Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1928.324ON94394347770.0
Suva_10.2228.324ON94394345200.0
YLR129W (DIP2)8.324ON94394345010.0
Skud_12.1988.324ON94394344910.0
NCAS0C032608.324ON98395936860.0
SAKL0H15532g8.324ON94194736340.0
NDAI0G025808.324ON95896336200.0
Kpol_1036.698.324ON93694335300.0
TDEL0F045008.324ON93894435060.0
TPHA0C008108.324ON93794234930.0
KAFR0H022608.324ON93894634840.0
ZYRO0F10406g8.324ON93894234640.0
KLTH0G12276g8.324ON93794434540.0
TBLA0A039508.324ON93693834430.0
KNAG0G024508.324ON94294734200.0
Kwal_56.239208.324ON93794433860.0
Ecym_42558.324ON93794233630.0
CAGL0M04279g8.324ON94094333560.0
AGL196C8.324ON93594133270.0
KLLA0D16390g8.324ON93694630300.0
NDAI0E034408.435ON8576103024e-27
YLR222C (UTP13)8.435ON8173782801e-24
Ecym_41348.435ON8102352773e-24
ZYRO0A09636g8.435ON8082392702e-23
Skud_12.2858.435ON8172352702e-23
TBLA0I025708.435ON8482002693e-23
AGR180W8.435ON8062392693e-23
KAFR0H017508.435ON7832352622e-22
Smik_12.2798.435ON8173782594e-22
SAKL0H12760g8.435ON8412372595e-22
Kpol_1031.498.435ON7602352585e-22
Kwal_27.115858.435ON8232352561e-21
KNAG0A025108.435ON8492032561e-21
KLTH0E10120g8.435ON8262352551e-21
Ecym_25236.363ON6462782541e-21
Suva_10.3168.435ON8182352542e-21
TDEL0B020108.435ON8053042523e-21
AGL234W6.363ON6292782503e-21
NCAS0C027108.435ON8153412514e-21
TPHA0L010808.435ON8352382505e-21
TPHA0M020006.363ON6994242496e-21
KLLA0F13244g8.435ON8142352488e-21
KNAG0A037008.544ON8172952471e-20
CAGL0C00737g8.435ON8162402471e-20
CAGL0C03608g6.363ON6433572423e-20
TBLA0F042406.363ON7273302433e-20
KLLA0F10263g6.363ON6822762381e-19
KNAG0D002506.363ON6553832371e-19
YCR084C (TUP1)6.363ON7132822362e-19
KAFR0E031808.544ON8142952362e-19
TDEL0A077806.363ON6572842352e-19
Kpol_1028.236.363ON7442822362e-19
Kwal_23.64296.363ON7503162363e-19
NDAI0C054908.544ON8592952335e-19
Skud_3.1566.363ON7132822335e-19
AEL246C8.544ON8152942336e-19
TBLA0H036208.544ON8122982327e-19
Smik_3.1836.363ON7092822318e-19
SAKL0A00660g6.363ON6602872309e-19
SAKL0F15972g7.534ON4702972252e-18
Smik_2.3388.544ON8003092282e-18
Suva_3.1216.363ON7002572282e-18
KLTH0D04466g2.431ON3192032192e-18
KLTH0A07282g6.363ON7252842282e-18
Skud_2.3248.544ON8023012282e-18
CAGL0E00561g6.363ON8363402273e-18
CAGL0M05335g8.544ON8062972264e-18
NCAS0D047806.363ON6212762244e-18
ZYRO0D01122g7.534ON4663142225e-18
TPHA0L016908.544ON8322192247e-18
ZYRO0A12980g8.544ON8243232238e-18
Ecym_70388.544ON8001752221e-17
NCAS0A055206.363ON6713382211e-17
ZYRO0D17292g6.363ON7182832211e-17
Kpol_487.71.399ON3032852112e-17
TDEL0B030208.544ON8312952192e-17
NDAI0K023506.363ON7933462192e-17
YBR198C (TAF5)8.544ON7983072183e-17
AEL269C7.534ON4552692136e-17
Kwal_23.53517.534ON4742452101e-16
NCAS0F018502.431ON3182312051e-16
KLTH0A00880g7.534ON4712452092e-16
SAKL0H09988g8.544ON7492772122e-16
Skud_14.3211.399ON3032832032e-16
Suva_14.3421.399ON3032832032e-16
Kpol_1013.377.534ON4682742082e-16
Suva_4.4528.544ON8003012103e-16
KAFR0A005102.431ON3192232023e-16
Smik_14.3221.399ON3032832014e-16
YNL006W (LST8)1.399ON3032832014e-16
Kwal_27.120538.544ON7552962094e-16
NCAS0A151707.534ON4742742064e-16
Suva_13.2952.431ON3192252014e-16
Skud_13.2752.431ON3192252014e-16
Smik_13.3052.431ON3192252014e-16
YMR116C (ASC1)2.431ON3192252014e-16
Kpol_1024.428.544ON8433062095e-16
NCAS0A042702.431ON3182312015e-16
ZYRO0E04620g1.399ON3032832006e-16
ZYRO0D08206g6.340ON5152902056e-16
NDAI0H027102.431ON3182272006e-16
TPHA0G023802.431ON3181942007e-16
NCAS0B022008.544ON8222842069e-16
KLTH0E12606g8.544ON7552152061e-15
KLLA0E23453g8.544ON8262102051e-15
TDEL0H003707.534ON4652832021e-15
TDEL0B059701.399ON3032831971e-15
TPHA0I032407.534ON4772232012e-15
TPHA0I018808.544ON10342092032e-15
NDAI0I003506.340ON5152902012e-15
KNAG0E023102.431ON3192251953e-15
SAKL0E03960g2.431ON3201981936e-15
Kpol_297.72.431ON3181561927e-15
Kwal_23.63246.340ON5142931977e-15
AFR199C2.431ON3342061929e-15
KNAG0I028406.340ON5192851969e-15
TBLA0B091002.431ON3171601911e-14
NCAS0D046106.340ON5152831951e-14
ADL082C7.231ON5692081951e-14
KNAG0H016901.399ON3032831882e-14
KAFR0C047406.363ON6652371942e-14
TBLA0F041306.340ON5142901923e-14
KLLA0C08547g6.340ON5152901913e-14
NDAI0G038303.25ON5102991913e-14
YCR072C (RSA4)6.340ON5152831913e-14
KAFR0H031401.399ON3032541863e-14
KLTH0A06754g6.340ON5142901904e-14
CAGL0H03729g1.399ON3032841854e-14
TBLA0F005206.363ON6631571906e-14
Skud_3.1456.340ON5152831897e-14
KLLA0E07085g3.25ON4523051878e-14
SAKL0D08756g1.399ON3032541839e-14
Smik_3.1726.340ON5152831871e-13
TDEL0A020702.431ON3191941821e-13
ZYRO0G20152g2.431ON3191951821e-13
KAFR0A033801.247ON6661711871e-13
Suva_3.1096.340ON5152831852e-13
KAFR0I018807.231ON5911821852e-13
SAKL0A01276g6.340ON5152831842e-13
Ecym_60982.431ON3181511793e-13
AER263C6.340ON5132831833e-13
TDEL0A075506.340ON5152911824e-13
ZYRO0F07282g8.672ON4271601806e-13
KAFR0F043506.340ON5152901816e-13
KAFR0B003707.534ON4612501807e-13
KLTH0H12122g1.399ON3032531767e-13
Ecym_24986.340ON5422831807e-13
TPHA0O007101.399ON3043101758e-13
Kpol_1070.117.231ON6661821801e-12
CAGL0J03476g6.340ON5173401791e-12
Kpol_1048.598.544ON8502171801e-12
Kpol_1028.416.340ON5122841781e-12
TPHA0G016108.672ON4141441771e-12
Ecym_12931.399ON3032541731e-12
Suva_9.1547.231ON6381821791e-12
Skud_9.1237.231ON6391821781e-12
KNAG0J016808.672ON3981441762e-12
NDAI0C026001.399ON3032541722e-12
KLLA0D04840g1.399ON3032531722e-12
SAKL0F08404g7.231ON6432811772e-12
NCAS0B078401.247ON5892081763e-12
ZYRO0D16742g7.231ON6082761763e-12
NCAS0G036001.399ON3272961713e-12
KNAG0F038707.534ON4652371743e-12
Ecym_43437.231ON5831731754e-12
Smik_9.1447.231ON6301821754e-12
YIL046W (MET30)7.231ON6401821754e-12
NDAI0B051901.247ON6681741745e-12
Suva_14.223.25ON4692081735e-12
Ecym_55015.631ON3271881696e-12
KLLA0D07546g8.67ON6473331746e-12
TDEL0H021307.231ON5842801737e-12
Ecym_28087.534ON4652441718e-12
Skud_14.223.25ON4672081701e-11
SAKL0A03872g6.239ON8783051721e-11
NCAS0A139407.322ON12051521721e-11
TPHA0P014903.25ON4592921691e-11
KNAG0F018406.239ON9112721711e-11
SAKL0H06666g8.672ON4412121691e-11
TPHA0M018306.340ON5152831701e-11
AFL118W6.239ON8322921711e-11
Kpol_1014.193.25ON4522571691e-11
TDEL0A004403.25ON4512951691e-11
Smik_11.2981.247ON6622391701e-11
Ecym_24018.672ON4261561681e-11
CAGL0G09845g7.534ON5002541691e-11
TPHA0C011507.231ON6871901702e-11
ZYRO0C03124g3.25ON4452951682e-11
Kwal_23.57697.231ON6272881692e-11
KLLA0E12277g2.431ON3262171652e-11
TPHA0D045007.322ON12081881693e-11
TBLA0E007607.534ON3842431653e-11
CAGL0L00781g7.231ON6731821683e-11
CAGL0G04345g1.247ON7111271673e-11
NCAS0C044503.25ON4612961663e-11
CAGL0I03718g7.322ON12011411684e-11
TBLA0A060606.239ON8882731674e-11
NDAI0A020907.322ON12001601684e-11
YNL317W (PFS2)3.25ON4652081654e-11
TPHA0B011201.247ON7191231674e-11
TBLA0B043908.585ON3361611634e-11
Smik_4.907.322ON12011491684e-11
Skud_4.1097.322ON12011521674e-11
NCAS0A134307.231ON6082931665e-11
Smik_14.143.25ON4662081655e-11
NDAI0A026107.231ON7671821665e-11
Suva_4.997.322ON12011601675e-11
YDL145C (COP1)7.322ON12011521675e-11
KLTH0D11132g8.672ON4371441645e-11
KNAG0B027207.322ON12041601666e-11
KAFR0L013907.322ON12061521666e-11
KNAG0D016907.231ON6542861648e-11
CAGL0A02772g5.429ON4411551628e-11
KLLA0F27511g7.231ON6231821639e-11
Kwal_26.87768.672ON4331441611e-10
KNAG0C014101.247ON6531221631e-10
NCAS0A034704.106ON8162301631e-10
Suva_2.1174.106ON8402261631e-10
KLTH0A04114g7.231ON6582841621e-10
KLTH0H03608g6.239ON8752871621e-10
CAGL0M04081g3.25ON4552051601e-10
TBLA0F022307.322ON12161591632e-10
ACR137W8.672ON4252131602e-10
KLLA0F21406g1.247ON7051201612e-10
TBLA0C018408.672ON4231531592e-10
ZYRO0G03586g6.177ON9711861612e-10
TBLA0D041307.231ON5742781602e-10
ZYRO0F09922g5.429ON4552251592e-10
Skud_11.2711.247ON6462391602e-10
TDEL0A061808.672ON4341461583e-10
TDEL0C022407.322ON12011591613e-10
ZYRO0E07392g6.239ON8972721603e-10
Kpol_2001.657.322ON12061601613e-10
Kwal_27.126671.247ON7211991603e-10
Suva_6.1871.247ON7141251603e-10
Smik_2.1124.106ON8412261603e-10
KNAG0B016101.247ON6741661593e-10
Ecym_80901.247ON7162521593e-10
KLLA0F04884g7.322ON12121831603e-10
Ecym_80727.322ON12011591603e-10
ZYRO0D03828g1.247ON7261231593e-10
NDAI0J003307.534ON4722701574e-10
KLTH0E15576g1.247ON7231211584e-10
CAGL0M02277g8.672ON4271441564e-10
TPHA0F005504.106ON8282251584e-10
KAFR0H024508.672ON4172081565e-10
AEL314W1.247ON7151171585e-10
KLLA0F11231g8.672ON4341441565e-10
TBLA0D048701.399ON3273071545e-10
Skud_2.1034.106ON8402261585e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.192
         (943 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...  1844   0.0  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...  1745   0.0  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...  1738   0.0  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...  1734   0.0  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...  1424   0.0  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...  1404   0.0  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...  1399   0.0  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...  1364   0.0  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...  1355   0.0  
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...  1350   0.0  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...  1346   0.0  
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...  1338   0.0  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...  1335   0.0  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...  1330   0.0  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...  1321   0.0  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...  1308   0.0  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...  1300   0.0  
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...  1297   0.0  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...  1286   0.0  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...  1171   0.0  
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...   120   4e-27
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...   112   1e-24
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...   111   3e-24
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...   108   2e-23
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...   108   2e-23
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...   108   3e-23
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...   108   3e-23
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...   105   2e-22
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...   104   4e-22
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...   104   5e-22
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...   103   5e-22
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...   103   1e-21
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...   103   1e-21
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...   102   1e-21
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...   102   1e-21
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...   102   2e-21
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...   101   3e-21
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...   100   3e-21
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...   101   4e-21
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....   100   5e-21
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...   100   6e-21
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...   100   8e-21
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...   100   1e-20
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...   100   1e-20
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    98   3e-20
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    98   3e-20
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    96   1e-19
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    96   1e-19
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    96   2e-19
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    96   2e-19
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    95   2e-19
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    96   2e-19
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    96   3e-19
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             94   5e-19
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    94   5e-19
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    94   6e-19
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    94   7e-19
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    94   8e-19
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    93   9e-19
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    91   2e-18
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    92   2e-18
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    92   2e-18
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    89   2e-18
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    92   2e-18
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    92   2e-18
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    92   3e-18
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    92   4e-18
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     91   4e-18
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    90   5e-18
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    91   7e-18
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    91   8e-18
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    90   1e-17
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    90   1e-17
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    90   1e-17
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    86   2e-17
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    89   2e-17
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    89   2e-17
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    89   3e-17
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    87   6e-17
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    86   1e-16
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    84   1e-16
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    85   2e-16
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    86   2e-16
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    83   2e-16
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    83   2e-16
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    85   2e-16
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    86   3e-16
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    82   3e-16
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    82   4e-16
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    82   4e-16
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    85   4e-16
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    84   4e-16
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    82   4e-16
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    82   4e-16
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    82   4e-16
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    82   4e-16
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    85   5e-16
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    82   5e-16
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    82   6e-16
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    84   6e-16
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    82   6e-16
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    82   7e-16
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    84   9e-16
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    84   1e-15
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    84   1e-15
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    82   1e-15
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    80   1e-15
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    82   2e-15
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    83   2e-15
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       82   2e-15
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    80   3e-15
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    79   6e-15
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    79   7e-15
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    80   7e-15
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    79   9e-15
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    80   9e-15
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    78   1e-14
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     80   1e-14
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    80   1e-14
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    77   2e-14
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    79   2e-14
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    79   3e-14
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    78   3e-14
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      78   3e-14
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    78   3e-14
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    76   3e-14
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    78   4e-14
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    76   4e-14
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    78   6e-14
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    77   7e-14
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    77   8e-14
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    75   9e-14
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    77   1e-13
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    75   1e-13
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    75   1e-13
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    77   1e-13
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    76   2e-13
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    76   2e-13
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    75   2e-13
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    74   3e-13
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    75   3e-13
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    75   4e-13
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    74   6e-13
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    74   6e-13
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    74   7e-13
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    72   7e-13
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    74   7e-13
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    72   8e-13
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    74   1e-12
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    74   1e-12
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    74   1e-12
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    73   1e-12
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    73   1e-12
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    71   1e-12
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    74   1e-12
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    73   1e-12
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    72   2e-12
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      71   2e-12
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    71   2e-12
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    73   2e-12
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    72   3e-12
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    72   3e-12
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    70   3e-12
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    72   3e-12
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    72   4e-12
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    72   4e-12
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    72   4e-12
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    72   5e-12
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    71   5e-12
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    70   6e-12
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    72   6e-12
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    71   7e-12
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    70   8e-12
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    70   1e-11
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    71   1e-11
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    71   1e-11
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    70   1e-11
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    70   1e-11
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    70   1e-11
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    70   1e-11
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    70   1e-11
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    70   1e-11
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    70   1e-11
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    70   1e-11
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    69   1e-11
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    70   1e-11
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    70   2e-11
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    69   2e-11
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    70   2e-11
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    68   2e-11
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    70   3e-11
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               68   3e-11
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    69   3e-11
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    69   3e-11
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      69   3e-11
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    69   4e-11
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    69   4e-11
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    69   4e-11
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    68   4e-11
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    69   4e-11
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    67   4e-11
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    69   4e-11
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    69   4e-11
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    69   5e-11
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    68   5e-11
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     69   5e-11
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    69   5e-11
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    69   5e-11
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    68   5e-11
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    69   6e-11
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    69   6e-11
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    68   8e-11
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    67   8e-11
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    67   9e-11
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    67   1e-10
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    67   1e-10
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     67   1e-10
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    67   1e-10
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    67   1e-10
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    67   1e-10
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    66   1e-10
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    67   2e-10
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    66   2e-10
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    67   2e-10
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    66   2e-10
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    67   2e-10
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    66   2e-10
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    66   2e-10
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    66   2e-10
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    65   3e-10
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    67   3e-10
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    66   3e-10
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    67   3e-10
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    66   3e-10
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    66   3e-10
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    66   3e-10
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    66   3e-10
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    66   3e-10
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    66   3e-10
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    66   3e-10
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    66   3e-10
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      65   4e-10
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    65   4e-10
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    65   4e-10
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    65   4e-10
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    65   5e-10
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    65   5e-10
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    65   5e-10
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    64   5e-10
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    65   5e-10
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    65   6e-10
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    65   6e-10
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    65   6e-10
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    65   6e-10
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    64   6e-10
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    65   7e-10
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    65   7e-10
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    64   7e-10
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    65   7e-10
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    65   9e-10
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    63   9e-10
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    64   9e-10
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    62   9e-10
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    64   1e-09
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    63   1e-09
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    64   1e-09
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     64   1e-09
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    64   1e-09
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    64   1e-09
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    64   1e-09
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    64   2e-09
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    64   2e-09
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    64   2e-09
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    64   2e-09
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    64   2e-09
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    64   2e-09
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    63   2e-09
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    63   2e-09
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    64   2e-09
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    64   2e-09
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      62   2e-09
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    64   2e-09
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    63   2e-09
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    64   2e-09
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    63   2e-09
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    62   2e-09
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    63   2e-09
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    63   2e-09
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    63   2e-09
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    63   2e-09
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    63   2e-09
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    62   3e-09
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    63   3e-09
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    59   3e-09
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    62   3e-09
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     63   3e-09
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    63   3e-09
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    62   4e-09
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    62   4e-09
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    62   4e-09
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    62   4e-09
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    62   4e-09
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    62   4e-09
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    62   5e-09
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    62   5e-09
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    62   5e-09
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    62   5e-09
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    62   5e-09
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    62   6e-09
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    60   6e-09
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     61   6e-09
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    62   6e-09
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    62   6e-09
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    62   7e-09
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    62   7e-09
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    61   8e-09
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    61   8e-09
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    61   8e-09
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    61   9e-09
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    61   9e-09
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    61   9e-09
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    60   1e-08
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    60   1e-08
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    61   1e-08
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    61   1e-08
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    60   1e-08
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    61   1e-08
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    60   1e-08
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    60   1e-08
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    59   1e-08
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    59   2e-08
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    60   2e-08
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    60   2e-08
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    60   2e-08
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    60   2e-08
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    60   2e-08
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    60   2e-08
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    60   2e-08
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    60   2e-08
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    60   2e-08
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    59   2e-08
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    59   2e-08
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    59   3e-08
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    60   3e-08
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    59   3e-08
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    60   3e-08
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    59   3e-08
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    59   3e-08
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    59   4e-08
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    59   4e-08
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    59   4e-08
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    59   4e-08
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       59   4e-08
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    59   5e-08
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    58   5e-08
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    59   5e-08
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    59   5e-08
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    59   6e-08
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    59   6e-08
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    59   6e-08
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    58   6e-08
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    59   6e-08
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    58   6e-08
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    59   7e-08
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    57   7e-08
