits (275), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 121/259 (46%), Gaps = 26/259 (10%)

Query: 24  HSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFPKNLLQLIAVGKIETTLTVVNSGS 83
           +SL+  P+P+V L + L  + +  V I T+I   LF   L     +   E          
Sbjct: 12  NSLQLAPLPEVRLTEPLKSNSFKRVFIITEIFRSLFVGKLAHAEQISTFEVKW------- 64

Query: 84  VQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSFPIYSFGK-TLLFSIEENFLSISP 142
            Q+ G     + E+F  + D        +      S P+    + T L  + E+FL + P
Sbjct: 65  -QTKGREQHLYREDFQVQED-----CTKENESCGLSIPVLKIDEDTFLLCVAEDFLHVPP 118

Query: 143 IFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMTKDECS------LKPPEFITGFIG 196
           I GN++S+ +    +     ++VIGTSD+I  +K +   +        L PPE IT F  
Sbjct: 119 IVGNLLSQEMAK--LCRDLRVLVIGTSDRIEEVKYVGSAQNGRNGVPPLTPPELITSFTA 176

Query: 197 SVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSLCGQWLGF-DHSSYHEEC 255
           S+ TQL+      + F   V PSEGP+GYEKLS+  M  L+ LC   +   +   Y +E 
Sbjct: 177 SITTQLLLC---KVPFDGYVAPSEGPSGYEKLSMETMDKLIDLCWSEISTGNRDEYVKET 233

Query: 256 YRLWRCDSAAIGAQSGLYI 274
           +R WR    + G Q+GLY+
Sbjct: 234 HRNWRLHGTSTGTQTGLYL 252

>KLLA0D12276g Chr4 complement(1046970..1047737,1047816..1047824)
           [777 bp, 258 aa] {ON} similar to uniprot|Q05778
           Saccharomyces cerevisiae YLR199C Hypothetical ORF
          Length = 258

 Score =  103 bits (258), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 80/278 (28%), Positives = 134/278 (48%), Gaps = 27/278 (9%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVEL-PQDLDVSQYSTVVITTKIMNPLF 59
           FKQW     PRH +D P +  + +SL     P V + P+ LD+S Y+  ++    +  L 
Sbjct: 4   FKQWQNDQVPRHQID-PVVQSDPYSLVNKTTPTVTIEPESLDISPYNHCIVLPTSLKWLL 62

Query: 60  PKNLLQLIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDETKYDFS 119
           PK+++ L+ +G I  TL+ +N           ++ +E+  N  +           ++   
Sbjct: 63  PKSIINLVHIGIISGTLSNMNEWESMKPVPGMYDTEEHMINSTE-----------QFVIH 111

Query: 120 FPIYSFGKTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMT 179
           + ++    TL+  I+EN +    I  N ++R + ++L+    +I ++  SDKI  +K ++
Sbjct: 112 YNLWRLEDTLIAIIDENEVKYPAIVTNFMTRNL-AQLLRDIKDITILVNSDKITELKQLS 170

Query: 180 KDECSLKPPEFITGFIGSVLTQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSL 239
                L PPEFITG I + +  L        + K +VVPSEGP G+EK +   + +LV  
Sbjct: 171 ----YLVPPEFITGSITNFILAL-----PRKELKVIVVPSEGPIGFEKYNFPTVDALVDE 221

Query: 240 CGQWLGFDHSS---YHEECYRLWRCDSAAIGAQSGLYI 274
             + L    S    Y  EC +LW+ D      Q GLYI
Sbjct: 222 MSKLLCSYPSQTEYYVSECLKLWKLDECT-TTQGGLYI 258

>Ecym_4720 Chr4 complement(1412286..1413065,1413130..1413135) [786
           bp, 261 aa] {ON} similar to Ashbya gossypii ACL145W
           1-intron
          Length = 261

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 130/282 (46%), Gaps = 31/282 (10%)

Query: 1   FKQWNEIPEPRHLLDFPEISKNLHSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFP 60
           FKQW     PRH +     S +  SL   P P + L  D++   Y   +     +  L P
Sbjct: 3   FKQWEFDRIPRHQVQSIN-SADPTSLLLSPEPVITLDNDIN-KGYEKAIALPSSLTWLLP 60