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    58   7e-08
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    59   7e-08
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    59   7e-08
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    58   8e-08
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    58   1e-07
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    58   1e-07
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    58   1e-07
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    58   1e-07
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    58   1e-07
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    58   1e-07
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    57   1e-07
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    57   1e-07
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    58   1e-07
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    56   1e-07
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    58   1e-07
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    57   1e-07
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    58   1e-07
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    56   1e-07
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    57   2e-07
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    57   2e-07
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    56   2e-07
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    57   2e-07
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    57   2e-07
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    56   2e-07
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    57   2e-07
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    57   2e-07
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    57   2e-07
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    57   2e-07
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    57   2e-07
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    56   2e-07
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    57   2e-07
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    56   2e-07
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    56   3e-07
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    56   3e-07
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    56   3e-07
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    56   4e-07
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    55   4e-07
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    55   4e-07
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    55   4e-07
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    55   4e-07
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    56   4e-07
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    56   4e-07
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    56   5e-07
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    55   5e-07
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    55   5e-07
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    56   5e-07
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      55   5e-07
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    55   5e-07
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    55   5e-07
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    55   6e-07
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    55   6e-07
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    55   6e-07
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    55   6e-07
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    55   7e-07
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    55   7e-07
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    55   7e-07
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    55   7e-07
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    55   7e-07
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    55   7e-07
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    55   7e-07
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    54   7e-07
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    55   8e-07
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    55   8e-07
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    55   8e-07
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              55   9e-07
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    54   9e-07
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    54   1e-06
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    55   1e-06
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    54   1e-06
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    54   1e-06
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    54   1e-06
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    55   1e-06
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    54   1e-06
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    54   1e-06
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       54   1e-06
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    54   1e-06
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    54   1e-06
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    54   1e-06
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    54   1e-06
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    54   1e-06
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    53   2e-06
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    54   2e-06
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    53   2e-06
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    54   2e-06
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    53   2e-06
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    54   2e-06
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    53   2e-06
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    53   2e-06
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    54   2e-06
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    53   2e-06
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    54   2e-06
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    54   2e-06
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    53   2e-06
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    54   2e-06
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    54   2e-06
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    53   2e-06
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    54   2e-06
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    53   2e-06
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    52   3e-06
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    53   3e-06
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    53   3e-06
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    53   3e-06
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    53   3e-06
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    53   3e-06
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    53   3e-06
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    52   3e-06
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    53   3e-06
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    52   3e-06
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    53   3e-06
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    52   3e-06
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    53   3e-06
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    53   3e-06
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    53   3e-06
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    53   3e-06
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    53   3e-06
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    52   4e-06
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    53   4e-06
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    53   4e-06
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    52   4e-06
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    52   4e-06
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    52   4e-06
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    52   4e-06
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    52   5e-06
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    52   5e-06
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    52   5e-06
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    52   5e-06
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    52   5e-06
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    52   5e-06
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    52   5e-06
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    52   5e-06
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    52   5e-06
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    52   6e-06
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    52   6e-06
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    52   6e-06
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    52   6e-06
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    52   6e-06
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    52   6e-06
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    52   6e-06
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    51   6e-06
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    51   7e-06
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    52   7e-06
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    52   7e-06
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    52   7e-06
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    51   7e-06
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    52   8e-06
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    52   8e-06
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     52   8e-06
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    51   8e-06
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    52   8e-06
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    52   8e-06
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    52   8e-06
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    51   9e-06
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    52   1e-05
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    51   1e-05
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    51   1e-05
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    51   1e-05
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    50   1e-05
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    51   1e-05
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    51   1e-05
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    50   1e-05
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    50   1e-05
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    51   1e-05
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    50   1e-05
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    50   1e-05
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    50   1e-05
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    50   2e-05
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    51   2e-05
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    50   2e-05
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    50   2e-05
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    50   2e-05
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    50   2e-05
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    50   2e-05
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    50   2e-05
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    50   2e-05
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    50   2e-05
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    50   2e-05
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    50   3e-05
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    50   3e-05
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    50   3e-05
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    49   3e-05
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    50   3e-05
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    49   3e-05
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    49   3e-05
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    49   3e-05
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    50   3e-05
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    49   3e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    49   3e-05
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    49   3e-05
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    49   3e-05
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    49   3e-05
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    50   4e-05
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    49   4e-05
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    49   4e-05
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    50   4e-05
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    49   4e-05
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    49   4e-05
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    49   4e-05
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    49   4e-05
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     49   5e-05
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    49   5e-05
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    49   5e-05
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    49   5e-05
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    49   5e-05
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    49   5e-05
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    49   5e-05
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    49   5e-05
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    49   5e-05
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    49   6e-05
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    49   6e-05
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    49   6e-05
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    49   6e-05
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    49   6e-05
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    49   6e-05
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    49   6e-05
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    49   6e-05
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    49   6e-05
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    49   7e-05
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    48   7e-05
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    49   7e-05
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    49   7e-05
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    48   8e-05
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    48   8e-05
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    49   8e-05
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    48   8e-05
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    48   8e-05
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    48   8e-05
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    48   9e-05
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    48   9e-05
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    47   9e-05
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    48   1e-04
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    47   1e-04
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    48   1e-04
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    48   1e-04
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    48   1e-04
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    48   1e-04
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    48   1e-04
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    48   1e-04
NCAS0A07160 Chr1 complement(1419393..1420385) [993 bp, 330 aa] {...    47   1e-04
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    47   1e-04
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    48   1e-04
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    47   1e-04
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    47   1e-04
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    48   1e-04
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    48   1e-04
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    48   1e-04
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    47   1e-04
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    48   1e-04
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    48   1e-04
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    47   1e-04
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    47   1e-04
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    47   1e-04
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    47   1e-04
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    47   1e-04
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    48   1e-04
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    47   1e-04
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    47   2e-04
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    47   2e-04
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    47   2e-04
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    47   2e-04
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    47   2e-04
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    47   2e-04
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    47   2e-04
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    47   2e-04
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    47   2e-04
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    47   2e-04
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    47   2e-04
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    47   2e-04
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    47   2e-04
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    47   2e-04
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    47   2e-04
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    47   2e-04
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    47   2e-04
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    47   2e-04
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    47   2e-04
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    47   2e-04
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    47   2e-04
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    47   2e-04
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    47   2e-04
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    47   2e-04
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    47   2e-04
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    47   2e-04
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    47   2e-04
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    47   2e-04
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    47   2e-04
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    47   3e-04
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    47   3e-04
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    46   3e-04
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    46   3e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    47   3e-04
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    47   3e-04
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    46   3e-04
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    46   3e-04
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    46   3e-04
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    46   4e-04
Smik_4.585 Chr4 complement(1040861..1043125) [2265 bp, 754 aa] {...    46   4e-04
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    46   4e-04
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    44   4e-04
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    45   4e-04
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    46   4e-04
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    46   4e-04
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    46   4e-04
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    46   4e-04
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    46   5e-04
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    45   5e-04
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    46   5e-04
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    46   5e-04
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    45   6e-04
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    46   6e-04
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    45   6e-04
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    45   8e-04
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    45   8e-04
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    45   8e-04
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    45   8e-04
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    45   8e-04
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    45   9e-04
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    45   0.001
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    45   0.001
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    45   0.001
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    45   0.001
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    44   0.001
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    45   0.001
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    45   0.001
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    45   0.001
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    45   0.001
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    45   0.001
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    45   0.001
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    45   0.001
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    45   0.001
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    45   0.001
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    45   0.001
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    44   0.001
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    44   0.001
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    44   0.001
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    44   0.001
Smik_7.50 Chr7 complement(84865..86058) [1194 bp, 397 aa] {ON} Y...    44   0.001
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    44   0.001
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    44   0.001
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    44   0.001
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    44   0.001
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    44   0.001
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    44   0.001
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    44   0.001
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    44   0.001
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    44   0.001
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    44   0.001
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    44   0.001
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    44   0.002
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    44   0.002
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    44   0.002
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    44   0.002
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    44   0.002
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    44   0.002
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    44   0.002
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    44   0.002
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    44   0.002
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    44   0.002
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    44   0.002
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    44   0.002
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    44   0.002
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    44   0.002
Skud_4.592 Chr4 complement(1050634..1052892) [2259 bp, 752 aa] {...    44   0.002
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    44   0.002
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    43   0.002
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    44   0.002
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    43   0.002
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    44   0.002
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    43   0.002
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    44   0.003
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    44   0.003
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    44   0.003
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    44   0.003
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    43   0.003
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    43   0.003
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    43   0.003
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    43   0.003
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    43   0.003
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    43   0.003
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    43   0.003
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    43   0.003
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    43   0.003
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    43   0.003
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    43   0.003
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    43   0.003
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    43   0.004
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    43   0.004
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    43   0.004
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    43   0.004
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    43   0.004
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    43   0.004
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    43   0.004
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    43   0.004
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    42   0.004
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    42   0.004
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    43   0.004
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    42   0.004
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    42   0.005
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    42   0.005
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    43   0.005
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    42   0.005
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    43   0.005
Suva_2.495 Chr2 complement(871929..874187) [2259 bp, 752 aa] {ON...    43   0.005
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    42   0.005
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    42   0.005
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    43   0.005
SAKL0C03344g Chr3 (315639..317087) [1449 bp, 482 aa] {ON} weakly...    42   0.005
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    42   0.005
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    42   0.005
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    42   0.006
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    42   0.006
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    42   0.006
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    42   0.006
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    42   0.006
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    42   0.006
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    42   0.006
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    42   0.006
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    42   0.006
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    42   0.007
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    42   0.007
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    42   0.007
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    42   0.007
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    42   0.007
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    42   0.007
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     42   0.007
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    42   0.008
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    42   0.008
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    42   0.008
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    42   0.008
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    42   0.008
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    42   0.008
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    42   0.008
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    42   0.008
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    42   0.009
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    42   0.009
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    41   0.009
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    42   0.009
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    42   0.009
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    42   0.009
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    42   0.010
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    41   0.010
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    42   0.010
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    42   0.011
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    41   0.011
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    41   0.011
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    41   0.011
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    41   0.011
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    42   0.012
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    41   0.012
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    41   0.012
KNAG0K00850 Chr11 complement(159329..162832) [3504 bp, 1167 aa] ...    42   0.012
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    41   0.013
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    41   0.013
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    41   0.013
Skud_7.55 Chr7 complement(95372..96565) [1194 bp, 397 aa] {ON} Y...    41   0.013
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    40   0.014
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    41   0.014
YGL213C Chr7 complement(90054..91247) [1194 bp, 397 aa] {ON}  SK...    41   0.014
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    41   0.014
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    41   0.015
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    41   0.015
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    41   0.015
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    41   0.015
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    41   0.016
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    40   0.017
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    40   0.017
KAFR0C01310 Chr3 (268850..271888) [3039 bp, 1012 aa] {ON} Anc_3....    41   0.017
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    41   0.018
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    40   0.019
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    40   0.019
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    40   0.019
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    41   0.019
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    40   0.020
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    40   0.020
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    40   0.022
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    40   0.022
KLLA0F21076g Chr6 (1966373..1969036) [2664 bp, 887 aa] {ON} weak...    40   0.023
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    40   0.024
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    40   0.024
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    40   0.026
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    40   0.027
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    40   0.027
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    40   0.028
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    40   0.028
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    40   0.030
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    40   0.030
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    40   0.030
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    40   0.031
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    40   0.031
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    40   0.032
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    40   0.033
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    40   0.033
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    40   0.033
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    40   0.033
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    40   0.033
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    40   0.034
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    40   0.035
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               40   0.036
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    40   0.037
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    40   0.037
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    40   0.037
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    40   0.037
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    40   0.038
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    40   0.038
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    40   0.039
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    40   0.041
CAGL0M01430g Chr13 (164428..166683) [2256 bp, 751 aa] {ON} highl...    40   0.042
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    39   0.042
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    40   0.043
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    40   0.043
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    40   0.043
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    39   0.043
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    39   0.043
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    39   0.044
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    40   0.045
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    39   0.045
KNAG0B00900 Chr2 (164610..165698) [1089 bp, 362 aa] {ON} Anc_3.4...    39   0.046
TPHA0M00700 Chr13 complement(132140..135313) [3174 bp, 1057 aa] ...    40   0.047
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    39   0.047
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    39   0.048
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    39   0.049
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    39   0.049
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    39   0.049
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    39   0.050
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    39   0.050
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    39   0.050
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    39   0.051
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    39   0.052
TDEL0D05080 Chr4 (924017..927007) [2991 bp, 996 aa] {ON} Anc_3.1...    39   0.052
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    39   0.052
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    39   0.055
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    39   0.055
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    39   0.056
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    39   0.056
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    39   0.056
KAFR0C02420 Chr3 (471045..472484) [1440 bp, 479 aa] {ON} Anc_1.3...    39   0.057
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    39   0.057
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    39   0.058
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    39   0.061
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    39   0.061
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    39   0.062
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    39   0.062
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    39   0.063
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    39   0.063
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    39   0.065
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    39   0.065
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    39   0.065
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    39   0.066
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    39   0.067
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    39   0.067
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    39   0.067
ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]...    39   0.067
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    39   0.069
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    39   0.070
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    39   0.072
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    39   0.072
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    39   0.073
TBLA0A03210 Chr1 complement(762289..764535) [2247 bp, 748 aa] {O...    39   0.073
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    39   0.074
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    39   0.075
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    39   0.076
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    39   0.077
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    39   0.081
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    39   0.083
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    39   0.088
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    39   0.089
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    38   0.090
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    39   0.090
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    38   0.090
KNAG0A06340 Chr1 (967160..970114) [2955 bp, 984 aa] {ON} Anc_2.4...    39   0.093
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    39   0.094
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    38   0.094
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    38   0.095
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    39   0.096
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    38   0.097
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    39   0.097
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    38   0.098
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    38   0.099
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    38   0.10 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    39   0.10 
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    38   0.10 
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    38   0.10 
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    38   0.11 
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    38   0.11 
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    38   0.11 
Suva_7.48 Chr7 complement(86451..87644) [1194 bp, 397 aa] {ON} Y...    38   0.11 
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    38   0.11 
TDEL0F03590 Chr6 (659038..660756) [1719 bp, 572 aa] {ON} Anc_3.4...    38   0.11 
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    38   0.11 
SAKL0H24530g Chr8 complement(2127253..2128998) [1746 bp, 581 aa]...    38   0.12 
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    38   0.12 
Kwal_26.8604 s26 complement(859891..862494) [2604 bp, 867 aa] {O...    38   0.12 
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    38   0.12 
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    38   0.12 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    38   0.12 
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    38   0.12 
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    38   0.12 
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    38   0.13 
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    38   0.13 
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    38   0.13 
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    38   0.13 
KLLA0E18063g Chr5 (1608371..1609351) [981 bp, 326 aa] {ON} highl...    38   0.13 
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    38   0.13 
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    38   0.13 
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    38   0.13 
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    38   0.13 
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    38   0.14 
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    38   0.14 
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    38   0.14 
NCAS0E03500 Chr5 complement(694491..696143) [1653 bp, 550 aa] {O...    38   0.14 
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    38   0.14 
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    38   0.14 
SAKL0D07238g Chr4 complement(594187..596784) [2598 bp, 865 aa] {...    38   0.14 
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    38   0.14 
ZYRO0D10516g Chr4 (883922..886171) [2250 bp, 749 aa] {ON} simila...    38   0.15 
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    38   0.15 
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    38   0.15 
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    38   0.16 
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      37   0.16 
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    37   0.16 
CAGL0J10340g Chr10 complement(1010761..1011777) [1017 bp, 338 aa...    37   0.16 
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    37   0.16 
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    37   0.16 
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    38   0.16 
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    38   0.16 
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    37   0.16 
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    37   0.17 
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    37   0.17 
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    37   0.17 
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    37   0.17 
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    38   0.19 
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    37   0.19 
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    37   0.19 
Kpol_1072.46 s1072 (103226..105850) [2625 bp, 874 aa] {ON} (1032...    37   0.19 
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    37   0.20 
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    37   0.20 
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    37   0.20 
Ecym_8393 Chr8 complement(805739..807394) [1656 bp, 551 aa] {ON}...    37   0.20 
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    37   0.20 
Kwal_YGOB_27.12717 s27 (1347453..1348746,1348819..1349414) [1890...    37   0.21 
CAGL0B00748g Chr2 (65727..68165) [2439 bp, 812 aa] {ON} similar ...    37   0.21 
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    37   0.22 
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    37   0.22 
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    37   0.22 
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    37   0.22 
KLLA0D04664g Chr4 (397818..399320) [1503 bp, 500 aa] {ON} simila...    37   0.22 
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    37   0.22 
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    37   0.22 
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    37   0.23 
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    37   0.23 
Kpol_1008.20 s1008 (39393..41141) [1749 bp, 582 aa] {ON} (39393....    37   0.23 
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    37   0.23 
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    37   0.23 
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...    37   0.24 
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    37   0.24 
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    37   0.24 
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    37   0.24 
SAKL0D09504g Chr4 (792974..794599) [1626 bp, 541 aa] {ON} highly...    37   0.25 
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    37   0.25 
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    37   0.25 
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    37   0.26 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    37   0.26 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    37   0.27 
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    37   0.27 
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    37   0.28 
Kwal_55.20233 s55 (311887..314130) [2244 bp, 747 aa] {ON} YDR324...    37   0.30 
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    36   0.31 
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    37   0.31 
NCAS0D00540 Chr4 complement(85322..86953) [1632 bp, 543 aa] {ON}...    37   0.32 
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    37   0.32 
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    37   0.32 
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    37   0.33 
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    37   0.33 
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    37   0.33 
KLTH0H11286g Chr8 complement(965578..967500) [1923 bp, 640 aa] {...    37   0.34 
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    37   0.34 
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    37   0.35 
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    36   0.36 
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    37   0.36 
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    36   0.37 
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    36   0.38 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    37   0.38 
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    37   0.38 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    37   0.39 
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    36   0.39 
KLTH0H12870g Chr8 (1098531..1100117) [1587 bp, 528 aa] {ON} simi...    36   0.40 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    37   0.40 
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    37   0.41 
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    36   0.42 
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    36   0.42 
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    36   0.42 
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    36   0.43 
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    36   0.43 
Skud_16.142 Chr16 complement(261333..262718) [1386 bp, 461 aa] {...    36   0.43 
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    36   0.44 
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    36   0.44 
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    36   0.46 
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    36   0.48 
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    36   0.48 
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    36   0.48 
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    36   0.48 
Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa] ...    36   0.49 
CAGL0F01837g Chr6 (181178..182980) [1803 bp, 600 aa] {ON} simila...    36   0.49 
KLLA0C06633g Chr3 (580349..582244) [1896 bp, 631 aa] {ON} simila...    36   0.49 
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    36   0.49 
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    36   0.50 
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    36   0.50 
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    36   0.51 
NCAS0B08910 Chr2 complement(1709752..1712469) [2718 bp, 905 aa] ...    36   0.52 
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    36   0.55 
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    36   0.56 
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    36   0.57 
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    35   0.57 
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    35   0.58 
YER082C Chr5 complement(324272..325936) [1665 bp, 554 aa] {ON}  ...    36   0.60 
KNAG0L00330 Chr12 (45380..47014) [1635 bp, 544 aa] {ON} Anc_8.43...    36   0.60 
Ecym_4649 Chr4 (1264219..1265784) [1566 bp, 521 aa] {ON} similar...    36   0.61 
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    36   0.61 
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    36   0.62 
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    36   0.63 
KLLA0F16038g Chr6 complement(1487475..1490063) [2589 bp, 862 aa]...    36   0.63 
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    35   0.64 
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    36   0.66 
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    35   0.68 
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    35   0.69 
NDAI0I01360 Chr9 complement(331085..332122) [1038 bp, 345 aa] {O...    35   0.69 
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    35   0.69 
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    35   0.71 
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    36   0.76 
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    35   0.76 
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    35   0.77 
TPHA0N01070 Chr14 complement(224464..225525) [1062 bp, 353 aa] {...    35   0.78 
NDAI0I02940 Chr9 (693605..694816) [1212 bp, 403 aa] {ON} Anc_3.5...    35   0.79 
KNAG0F02280 Chr6 complement(432897..433967) [1071 bp, 356 aa] {O...    35   0.81 
Kpol_534.25 s534 complement(58326..59444) [1119 bp, 372 aa] {ON}...    35   0.81 
NDAI0G05990 Chr7 complement(1480864..1482261) [1398 bp, 465 aa] ...    35   0.82 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    35   0.83 
Kpol_1050.56 s1050 (126134..127528,127531..127563,127565..128245...    35   0.84 
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    35   0.86 
CAGL0J08778g Chr10 (868299..869195) [897 bp, 298 aa] {ON} highly...    35   0.87 
KLTH0C01848g Chr3 complement(165526..166121,166518..167517) [159...    35   0.90 
Skud_12.121 Chr12 complement(236234..238000) [1767 bp, 588 aa] {...    35   0.90 
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    35   0.92 
KLTH0H11000g Chr8 complement(943669..946260) [2592 bp, 863 aa] {...    35   0.96 
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    35   0.96 
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    35   0.99 
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    35   1.00 
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    35   1.0  
Kpol_1055.2 s1055 complement(663..2915) [2253 bp, 750 aa] {ON} c...    35   1.0  
TBLA0H01080 Chr8 complement(240857..242461) [1605 bp, 534 aa] {O...    35   1.0  
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    35   1.1  
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    35   1.1  
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    35   1.1  
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    35   1.1  
NDAI0D02490 Chr4 (575553..577499) [1947 bp, 648 aa] {ON} Anc_5.104     35   1.1  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    35   1.1  
KLTH0D10054g Chr4 complement(835206..837818) [2613 bp, 870 aa] {...    35   1.1  
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    35   1.1  
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    35   1.2  
AAL119W Chr1 (137922..139535) [1614 bp, 537 aa] {ON} Syntenic ho...    35   1.2  
Smik_15.69 Chr15 complement(118407..121760) [3354 bp, 1117 aa] {...    35   1.2  
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    35   1.2  
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    35   1.2  
NCAS0D03490 Chr4 (650325..651362) [1038 bp, 345 aa] {ON} Anc_6.159     35   1.2  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    34   1.3  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    35   1.3  
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             35   1.3  
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    35   1.3  
KAFR0A03660 Chr1 (748252..750816) [2565 bp, 854 aa] {ON} Anc_1.3...    35   1.3  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    35   1.4  
ZYRO0G00946g Chr7 complement(72544..74184) [1641 bp, 546 aa] {ON...    35   1.4  
KAFR0D01020 Chr4 (210874..212490) [1617 bp, 538 aa] {ON} Anc_8.4...    35   1.4  
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    35   1.4  
Skud_15.66 Chr15 complement(114566..117898) [3333 bp, 1110 aa] {...    35   1.5  
NDAI0C04390 Chr3 complement(993861..996212) [2352 bp, 783 aa] {O...    35   1.5  
TDEL0G00730 Chr7 (147888..152492) [4605 bp, 1534 aa] {ON} Anc_5....    35   1.5  
NDAI0D00630 Chr4 (139065..139967) [903 bp, 300 aa] {ON} Anc_7.33...    34   1.5  
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    34   1.5  
TDEL0F03030 Chr6 (545760..552173) [6414 bp, 2137 aa] {ON} Anc_1....    35   1.5  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    35   1.5  
SAKL0F11022g Chr6 (863614..864504) [891 bp, 296 aa] {ON} highly ...    34   1.5  
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    35   1.5  
Kwal_23.4327 s23 (670568..675208) [4641 bp, 1546 aa] {ON} YHR186...    35   1.6  
Suva_10.139 Chr10 complement(252982..254748) [1767 bp, 588 aa] {...    34   1.6  
Ecym_2240 Chr2 (470406..473900) [3495 bp, 1164 aa] {ON} similar ...    35   1.6  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    34   1.6  
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    34   1.6  
NCAS0A09060 Chr1 (1793006..1793854) [849 bp, 282 aa] {ON} Anc_1....    34   1.6  
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    34   1.6  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    35   1.7  
Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121...    34   1.7  
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    35   1.7  
NCAS0B05410 Chr2 (1008672..1012064) [3393 bp, 1130 aa] {ON} Anc_...    34   1.7  
TBLA0A02500 Chr1 complement(599925..601844) [1920 bp, 639 aa] {O...    34   1.7  
SAKL0F09504g Chr6 complement(728890..730611) [1722 bp, 573 aa] {...    34   1.7  
Ecym_3389 Chr3 (736712..737695) [984 bp, 327 aa] {ON} similar to...    34   1.7  
TBLA0G03390 Chr7 complement(900177..902099) [1923 bp, 640 aa] {O...    34   1.7  
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    34   1.7  
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    34   1.7  
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    34   1.8  
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    34   1.8  
Smik_12.117 Chr12 complement(232159..233895) [1737 bp, 578 aa] {...    34   1.8  
YGL100W Chr7 (313234..314283) [1050 bp, 349 aa] {ON}  SEH1Compon...    34   1.8  
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    34   1.9  
NDAI0C06420 Chr3 complement(1486617..1488686) [2070 bp, 689 aa] ...    34   1.9  
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    34   1.9  
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    34   1.9  
KLLA0C18491g Chr3 (1632791..1636387) [3597 bp, 1198 aa] {ON} sim...    34   2.0  
ADL135C Chr4 complement(454163..454761,454819..456085) [1866 bp,...    34   2.0  
KNAG0C06020 Chr3 complement(1172661..1176416) [3756 bp, 1251 aa]...    34   2.0  
ACL099W Chr3 (165316..166389) [1074 bp, 357 aa] {ON} Syntenic ho...    34   2.0  
KLTH0A05082g Chr1 complement(424327..425985) [1659 bp, 552 aa] {...    34   2.0  
TBLA0B08220 Chr2 complement(1962086..1963405) [1320 bp, 439 aa] ...    34   2.0  
NCAS0B07540 Chr2 complement(1422115..1424745) [2631 bp, 876 aa] ...    34   2.0  
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    34   2.1  
ZYRO0G21736g Chr7 (1788792..1789856) [1065 bp, 354 aa] {ON} high...    34   2.1  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    34   2.1  
Smik_14.82 Chr14 (149174..150442) [1269 bp, 422 aa] {ON} YNL253W...    34   2.2  
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    34   2.2  
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    33   2.2  
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    34   2.2  
KNAG0D00440 Chr4 (64241..65488) [1248 bp, 415 aa] {ON} Anc_6.333...    34   2.2  
ADL316C Chr4 complement(141605..145861) [4257 bp, 1418 aa] {ON} ...    34   2.2  
ACL034W Chr3 (302396..304048) [1653 bp, 550 aa] {ON} Syntenic ho...    34   2.2  
TBLA0A07380 Chr1 complement(1829567..1832275) [2709 bp, 902 aa] ...    34   2.3  
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    34   2.4  
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    34   2.4  
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    34   2.4  
Skud_16.374 Chr16 complement(672714..674045) [1332 bp, 443 aa] {...    33   2.4  
YLR055C Chr12 complement(251272..253080) [1809 bp, 602 aa] {ON} ...    34   2.4  
Suva_15.79 Chr15 complement(128494..131850) [3357 bp, 1118 aa] {...    34   2.4  
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    34   2.5  
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    34   2.5  
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    34   2.5  
KLTH0B08800g Chr2 complement(712793..717340) [4548 bp, 1515 aa] ...    34   2.6  
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    33   2.6  
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    34   2.6  
Ecym_3559 Chr3 complement(1060241..1061944) [1704 bp, 567 aa] {O...    33   2.7  
TBLA0I03300 Chr9 (802032..803279) [1248 bp, 415 aa] {ON} Anc_3.5...    33   2.7  
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    33   2.8  
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    33   2.9  
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    33   2.9  
SAKL0H21890g Chr8 complement(1910870..1913074) [2205 bp, 734 aa]...    33   3.1  
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    33   3.1  
ADL054W Chr4 (586898..588772) [1875 bp, 624 aa] {ON} Syntenic ho...    33   3.1  
ZYRO0F03256g Chr6 (274828..276807) [1980 bp, 659 aa] {ON} simila...    33   3.2  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    33   3.2  
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    33   3.3  
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    33   3.3  
Suva_7.166 Chr7 (307962..309014) [1053 bp, 350 aa] {ON} YGL100W ...    33   3.4  
KAFR0H02680 Chr8 (507660..510239) [2580 bp, 859 aa] {ON} Anc_8.6...    33   3.4  
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    33   3.4  
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    33   3.4  
TBLA0B01860 Chr2 complement(424732..427818) [3087 bp, 1028 aa] {...    33   3.4  
ABR189W Chr2 (764141..765370) [1230 bp, 409 aa] {ON} Syntenic ho...    33   3.4  
ZYRO0E08602g Chr5 (687971..689242) [1272 bp, 423 aa] {ON} simila...    33   3.5  
KAFR0A04420 Chr1 complement(881701..882768) [1068 bp, 355 aa] {O...    33   3.5  
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    33   3.5  
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    33   3.7  
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    33   3.8  
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    33   3.8  
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    33   3.8  
Skud_7.174 Chr7 (317467..318516) [1050 bp, 349 aa] {ON} YGL100W ...    33   3.8  
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    33   3.9  
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    33   3.9  
NCAS0F00640 Chr6 complement(123774..124396,124484..125543) [1683...    33   4.0  
TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.6...    33   4.0  
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    33   4.0  
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    33   4.0  
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    33   4.1  
CAGL0J03564g Chr10 (340647..343736) [3090 bp, 1029 aa] {ON} simi...    33   4.1  
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    33   4.1  
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    33   4.1  
Kwal_56.24596 s56 complement(1068314..1069198) [885 bp, 294 aa] ...    33   4.2  
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    33   4.2  
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    33   4.3  
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    33   4.3  
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    33   4.4  
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    33   4.5  
AFL038C Chr6 complement(367581..368573) [993 bp, 330 aa] {ON} Sy...    33   4.5  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    33   4.5  
KAFR0B04210 Chr2 (874621..875803,875906..876507) [1785 bp, 594 a...    33   4.6  
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    33   4.6  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    33   4.6  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    33   4.6  
Skud_2.412 Chr2 complement(733900..736536) [2637 bp, 878 aa] {ON...    33   4.7  
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    33   4.7  
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    33   4.8  
YBR281C Chr2 complement(764970..767606) [2637 bp, 878 aa] {ON}  ...    33   4.8  
KLLA0F06754g Chr6 complement(650475..651509) [1035 bp, 344 aa] {...    33   4.9  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    33   4.9  
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    33   5.0  
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    33   5.0  
TDEL0C02080 Chr3 (360056..360940) [885 bp, 294 aa] {ON} Anc_7.33...    32   5.0  
KNAG0I02870 Chr9 (558973..562131) [3159 bp, 1052 aa] {ON} Anc_6....    33   5.1  
Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON...    33   5.3  
TBLA0A06550 Chr1 (1605033..1607276) [2244 bp, 747 aa] {ON} Anc_5...    33   5.4  
TDEL0D02140 Chr4 complement(414754..415587) [834 bp, 277 aa] {ON...    32   5.4  
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    33   5.5  
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    32   5.5  
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    33   5.5  
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    33   5.6  
KAFR0D03800 Chr4 complement(735667..736953) [1287 bp, 428 aa] {O...    32   5.6  
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    32   5.8  
SAKL0H07832g Chr8 (669398..671995) [2598 bp, 865 aa] {ON} simila...    33   5.8  
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    32   5.8  
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    33   5.8  
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    32   5.9  
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    32   5.9  
TDEL0D01740 Chr4 (346288..348957) [2670 bp, 889 aa] {ON} Anc_1.3...    33   6.0  
TDEL0B03950 Chr2 complement(709272..710306) [1035 bp, 344 aa] {O...    32   6.2  
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    32   6.3  
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    32   6.4  
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    32   6.5  
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    32   6.6  
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    32   6.6  
KLTH0E03872g Chr5 (353271..355511) [2241 bp, 746 aa] {ON} simila...    32   6.7  
NDAI0E00410 Chr5 (72769..74559) [1791 bp, 596 aa] {ON} Anc_8.817...    32   6.7  
TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.3...    32   6.7  
CAGL0I07821g Chr9 complement(751754..755143) [3390 bp, 1129 aa] ...    32   6.9  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    32   6.9  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    32   7.0  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    32   7.1  
NDAI0B04880 Chr2 complement(1193217..1195928) [2712 bp, 903 aa] ...    32   7.2  
NDAI0F03380 Chr6 (813767..815455) [1689 bp, 562 aa] {ON} Anc_2.7...    32   7.3  
SAKL0A05962g Chr1 complement(543144..544184) [1041 bp, 346 aa] {...    32   7.4  
Suva_16.171 Chr16 complement(299070..300455) [1386 bp, 461 aa] {...    32   7.4  
CAGL0J11286g Chr10 (1097912..1099498) [1587 bp, 528 aa] {ON} sim...    32   7.5  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    32   7.6  
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...    32   7.7  
Smik_6.325 Chr6 complement(511278..513968) [2691 bp, 896 aa] {ON...    32   7.7  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    32   7.9  
TBLA0B02480 Chr2 complement(569751..571400) [1650 bp, 549 aa] {O...    32   7.9  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    32   7.9  
TDEL0F03510 Chr6 complement(647165..648505) [1341 bp, 446 aa] {O...    32   8.0  
Suva_16.463 Chr16 (801619..804411) [2793 bp, 930 aa] {ON} YPR135...    32   8.1  
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    32   8.2  
TPHA0M00990 Chr13 complement(193577..194938) [1362 bp, 453 aa] {...    32   8.3  
TBLA0B04120 Chr2 (941318..943987) [2670 bp, 889 aa] {ON} Anc_8.6...    32   8.7  
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    32   8.7  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    32   8.8  
TBLA0E03460 Chr5 (859536..863192) [3657 bp, 1218 aa] {ON} Anc_3....    32   8.8  
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    32   8.8  
KNAG0B02670 Chr2 (517131..518042) [912 bp, 303 aa] {ON} Anc_7.33...    32   8.8  
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    32   8.9  
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    32   8.9  
KLLA0A07106g Chr1 complement(640536..641468) [933 bp, 310 aa] {O...    32   9.1  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    32   9.1  
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    32   9.5  
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    31   9.5  
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    32   10.0 