Query: 61  KNLLQ------LIAVGKIETTLTVVNSGSVQSTGDHSWNFDENFPNEVDPVPRGAMSDET 114
            +L+       L AV K  +    V    V ++G +          EVD  P    + E 
Sbjct: 61  ADLIHFKQISCLTAVLKQSSNPDPVEIEDVNTSGFY----------EVDVKPS---TKEV 107

Query: 115 KYDFSFPIYSFG-KTLLFSIEENFLSISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIA 173
           +   S+PIY     TL+  I+E+ L   PI  N ++  +   L  +  ++ ++  SDKI 
Sbjct: 108 RA--SYPIYELDDHTLVVLIKEDELQHPPILHNFLAIALAKVLRTAIQKVYLLINSDKII 165

Query: 174 NMKVMTKDECSLKPPEFITGFIGSVLTQLVG-GVNKGMKFKCLVVPSEGPNGYEKLSLSD 232
             K +++    L+PPEFI G + +++T L     +K  + + +VV SEGP GYE  +++ 
Sbjct: 166 GFKSLSE----LQPPEFIAGALAAIVTALNSQSSSKEFQHEIMVVQSEGPRGYEIHNITV 221

Query: 233 MGSLVSLCGQWLGFDHSSYHEECYRLWRCDSAAIGAQSGLYI 274
           +  LV      LG+    Y    YR W+ +SA+   QSGLY+
Sbjct: 222 VDLLVEYMKSTLGYSE-EYVTSAYRRWKSNSAS-QFQSGLYL 261

>ACL145W Chr3 (93920..94624) [705 bp, 234 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR199C
          Length = 234

 Score = 79.0 bits (193), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 73/255 (28%), Positives = 114/255 (44%), Gaps = 28/255 (10%)

Query: 24  HSLEACPVPKVELPQDLDVSQYSTVVITTKIMNPLFPKNLLQLIAVGKIETTLTVVNSGS 83
           HSL A   P+VE    L   +YS  ++    ++ L P  ++QL  V ++  TLT    G 
Sbjct: 4   HSLLAGAEPQVEFSGKLG-ERYSAALVVPSTLSWLMPPEMVQLTPVAQLVGTLTQAGGGE 62

Query: 84  VQS---TGDHSWNFDENFPNEVDPVPRGAMSDETKYDFSFPIYSFG-KTLLFSIEENFLS 139
             +     D  +  D         VP+     E     ++ +Y  G   L+  +EEN L 
Sbjct: 63  CATRLVAADQFYEAD---------VPQA----ERHVRVAYQLYERGPGQLVVVVEENDLK 109

Query: 140 ISPIFGNMISRCIVSRLVESSPEIIVIGTSDKIANMKVMTKDECSLKPPEFITGFIGSVL 199
             PI  N +++ +  +L     E  V+  SDK   +K    D   L PPEFITG + +++
Sbjct: 110 YPPIVHNRLAQQLAEKLRAVGAETTVLVNSDKSTGVK----DLEELVPPEFITGALAALV 165

Query: 200 TQLVGGVNKGMKFKCLVVPSEGPNGYEKLSLSDMGSLVSLCGQWLGFDHSSYHEECYRLW 259
                 +      + LVV SEGP+G+EK +L+ + +LV    Q L      Y   C R W
Sbjct: 166 CA----LAPSGAGRVLVVQSEGPHGFEKHNLTVVDALVERVRQILD-QPPEYVAACTRHW 220

Query: 260 RCDSAAIGAQSGLYI 274
           +  + +   Q GLY+
Sbjct: 221 KLQAGS-QFQGGLYL 234

>KLTH0B10318g Chr2 (869187..873833) [4647 bp, 1548 aa] {ON} no
           similarity
          Length = 1548

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 5/54 (9%)

Query: 2   KQWNE-IPEPR-HLLDFPEISKNLHSLEA-CPVPKVELPQDLDVSQYSTVVITT 52
           K W E  PE +  LL F E  +NL  +E+ C  P + LP+D+D+ Q+  +++TT
Sbjct: 885 KHWKEQFPETQLGLLVFDEF-QNLPDVESYCKTP-LHLPKDIDIEQFQRLILTT 936

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,387,631
Number of extensions: 1315942
Number of successful extensions: 3339
Number of sequences better than 10.0: 29
Number of HSP's gapped: 3376
Number of HSP's successfully gapped: 30
Length of query: 274
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 166
Effective length of database: 41,097,471
Effective search space: 6822180186
Effective search space used: 6822180186
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)