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1844 bits (4777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 904/943 (95%), Positives = 904/943 (95%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM
Sbjct: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH
Sbjct: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
           KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKT                    
Sbjct: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   TDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN
Sbjct: 301 KRLREKGLTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK
Sbjct: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALAISTDGSFVVSSSHDHSIRIWEETEDQVF           QYEDTLLTSLEEGNGDD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780
           AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK
Sbjct: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780

Query: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840
           LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM
Sbjct: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840

Query: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900
           QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF
Sbjct: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943
           NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1745 bits (4520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 835/943 (88%), Positives = 886/943 (93%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQ+A+FGVIASNANCVW+PASSRT +GSGPGQLITSALENVN+WDIKTGDL+
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           +TLSDGLPPGASDA+G+KPAECTYLEVHQDT+LLAVGYADGVIKVWDL+SKTVLLNFNGH
Sbjct: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           KAAITL+QFD TGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKD+ITGFWCQGEDWL+ST
Sbjct: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDG+IK+WDLKTQQCIETHIAHTGECWGL+VKDDLLITT TDSQVK+WKLN+EN+K+G 
Sbjct: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
           KLTEMG FEKQSKQRGLKIEFITN SDG SFFYIQNADKT                    
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   TDEEI+KSIKDSYSSLILHPFQTVRSLYKIKSASWTT+TSSKLELV+TTSNN
Sbjct: 301 KRLREKGLTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           TIEYYSIPYEKR+PTSPAPLKTHTIELQGQRTD+RSID+SDDN+LLATASNGSLKIWNVK
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           THKCIRTFECGYALTCKFLPGGLLVILGTR+GELQLFDLASSSLLDTIEDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           LTSDGKRLVTGSADKTVKFWDFQVE TLVPGTKDKF+P+LKLNHDTTLELNDDILS+RIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALAISTDGSFVVSSSHDHSIRIWEETEDQVF           QYEDTLLTSLEEGNGDD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780
           AFKGDATGE+V+DE SGVHKQTLESLKAGE+LMEALDLGIAEIEG+E Y++DMKLWQRKK
Sbjct: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780

Query: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840
           LGEAP+KPQGNSVLIAV KTPEQYIMDTL RIR+SQLEDALMVMPFSYVLKFLKF D++M
Sbjct: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840

Query: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900
           QNK+LLH+HLPLICKNLFFIIKFNHKEL+SQKNEELK Q++RVKTELRNALKSTEDDLGF
Sbjct: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943
           NVQGLKFI+QQWNL+HNYEFVDEYDQQEKE+  ARKR FE V+
Sbjct: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARKRVFERVI 943

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 1738 bits (4501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 835/943 (88%), Positives = 882/943 (93%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQ+A+FGVIASNANCVW+PASS   +GSGPGQLITSALE+VN+WDIKTGDL+
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV 60

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           S LSDGLPPGASDARGAKPAECTYLE H+DTDLLAVGYADGVIKVWDLMSKTVLLNFNGH
Sbjct: 61  SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDGMIKLWDLKT QCIETHIAHTGECWGL+VKDDLLITTGTDSQVK+WKL+IENDK+GG
Sbjct: 181 SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG 240

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
           KLTEMG FEKQSKQRGLKIEFITN+SD  SFFYIQNADKT                    
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   T+EEI KSIK+SYSS ILHPFQT+RSLYKIKSASWTT++SSKLELVLTTS+N
Sbjct: 301 KRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSN 360

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           TIEYYSIPYEKR+PTSPAPLKTHTIELQGQRTD+RSIDISDDN+LLATASNGSLKIWN+K
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIK 420

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           LTSDGKRLVTGSADKTVKFWDF+VEN+LVPGTK+KFLP+LKL+HDTTLEL DDIL +R+S
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLP+SHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALA++TDG FVVSSSHDHSIRIWEETEDQVF           QYEDTLLTSLEEGNGDD
Sbjct: 661 WALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780
           AFK DA+GE V+DE SGVHKQTLESLKAGERLMEALDLGIAEIEG+EAY+RDMKLWQRKK
Sbjct: 721 AFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK 780

Query: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840
           LGEAPIKPQGN+VLIAVNKTPEQYIMDTLLRIR SQLEDALMVMPFSYVLKFLKFID++M
Sbjct: 781 LGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900
           QNK+LLHSHLPLICKNLFFIIKFNHKELVSQKNEELK Q++RVKTELR+ALKSTEDDLGF
Sbjct: 841 QNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGF 900

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943
           NVQGLKF+KQQWNLRHNYEFVDEYDQQEKESN ARKR F TV+
Sbjct: 901 NVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARKRVFGTVI 943

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1734 bits (4491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 831/943 (88%), Positives = 876/943 (92%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQSA FGVIASNANCVWLP SSRT  GSGPGQLITSALENVN+WDIKTGDL+
Sbjct: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           +TLSDGLPPGASDARG+KPAECTYLEVH+DTDLLAVGYADGVIKVWDLMSKTVLLNFNGH
Sbjct: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           KAAITLLQFD TGTRLISGS+DSNIIVWDLVGEVGLYKLRSHKD ITG WCQGEDWLIST
Sbjct: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDGMIKLWDLKTQQCIETHIAHTGECW LSVKDDLLITTGTDSQVK+WKLN+ENDK+G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
           KLTE+G FEKQSKQRGLK+EFITN SDG SFFYIQNADKT                    
Sbjct: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   TDEEI +SIK SYSSL+LHPFQT+RS YK+KSASWTT+TSSKLELVLTTSNN
Sbjct: 301 KRLREKGLTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           TIEYYSIPYEKRE TSPAPLKTHTIELQGQRTD+RSIDISDDN+LLATASNGSLKIWNVK
Sbjct: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           THKCIRTFECGYAL+CKFLPGGLLVILGTR GELQLFDLASSSLLDT+EDAHDAAIWSLD
Sbjct: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDK LP+LKLNHDTTLELNDDILS+RIS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALAI+++GSFVVSSSHDHSIRIWEETEDQVF           QYEDTLL SLEEGN DD
Sbjct: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNADD 720

Query: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780
           AFKGDA GE V+DE SGVHKQTLESLKAGERLMEALD+GIA+IEG+E Y++DM+LWQRKK
Sbjct: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780

Query: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840
           LGEAP+KPQGNSVLIAVNKTPEQYI+DTL RIR+SQLEDALMVMPFSYVLKFLKFID++M
Sbjct: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900
           QNK+LLHSHLPL+C+NLFFIIKFNHKELVSQKNEELK Q++RVKTELRNALKSTEDDLGF
Sbjct: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943
           NVQGLKFIKQQWNLRHNYEFVDEYDQQEKE++ ARKR FETV+
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARKRVFETVI 943

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 1424 bits (3686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/959 (71%), Positives = 806/959 (84%), Gaps = 19/959 (1%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQ++ FGVI+SN+NCVWLP++S  KS   PGQ+IT ALENVN+WD+KTG+L 
Sbjct: 28  MVKSYQRFEQASVFGVISSNSNCVWLPSTSSKKSH--PGQIITGALENVNIWDLKTGELA 85

Query: 61  STLSDGL--PPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN 118
           S L+DGL  PPG+ DA+ +KPAE T+L+ H++T+LLAVGY DGV+KVWDL SKTVL N N
Sbjct: 86  SFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYSKTVLCNLN 145

Query: 119 GHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC------- 171
           GH +AIT L+FD +GTRLISGS+DSNIIVWDLV EVGLYKLRSHKD+ITG WC       
Sbjct: 146 GHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNN 205

Query: 172 QGE---DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKL 228
           Q E   DWLISTSKDG+IK+WDLK QQC+ETHIAHTGECW L+V++DL+ITT +DSQVK 
Sbjct: 206 QEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKF 265

Query: 229 WKLNIENDKL--GGKLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXX 286
           W+L++++D +  G KL E G +EKQSKQRGL +EFI ++ DG  FF IQNAD+T      
Sbjct: 266 WQLSLQDDTVPNGSKLIEKGIYEKQSKQRGLNVEFI-DSIDGVGFFLIQNADRTVEIFRL 324

Query: 287 XXXXXXXXXXXXXXXXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTI 346
                                 T +EI KS++DS+ S+++HPFQ +RS+YK+K+A+WT  
Sbjct: 325 RKEEEISKALKKREKRLTEKGMTPDEIKKSLEDSFVSMMMHPFQIIRSIYKVKAATWTIA 384

Query: 347 TSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLL 406
           TS+KLEL +TT+NNTIEYYSIPYEKREPT P   K + +ELQGQRTD+RSIDISDDN+LL
Sbjct: 385 TSTKLELTVTTANNTIEYYSIPYEKREPTQPIANKLYNVELQGQRTDIRSIDISDDNKLL 444

Query: 407 ATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLD 466
           ATASNGSLKIWN+KT  CIRTFECGYALTCKFLPGG+LVI+GTR GELQLFDLASS+ + 
Sbjct: 445 ATASNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGELQLFDLASSTQIA 504

Query: 467 TIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDT 526
            IE+AHDAAIWSLDLTSDGKRL+TGSADK+VKFW+FQ+E  LVPGT DKF+P L L+HDT
Sbjct: 505 NIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDT 564

Query: 527 TLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
           TLEL+DDILS+R+SP+D++LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK
Sbjct: 565 TLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSK 624

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEK 646
           MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM+VKF+PESHNFFSCSKD ++KYWDG+K
Sbjct: 625 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDK 684

Query: 647 FECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYE 706
           FECIQKL AHQSEVWALAI+ D SFVVSSSHDHSIRIWEETED+VF           QYE
Sbjct: 685 FECIQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWEETEDEVFLEEERDKEMEEQYE 744

Query: 707 DTLLTSLEEGNGDDAFKGDATGES-VD-DEVSGVHKQTLESLKAGERLMEALDLGIAEIE 764
           DTLL SLEEGNGDDAFKGD  G + V+ DE + VHKQT+ESLKAGERLMEA DLG+AEIE
Sbjct: 745 DTLLASLEEGNGDDAFKGDTKGATNVEFDEATDVHKQTMESLKAGERLMEAFDLGMAEIE 804

Query: 765 GIEAYSRDMKLWQRKKLGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVM 824
             E Y +++KLWQRKK GE PIKPQGN++LIA+ KTPE+YIMDTL+RI+ SQLEDAL+V+
Sbjct: 805 SFEEYDKNLKLWQRKKTGEPPIKPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVL 864

Query: 825 PFSYVLKFLKFIDSIMQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVK 884
           PFSYVLKFLKFI+ ++ NK +L++HL LICKNLFFI+K NHKELVSQKNE LK Q+++VK
Sbjct: 865 PFSYVLKFLKFINIVIGNKKMLNNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVK 924

Query: 885 TELRNALKSTEDDLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943
            ELRNALK+ EDDLGFN+QG+KFIKQQWNLRHN EFVDEYDQ+  E   A+KR F T+V
Sbjct: 925 NELRNALKANEDDLGFNIQGMKFIKQQWNLRHNLEFVDEYDQKSHEDKMAKKRTFGTLV 983

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 1404 bits (3634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 667/947 (70%), Positives = 795/947 (83%), Gaps = 10/947 (1%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQ ++FGVI+SN NCVW+ + +R   GS  GQ++T ALENVN WDIKTG+L 
Sbjct: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNR---GSA-GQILTGALENVNCWDIKTGELS 56

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
             L+DGLPPGA DA+  K AE TYL+ H +T+LLAVGYADGVIK+WDL+SKTVL+NFNGH
Sbjct: 57  KILTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGH 116

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           K+AIT+L+FD TGTRLISGSKDS+II+WDLVGEVGLYKLRSHKDSITG WC+ EDWLIST
Sbjct: 117 KSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLIST 176

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDG+IK+WDLKTQQC+ETH+AHT ECWGL++ +DL+ITT T+SQ+K+W L+++ D +G 
Sbjct: 177 SKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKD-MGS 235

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
           KL E G +EKQSKQRG+ +EFIT TSDG +FFYIQNADKT                    
Sbjct: 236 KLIEKGIYEKQSKQRGVSVEFIT-TSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKRE 294

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                    DE+I ++IKDSY S+I+HPFQT+RS +KIK+A+W   T+SKLE+VLTTSNN
Sbjct: 295 KRLRDKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNN 354

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           T+EYYSIPY+KREPT PAP K +TIELQG RTD+RSIDISDDN+LLATASNG+LKIWN+K
Sbjct: 355 TVEYYSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIK 414

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           TH CIRTFECGYALTCKFLPGG LV++G R G+LQLFDLASS+LL+  EDAH AAIWSLD
Sbjct: 415 THACIRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           LTSDGKRLVTGSADKTVKFWDF+V+  L+PGT DKF+P LK+ HDTTLELNDDIL+++IS
Sbjct: 475 LTSDGKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
            D+++LA+SLLDNTVKVFFL+SMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIKIW
Sbjct: 535 SDNKFLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKF+PESHNFFSCSKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 595 GLDFGDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEV 654

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALAIS D  FVVS+SHDHSIR+WEETED+VF           QYE+TLL SLE G+GDD
Sbjct: 655 WALAISNDARFVVSTSHDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDD 714

Query: 721 AFKGDATGESVD----DEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLW 776
            F+ D  G   D    D+ + VHKQT+ESLKAGER++EALDLGIA IE  E Y +++K W
Sbjct: 715 NFQRDIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDW 774

Query: 777 QRKKLGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFI 836
           Q+KK GE P KPQ N++L+A+ K PEQYIM+TL++IR SQLEDAL+V+PFSYVL FLKFI
Sbjct: 775 QKKKSGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFI 834

Query: 837 DSIMQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTED 896
           D ++++K + ++HL LICK LFFIIK N++ELV+QKNEELK Q++RVK ELR ALK   D
Sbjct: 835 DVVIKDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNAD 894

Query: 897 DLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943
           DLGFNVQGLKFI+QQWNLRHN EFVD+YDQ+++E    +KR FET+V
Sbjct: 895 DLGFNVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKKRIFETLV 941

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 1399 bits (3620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 682/963 (70%), Positives = 791/963 (82%), Gaps = 25/963 (2%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQ + FGVI SN+NC+WLP+ S     + PGQ+ITSALEN+N+WDIKTG+L 
Sbjct: 1   MVKSYQRFEQESVFGVINSNSNCIWLPSDSN--PSTSPGQIITSALENINIWDIKTGELS 58

Query: 61  STLSDGL--PPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN 118
           S L D L  PPG+ DA+  KPAE TYL+ H+DT+LLAVGY DGVIKVWDL SKTVL N N
Sbjct: 59  SHLIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGVIKVWDLYSKTVLCNLN 118

Query: 119 GHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQ-----G 173
           GH +AIT+L+FD TGTRLISGS+DSNIIVWDLV EVGLYKLRSHKD+ITG WC      G
Sbjct: 119 GHSSAITVLKFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEMQNNG 178

Query: 174 ED------WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVK 227
           ED      WLISTSKDG+IK+WDLK QQCIETHIAHTGECW ++V++DLLITT +DSQ+K
Sbjct: 179 EDDENELDWLISTSKDGLIKIWDLKIQQCIETHIAHTGECWSVAVRNDLLITTSSDSQIK 238

Query: 228 LWKLNIENDKLGG--KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXX 285
           +W+LN++ND  G   KL E G +EKQSKQRGL IEFI +T+D   FFYIQNADKT     
Sbjct: 239 IWELNLDNDDDGKNKKLIEKGIYEKQSKQRGLSIEFI-DTADETGFFYIQNADKTVEIFR 297

Query: 286 XXXXXXXXXXXXXXXXXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTT 345
                                  T E+I ++IKDSY SLI+HPFQ VRS+YKIK+ +WT 
Sbjct: 298 LRKQDEINKAIKKRTKRLTEKGMTPEDIEQNIKDSYISLIMHPFQIVRSIYKIKAVTWTI 357

Query: 346 ITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRL 405
            T SKLEL LTTSNNTIEYYS PYEKREPT P P K HTIELQGQRTD+RSIDISDDN+L
Sbjct: 358 ATPSKLELCLTTSNNTIEYYSTPYEKREPTQPTPNKLHTIELQGQRTDIRSIDISDDNKL 417

Query: 406 LATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLL 465
           LATASNG LKIWN+KT  CIRTFECGY+LTCKFLPGG LVI+GTR GELQLFDLASS+LL
Sbjct: 418 LATASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTLVIVGTRGGELQLFDLASSTLL 477

Query: 466 DTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHD 525
           +TIEDAHDAAIWSLDLTSDGKRLVTGSADK+VKFWDFQ+E  LV GT DK+LP LKL HD
Sbjct: 478 ETIEDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDFQLEQELVAGTVDKYLPKLKLFHD 537

Query: 526 TTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
           TTLELNDDILS++ISP+D++LA+SLLDNTVKVFF+D+MKF+LSLYGHKLPVLSIDISFDS
Sbjct: 538 TTLELNDDILSVKISPEDKFLAVSLLDNTVKVFFMDTMKFFLSLYGHKLPVLSIDISFDS 597

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGE 645
           K+IITSSADKNIKIWGLDFGDCHKSLFAHQDSIM+VKF+PESHNFFSCSKD ++KYWDG+
Sbjct: 598 KLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGLIKYWDGD 657

Query: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQY 705
           KFECIQKL  HQSEVW++AI+ D SF+VSSSHDHSIRIWEETED+VF            Y
Sbjct: 658 KFECIQKLAGHQSEVWSIAIANDASFIVSSSHDHSIRIWEETEDEVFLEEEREKELEELY 717

Query: 706 EDTLLTSLEEGNGDDAFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEG 765
           EDTLLTSLEE NGDDAFK D  G    DE + VHKQT+ESLKA ERLMEA DLG+ EIE 
Sbjct: 718 EDTLLTSLEEDNGDDAFKKD--GGEDKDEATDVHKQTMESLKASERLMEAFDLGMKEIEA 775

Query: 766 IEAYSRDMKLWQRKKLGE-----APIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDA 820
           +E Y R++K WQRK          PIKPQGN++L+A+ KTPE+YIMDTL+RI+ SQLEDA
Sbjct: 776 MEEYERELKNWQRKDSNNKATQTVPIKPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDA 835

Query: 821 LMVMPFSYVLKFLKFIDSIMQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQV 880
           L+V+PFSY++KFLKFID ++ +K +L++HLPLIC+ LFFI+K NHKELVSQKNEELK Q+
Sbjct: 836 LLVLPFSYIIKFLKFIDIVINSKKILNNHLPLICRILFFIVKSNHKELVSQKNEELKSQI 895

Query: 881 SRVKTELRNALKSTEDDLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFE 940
           +RVK  LRNALK+ EDDLGFN+QGLKFIKQQW L+HNYE+VD+ DQ+ +E+  A+KR F 
Sbjct: 896 TRVKDNLRNALKNNEDDLGFNIQGLKFIKQQWKLKHNYEYVDDQDQKAQEAKFAKKRTFG 955

Query: 941 TVV 943
           T++
Sbjct: 956 TII 958

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 1364 bits (3530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/943 (68%), Positives = 789/943 (83%), Gaps = 9/943 (0%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQ++ FGVI++NANCVW+  S  +K  + PG +ITSALEN+N+WDIKTG+L+
Sbjct: 1   MVKSYQRFEQASVFGVISTNANCVWM--SPESKKSNSPGSVITSALENINIWDIKTGELI 58

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           S LSDGLP G+ D + +KPAE +YL  H +T+LLA GY DG IKVWDL+SK+VLL FNGH
Sbjct: 59  SVLSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGH 118

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           K+AIT+++FD TGTRLISGS+DSNIIVWDLV EVGLYKLRSHKD+I+G WC+GEDWL+ST
Sbjct: 119 KSAITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVST 178

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDG+IK+WDLK QQCIETHIAHTGECW + V +DLLIT+G D+Q+KLW L+   +  G 
Sbjct: 179 SKDGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEA-GS 237

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
           KL E G ++KQSKQRGL I+F +   +G +FFYIQNADKT                    
Sbjct: 238 KLIEKGVYDKQSKQRGLDIKF-SVAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKRE 296

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   TDEEI ++IK+SYSS+I+HPFQ ++S YKIKS S+TT++++KLE V+TTS+N
Sbjct: 297 KRLKEKGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSN 356

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           +IEYYSIPYEKR+PTSPAP + +TIEL G RTD+RS+DISDD++LLATASNG LK+WN+K
Sbjct: 357 SIEYYSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLK 416

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  CIR F+CGYALTCKFLPGG LVI+GTR G LQLFDLASS+LL+  EDAH+ AIWSLD
Sbjct: 417 TKACIRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLD 476

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           +TSDG+RLVTGSADKT+KFW+FQVE  LVPGT DK+LP++KL HDTT+E+N+D+LS+RIS
Sbjct: 477 ITSDGRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRIS 536

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+D++LAISLLDNTVKVF+LDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 537 PEDKFLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFS SKD +VKYWDG+KFECIQKL AHQSEV
Sbjct: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEV 656

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           W++AI++DG+ V+S+SHDHS+R+WEET+DQVF           QYEDTLL SLEEG+GDD
Sbjct: 657 WSIAITSDGTSVISASHDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDD 716

Query: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780
           AFKGDA  E V+DE + V  QT+ESLKAGERLMEALDLG++EIE  E Y  DMK W++KK
Sbjct: 717 AFKGDA--EKVEDESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKK 774

Query: 781 -LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSI 839
             GE PIKPQGN++LIA+ K P +YIM+TL++I+ SQLEDAL+V+PFSYVLK LKFID +
Sbjct: 775 SSGEPPIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIV 834

Query: 840 MQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLG 899
           M++K +  ++L LICKNLFF+I+ NHKEL+SQ+NE LK Q+  VK  LR++L+   DDLG
Sbjct: 835 MKDKKMTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLG 894

Query: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETV 942
           FN+QGLKFIKQQWNL+HN++F D++D++E ES+G +KR F T+
Sbjct: 895 FNIQGLKFIKQQWNLKHNFDFTDDFDKKE-ESSG-KKRIFGTL 935

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 1355 bits (3506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/944 (67%), Positives = 777/944 (82%), Gaps = 7/944 (0%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQSASFGVI+SN+NCV++P ++R     G GQ++T  LE VN+WD+KTGDL+
Sbjct: 1   MVKSYQRFEQSASFGVISSNSNCVYIPPANR----KGLGQVLTGGLEKVNLWDLKTGDLV 56

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           S LSDGLPPG+ DA+  KPAE TYLE H +T+LLAVGYA+GVIKVWDLMSKTVLL  NGH
Sbjct: 57  SCLSDGLPPGSIDAKSTKPAETTYLEYHAETNLLAVGYAEGVIKVWDLMSKTVLLTLNGH 116

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           K+A+T+L+FD TGTRLISGS+DSNII+WDL+GEVGLYKLRSHK +I+G W + ++WLIST
Sbjct: 117 KSAVTILKFDITGTRLISGSQDSNIIMWDLIGEVGLYKLRSHKGAISGLWLEKDEWLIST 176

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           S+DG+IK+WDLKTQQC+ETHIAHTGECW L V +DL IT   DSQVK+W LN E++  G 
Sbjct: 177 SRDGLIKVWDLKTQQCVETHIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESEA-GS 235

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
           KL E G +EKQS QRG  IEF+T T+D  +FFYIQNADK+                    
Sbjct: 236 KLIEKGIYEKQSNQRGSSIEFVT-TTDETTFFYIQNADKSIEIFRIRKEEEILKATRKRE 294

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   +DEEI ++I+D Y S+I+HPFQ +RS +K+K+A+W   T+SKL+LV+TT++N
Sbjct: 295 KRLKEKGLSDEEIKQNIQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASN 354

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           T+EYY+IPYEKREP  PAP + H++ELQG RTD+R++DIS+D+ LLATASNG+LK+WN+K
Sbjct: 355 TVEYYTIPYEKREPKLPAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLK 414

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  C+RTF+CGYAL C+FLPGG L+++GTRNG+LQLFDLASS++LD  E AHDAAIWSLD
Sbjct: 415 TRMCLRTFDCGYALCCRFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           +TSDGK+LVTGSADK+VKFW FQVE  L+ GT DKF P++KL+HDTTLELNDD+LS+RIS
Sbjct: 475 ITSDGKKLVTGSADKSVKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+D+Y AISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 535 PEDKYFAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKD +VKYWDG+KFECIQKL  HQSEV
Sbjct: 595 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEV 654

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALAIS +G +VVS+SHD SIRIWEETEDQVF           Q E  LL+SLEEG+GD 
Sbjct: 655 WALAISNNGKYVVSASHDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDA 714

Query: 721 AFKGDATGESVD-DEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRK 779
           AF+ D  G+  D DE + V KQT+ESLKAGERLMEALDLGI EIE  E Y +++K W + 
Sbjct: 715 AFRKDVGGDEADQDEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKH 774

Query: 780 KLGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSI 839
           K    P+KP GN++L A++KTPE+YI++TL RI+ SQLEDAL+V+PFSYVLKF +FID+ 
Sbjct: 775 KGDAKPVKPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAA 834

Query: 840 MQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLG 899
           + +  +L  +LPLICKNLFFI+K NH+ELVSQKNEELK ++++VK  LR ALKS EDDLG
Sbjct: 835 LLDNRILQHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLG 894

Query: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943
           FN++GLKFI++QW+LRH  EFVD+Y Q+E+E   A+KR FET+V
Sbjct: 895 FNIEGLKFIRRQWDLRHKLEFVDDYSQREQEDKTAKKRVFETIV 938

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 1350 bits (3493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/942 (66%), Positives = 778/942 (82%), Gaps = 6/942 (0%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQ + FGVI +NANCVWLP+S   KS  G  Q++T ALEN+N+WDIKTG+L+
Sbjct: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVG--QVLTGALENINLWDIKTGELL 58

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           S LSDGLPPG+ D + +KPAE TYLE H +T+LLA GYADGVIK+WDLMSKTVLL+F+GH
Sbjct: 59  SVLSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGH 118

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           K+ +T+L+FD TGTRL+SGS+DS+II+WDLV EVG++KLRSHKD+ITG WC+GEDWL+ST
Sbjct: 119 KSGVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVST 178

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           +KDG+IKLWDLKTQQC+ETHIA TGECW L V  DL++TTGTDSQ+K+W L+   +  G 
Sbjct: 179 AKDGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKEN-GS 237

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
           K+ E GT+EKQSKQRGL + F T T+D  +F YIQN+DKT                    
Sbjct: 238 KIVEKGTYEKQSKQRGLSVNFKT-TADETTFLYIQNSDKTVEIFRIRKQDEISRALKKRE 296

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   TDE+I +   D+Y SL+L PFQ ++S YKIK+ SWT   +SK+ELV+TTS+N
Sbjct: 297 KRMKEKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSN 356

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           TIEYYSIPYEKR P +P+P K +TIE +G RTD+RSIDISDDN+LLA+ASNG LKIWN+K
Sbjct: 357 TIEYYSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNLK 416

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  CIRTF+CGYALTCKFLP G L ++GTR G++QLFDL +S+L+++I+ AH+AAIWSLD
Sbjct: 417 TKSCIRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLD 476

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           +T DGKRLVTGSADK++KFW+F +E  LVPGT DKF+P++KL HDTTLELNDDILS++IS
Sbjct: 477 ITQDGKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKIS 536

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+D+YLA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 537 PEDKYLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+V FLPESHNFFS SKD +VKYWDG+KFEC+QKL AHQSEV
Sbjct: 597 GLDFGDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEV 656

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALAI++DGS VVSSSHDHS+R+W+ET+DQVF           QYEDTLLTSLEEG+GD 
Sbjct: 657 WALAITSDGSTVVSSSHDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGDS 716

Query: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780
           AFK D   E   DE + V  QT+ESLK+GERLMEAL+LG +EIE +E Y++D K W++KK
Sbjct: 717 AFKADI--EDGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKK 774

Query: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840
            GE P+KPQGN++L+A+N+ P+QYIMDTL++I+ SQLEDAL+V+PFSYVL+FLKFID +M
Sbjct: 775 AGEPPVKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVM 834

Query: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900
            +  +L + L LICKNLF I+K NHKEL+SQ+N+ LK Q++ VK +LR +L++  DDLGF
Sbjct: 835 DDPEILKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGF 894

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETV 942
           N+QGLKFIKQQWNL+HNYEF+DE DQ+++E   ++KR F T+
Sbjct: 895 NIQGLKFIKQQWNLKHNYEFIDEEDQKKQEEKNSKKRIFGTL 936

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 1346 bits (3484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/946 (69%), Positives = 777/946 (82%), Gaps = 11/946 (1%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQ++ FGVI+SN+N VW+P      +G+GPG +ITSALEN+N+WDIKTG+L+
Sbjct: 1   MVKSYQRFEQTSVFGVISSNSNSVWIP------NGNGPGNIITSALENINIWDIKTGELV 54

Query: 61  STLSDGLPP-GASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNG 119
           + L+DGLPP G+ D++ +KPA  TY + H+DT+LLA GY+DGVIKVWDL+SKT+LL FNG
Sbjct: 55  NQLTDGLPPPGSIDSKLSKPASVTYFKYHEDTNLLAAGYSDGVIKVWDLISKTILLTFNG 114

Query: 120 HKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQG-EDWLI 178
           HK+AIT+L FD TGTRLISGS DS+IIVWDLV EVGLYKLRSHKD+ITG WC   E+WLI
Sbjct: 115 HKSAITILTFDSTGTRLISGSNDSDIIVWDLVSEVGLYKLRSHKDNITGIWCSDDENWLI 174

Query: 179 STSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKL 238
           STSKDG+IK+WDLK QQC+ETHIAHTGECW L + +DL++TT  +SQVK WKL++EN   
Sbjct: 175 STSKDGLIKVWDLKIQQCVETHIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPN 234

Query: 239 GGKLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXX 298
           G KL E G FEKQSKQRGL +EFIT+  D  SFF+IQNADKT                  
Sbjct: 235 GSKLVEKGIFEKQSKQRGLSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKK 294

Query: 299 XXXXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTS 358
                     TD+EI +++ +++ S ++HPFQTVRS YKIKS  WT  TSSKLELV+TTS
Sbjct: 295 REKRLKEKGMTDDEIAQNVDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTS 354

Query: 359 NNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWN 418
           +NTIEYYS+ Y KR P  P+  K HTIEL GQRTD+RSI ISDDN+LLATASNG LKIWN
Sbjct: 355 SNTIEYYSVTYAKRIPQPPS--KIHTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWN 412

Query: 419 VKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWS 478
           +KTHKCIRTFECGYAL CKFLPGGLLVI+GTRNGELQLFDLASS+ L+ IEDAHDAAIWS
Sbjct: 413 LKTHKCIRTFECGYALCCKFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWS 472

Query: 479 LDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLR 538
           LD+TSDGKRL+TGSADKTVKFWDF+++   V GT+D ++P+LKL HDTTLE+ +DIL +R
Sbjct: 473 LDITSDGKRLITGSADKTVKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVR 532

Query: 539 ISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598
           +SPDD++LA+SLLD TVK+FFLDSMKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIK
Sbjct: 533 LSPDDKFLAVSLLDYTVKIFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIK 592

Query: 599 IWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658
           IWGLDFGDCHKSLFAH DSIM+VKFL  SHNFFSCSKD  +KYWDG+KFECIQKL AHQ+
Sbjct: 593 IWGLDFGDCHKSLFAHADSIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQN 652

Query: 659 EVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNG 718
           EVW++AI+ D SFVVSSSHDHS+RIWEETEDQVF           QYE+TLL SLEEG G
Sbjct: 653 EVWSIAIADDSSFVVSSSHDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTG 712

Query: 719 DDAFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQR 778
           D AFK D  G   +DE + VHKQT ESLKAGERLMEALDLGI EIE  E Y +D++LW++
Sbjct: 713 DSAFKSDTKGSEDEDEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKK 772

Query: 779 KKL-GEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFID 837
           KK+ G+APIKPQGN++L A+NKTPEQYI++TL++I+ SQLEDA++V PFSYVLKFLKFID
Sbjct: 773 KKIGGDAPIKPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFID 832

Query: 838 SIMQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDD 897
            ++ +  +L++HL LICKNLFF+IK NHKEL+SQKNE+LK QV RVK  LR AL+  EDD
Sbjct: 833 IVLNDPKVLNNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDD 892

Query: 898 LGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943
           LG+N+QGLKFIKQQWNL HN+EF DE DQ  +ES   +KR F T+V
Sbjct: 893 LGYNIQGLKFIKQQWNLTHNFEFNDELDQNVQESKSGKKRVFGTIV 938

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 1338 bits (3464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/942 (67%), Positives = 776/942 (82%), Gaps = 5/942 (0%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQS+ FGV++S  N +W+PA +  K  +GPGQ+IT ALENVN+WDIKTG+L+
Sbjct: 1   MVKSYQRFEQSSVFGVVSSGDNSIWIPAEN--KRTNGPGQIITGALENVNIWDIKTGELV 58

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           S LSDGLPPGA DAR  KPAE TY++ + DT LLAVGYADGVIK+WD+ SKTVLL+FNGH
Sbjct: 59  SHLSDGLPPGAIDARTTKPAEVTYMQYYSDTSLLAVGYADGVIKIWDMFSKTVLLSFNGH 118

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           ++A+T L FD TGTRLISGS+DSNIIVWDLV EVGLYKLRSHKDSITG     E+WL+S 
Sbjct: 119 RSAVTQLLFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDSITGLSLPDENWLMSV 178

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDG+IKLWDLK QQC+ETHIAH GECW L V +D+++TT +DSQ+K+W L+++ D  G 
Sbjct: 179 SKDGLIKLWDLKIQQCVETHIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDADA-GV 237

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
           K+TE G FEKQSKQRG+ + FIT  SDG  FFY+QNADKT                    
Sbjct: 238 KVTEKGIFEKQSKQRGVAVSFIT-VSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKRE 296

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   TDEEI ++ K+SY S+I+H FQ +RS +KI++ASW   TSSKLEL +TTS N
Sbjct: 297 KRFKEKGMTDEEIQQNFKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSGN 356

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           TIEYYSIPYEKREP  P P++ H+IELQG RTD+R+IDISDD +LLATASNG LKIWN++
Sbjct: 357 TIEYYSIPYEKREPKHPTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNIR 416

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  C+RTFECGYALTCKFLPGG+LVI+GTR+G+LQLFDLASS++L+  E+AHDAAIWSLD
Sbjct: 417 TKTCLRTFECGYALTCKFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLD 476

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           +TSDG+RLVTGSADKTVKFW+F VE   VPGT DK +P + L+HDTTLE++DDILS++IS
Sbjct: 477 ITSDGRRLVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKIS 536

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+++ LA+SLLDNTVKVF+L++MKF+LSLYGHKLPVLSIDISFDSK+IITSSADKNIKIW
Sbjct: 537 PENKLLAVSLLDNTVKVFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 596

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKDA VKYWDG+KFE IQKL  HQSEV
Sbjct: 597 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEV 656

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALA++  G+ V+S SHD SIR+WEET+DQVF           Q E+ LLTSLEEG+GD 
Sbjct: 657 WALAVARSGTCVISVSHDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGDS 716

Query: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780
           AFK     +   D+   VHKQT+ESLKAGERLMEA+DLGI EIE  E Y ++++LW++KK
Sbjct: 717 AFK-QDEKDDDHDDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKK 775

Query: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840
            G  P +PQ N++L+A+NK PE+YIMDTL+RI+ SQLEDAL+ +PFSYVLKFLKF+D+++
Sbjct: 776 QGVEPERPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVL 835

Query: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900
           Q+K LLH+HL LICKNLFFI++ NH+ELVSQKNEELK +++RVK ELR ALK+ EDDLGF
Sbjct: 836 QDKKLLHNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGF 895

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETV 942
           N++GLKFIKQQWNL+HNYEFVDE+DQ+++    A+KR FET+
Sbjct: 896 NIEGLKFIKQQWNLKHNYEFVDEFDQRKQAEKTAKKRVFETL 937

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 1335 bits (3454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 629/944 (66%), Positives = 765/944 (81%), Gaps = 8/944 (0%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQ++  GVI+SN+NC+W+PA +R  SG    Q++T ALENVN W +K+GDL+
Sbjct: 1   MVKSYQRFEQASVLGVISSNSNCIWIPAETRNASG----QVLTGALENVNCWSMKSGDLL 56

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           STLSDGLPPGA DA+ +KPAE T+L+ H +T LLA GY DGV+K+WDL+SK+VL+NFNGH
Sbjct: 57  STLSDGLPPGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGH 116

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           K+AIT+L+FD TGTRLISGSKDS+IIVWDLVGEVGL+KLRSHKDSITG WC+GEDWL+ST
Sbjct: 117 KSAITVLKFDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGEDWLVST 176

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDG+IK+WDLKTQQC+ETH+AH GECW + V +DL++T G D+Q+KLW ++ E   +G 
Sbjct: 177 SKDGLIKVWDLKTQQCVETHVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYEK-PVGS 235

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
            LTE GT EKQSKQRG+ +EF T  SDG +FF++QNAD+T                    
Sbjct: 236 MLTERGTHEKQSKQRGVSVEF-TTISDGVTFFFVQNADRTVETFRLRTEDEISKALKKRE 294

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   T EEI  ++K+SY+S I+HPFQ +RS YKIKSA W   T+SKLE+V++TSNN
Sbjct: 295 KRLSDKGLTGEEIQANLKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNN 354

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           T++YYSIPY K+EP  P+P K ++I+++G RTD+R+IDISDDN+LLATASNGSLKIWN+K
Sbjct: 355 TVDYYSIPYNKKEPKLPSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIK 414

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  CIRTFECGYAL CKFLPGG LV++GT+ G+L LFDLASS+LL +IE AH  AIWSLD
Sbjct: 415 TKSCIRTFECGYALACKFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           LT+DGKRLVTGSADK+V+FWDFQVE  LVPGT DKF+P LK+ HDTTLELNDD+L+++IS
Sbjct: 475 LTADGKRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PD+R LAISLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIK+W
Sbjct: 535 PDNRLLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAH DSIM V FLPESHNFFSC KD +VKYWDG+KFECIQKL AHQ EV
Sbjct: 595 GLDFGDCHKSLFAHSDSIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEV 654

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           W +AIS DG+FVVS+SHD SIR+W ET+DQVF           QYE TLL SLE+G GD 
Sbjct: 655 WTIAISHDGTFVVSASHDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDA 714

Query: 721 AFKGDATGES-VDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRK 779
            F GD  G + + DE + VHKQT ESLKA ERLMEA+D+G+AEI     Y + +K WQ+K
Sbjct: 715 MFHGDGNGGAEIGDEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKK 774

Query: 780 KLGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSI 839
           K G  P +PQ NS+LIA+NKTP +YIMD L RI+ SQLEDAL+V+PFSYVL+FL FI+ +
Sbjct: 775 KSGPHPGRPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELV 834

Query: 840 MQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLG 899
           +++KSL+  HLPL+CKNLFFIIK NH+EL SQKNE+LK Q+ R+K  LRN++K+  DDLG
Sbjct: 835 IEDKSLVRRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLG 894

Query: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943
           FN+QGLKFIKQQWNL+HN+EF D+     K+    +KR FETVV
Sbjct: 895 FNIQGLKFIKQQWNLKHNFEFSDDV-IISKQDKKVKKRVFETVV 937

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 1330 bits (3443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/938 (67%), Positives = 765/938 (81%), Gaps = 5/938 (0%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQS+ FGVI+SN+NCVW+P SS+       G++IT ALEN++VWD+KT +L 
Sbjct: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPSSKKSKS--LGKVITGALENISVWDLKTSELE 58

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
             LSDGLPPG+ D + +KPAE +YL+ H +T L+A GYADGVIK+WDL+SKTVLL+FNGH
Sbjct: 59  YVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           K+ IT+L+FD TGT+LISGS+DSNIIVWDLV EVGLYKLRSHK +ITG WC  ++WLIST
Sbjct: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST 178

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDG+IK+WDLKTQQCIETHIAHTGECW L +  D ++T+  DSQ+K+W++++E +  G 
Sbjct: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEP-GS 237

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
           KL E G FEKQSKQRGL IEF T TSDG  FFY+QNADKT                    
Sbjct: 238 KLIEKGAFEKQSKQRGLSIEF-TTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRRE 296

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   T+E+I  +I +SY S ++HPFQ VRS+YKIKS +WT   S+KLE+V+TT++N
Sbjct: 297 KRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSN 356

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           TIEYYS+PYEKR+PTSP P+K HTIELQG RTD+RSIDISDDN LLATASNG LKIWN+ 
Sbjct: 357 TIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLN 416

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  CIRTFECGYALTCKFLPGGLLV++GTR G LQLFDLASS LL TIE AH+ AIWSLD
Sbjct: 417 TKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLD 476

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           +T+DGKRLVTGSADK++KFWDFQV+  L+ GT DK++P + + HD+TLEL DDILS++IS
Sbjct: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
            DD++LAISLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS D+K+IITSSADKNIKIW
Sbjct: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIW 596

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM VKFLP SHNFFS SKD  VKYWDG+KFECIQKL AHQSEV
Sbjct: 597 GLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEV 656

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALA+S +G  VVS SHDHSIRIWEET+DQVF           QYEDTLL SLEEGN DD
Sbjct: 657 WALAVSDNGERVVSVSHDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADD 716

Query: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780
            FKGD   +  DDE + V KQT+ESLKAGERLM+ALDLGI EIE +E Y  +M  +++K+
Sbjct: 717 TFKGDVKNDE-DDEATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKYKKKQ 775

Query: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840
             +AP+KP GN++L+AV KTP +YIMDTL+ I+ SQLED+L+V+PFSYVLKFLKF D +M
Sbjct: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835

Query: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900
           +  ++L++ L LICKNLFFI+K N KELVSQKNEELK Q+SRVK +LR+AL++ EDDLGF
Sbjct: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRF 938
           N+QGLKFIKQQWN++HN+EFVD+YDQQ +    A+K +
Sbjct: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKKEY 933

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 1321 bits (3420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/947 (68%), Positives = 774/947 (81%), Gaps = 9/947 (0%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQSA FGVI+S AN VWLP      SGS PGQ+ITSALENVN+WDIKTG+L+
Sbjct: 1   MVKSYQRFEQSAVFGVISSEANNVWLPPLKGRSSGS-PGQIITSALENVNIWDIKTGELI 59

Query: 61  STLSDGLPPGASDAR-GAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNG 119
           + L DG+ PG++D++   KPAE T+L+ H D+ LLAVGY DG IKVWDL+SKTVL+N NG
Sbjct: 60  AQLQDGITPGSADSKVNTKPAEVTFLQYHPDSSLLAVGYRDGNIKVWDLVSKTVLINLNG 119

Query: 120 HKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGE-DWLI 178
           HK++IT+L+FD   TRL+SGS DSNII+WDLV EVG+ KLRSHKD I+  +   + +WL+
Sbjct: 120 HKSSITVLKFDVNCTRLVSGSSDSNIIIWDLVSEVGICKLRSHKDRISDLYVDDDFNWLL 179

Query: 179 STSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKL 238
           S SKDG+IK+WDLKT QC+ETHIAHTGECW L +KDD++ITT   SQ+KLW L+++ + +
Sbjct: 180 SVSKDGLIKVWDLKTNQCVETHIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGE-V 238

Query: 239 GGKLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXX 298
           G KL E G +EKQSKQRG  ++FI N+S G +FF I NADKT                  
Sbjct: 239 GSKLIEKGVYEKQSKQRGTSVKFIENSS-GVAFFAIGNADKTIEIFRIRPQEEITRALKK 297

Query: 299 XXXXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTS 358
                      DE+I ++IK+S+ S ++H FQTVRS +K+KS SWT  T+SKLELV TTS
Sbjct: 298 REKRLKEKGMEDEDIQQNIKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTS 357

Query: 359 NNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWN 418
           +NTIEYY+I YEKREPT PAP + +TIELQG RTD+R+ DISDDN LLATASNG LKIWN
Sbjct: 358 SNTIEYYTIAYEKREPTQPAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWN 417

Query: 419 VKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWS 478
           ++T +CIRTF+CGYALTCKFLPGGLLVILGTRNGELQLFDLASS+ ++ IE AHDAAIWS
Sbjct: 418 LRTKQCIRTFDCGYALTCKFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWS 477

Query: 479 LDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLR 538
           LDLTS+GKRLVTGSADKTVKFWDFQ+E   + GT  K    L LNHDTTLELNDD+L ++
Sbjct: 478 LDLTSNGKRLVTGSADKTVKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVK 537

Query: 539 ISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598
           ISP+D++LA+SLLDNTVK+FFLD+MKF+LSLYGHKLPVLSIDISFDSKM+ITSSADKNIK
Sbjct: 538 ISPEDKHLAVSLLDNTVKIFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIK 597

Query: 599 IWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658
           IWGLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKD  VKYWDG+KFEC+QKL +HQS
Sbjct: 598 IWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQS 657

Query: 659 EVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNG 718
           EVW LA+  DGSFVVS+SHDHSIRIW+ETEDQVF           QYE+TLL SLEEG G
Sbjct: 658 EVWCLAMGLDGSFVVSTSHDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTG 717

Query: 719 DDAFKGDAT-GESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQ 777
           DDAFK D+  GE   DE + VHKQT+ESLKA E+LM+ALDLG+ EIE +E Y+ DM LW+
Sbjct: 718 DDAFKKDSVDGEG--DEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALWK 775

Query: 778 RKKLG-EAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFI 836
           +KK+G E P+KP GN+VL+AV K+PEQYIM+TL RI+ SQLEDAL+++PFSYVLKFLKFI
Sbjct: 776 KKKIGSEMPVKPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKFI 835

Query: 837 DSIMQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTED 896
           D +++NK +LH++L LICKNLFFI++ NHKEL+SQKNEELK Q++RVK ELRN LK  ED
Sbjct: 836 DIVLKNKKMLHNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNED 895

Query: 897 DLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943
            LGFN+QGLKFIKQQW+L+HN+EFVDEYDQ+ +E   A+KR FET+V
Sbjct: 896 ALGFNIQGLKFIKQQWDLKHNFEFVDEYDQRIQEEKKAKKRIFETLV 942

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 1308 bits (3386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/944 (64%), Positives = 759/944 (80%), Gaps = 8/944 (0%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQ + FGVI+SN+NC+WLPA +R  +G    Q++T ALENVN W +K+G+L+
Sbjct: 1   MVKSYQRFEQESVFGVISSNSNCLWLPAENRNSTG----QVLTGALENVNCWSMKSGELI 56

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
            TL+DGLPPGA DA+  KPAE +YL+ H +T LLAVGY DG IK+WDL+SK+VL++FNGH
Sbjct: 57  GTLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGH 116

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
           K+AIT+L FD TGTRLISGS+DS+IIVWDLVGEVGLYKLRSHKDSITG WC+GE+WLIST
Sbjct: 117 KSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLIST 176

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDG+IK+WDLK QQC+ETH+AH GECW + V +DL+IT G D+Q+KLW LN E +  G 
Sbjct: 177 SKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFE-ESAGS 235

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
            L E GT EKQS+QRG+ I+F T  SD  +FF+IQNAD++                    
Sbjct: 236 MLIEKGTHEKQSRQRGVAIQF-TTVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKRE 294

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   +++EI +++KDS++S I+HPFQ VRS+YK++S  W T T+SKL+LV+TT+NN
Sbjct: 295 KRLTEKGLSEDEIQQNLKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANN 354

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           T++YYSI Y+KREPT P+P K H+I+++G R+D+R+IDIS DN+LLATASNG+LKIWN+K
Sbjct: 355 TVDYYSIKYQKREPTMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIK 414

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T+ CIRTFECGYAL CKFLPGG LV+LGT+ G+L L+DLASS+LL+TIE AH  AIWSLD
Sbjct: 415 TNSCIRTFECGYALACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           +T+DGKRLVTGSADKTV FWDFQVE   VPGT DKF P LK+ HDTTLELNDD+L+++IS
Sbjct: 475 MTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           PD+R LA+SLLDNTVKVFF+DSMKF+LSLYGHKLPVLSIDISFDSK++ITSSADKNIKIW
Sbjct: 535 PDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCH+SLFAH DSIM V F+PESHNFFSCSKDA+VKYWDG+KFECIQKL AHQ EV
Sbjct: 595 GLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEV 654

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           W LAIS+DG FVVS+SHD SIR+W ET+DQVF           QYE TLL SLE G GDD
Sbjct: 655 WTLAISSDGRFVVSASHDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDD 714

Query: 721 AFKGDATGES-VDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRK 779
            F+ D  G+  + D+ + VHKQT ESLKA E+LMEALDLG++EI  +  Y + +K W++K
Sbjct: 715 MFEKDGNGDGEITDQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKK 774

Query: 780 KLGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSI 839
           + G  P KP  NS+L+A+NKTP +YIMD L++I+ SQLEDAL+V+PF+YVL FL FID +
Sbjct: 775 RSGPHPGKPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLV 834

Query: 840 MQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLG 899
           ++ K L    LPLIC+NLFFIIK NH+EL SQKNEELK Q++R+K  LR ++K+  DDLG
Sbjct: 835 LKEKELARRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLG 894

Query: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETVV 943
           FN+QGL FIKQQWN++HN+EF D+     K +  A+KR FET+V
Sbjct: 895 FNIQGLTFIKQQWNMKHNFEFSDDI-TVNKTNEKAKKRVFETLV 937

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 1300 bits (3363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/942 (64%), Positives = 758/942 (80%), Gaps = 5/942 (0%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MV SYQRFEQ + FGVIASN+NCVW+P      S + PGQ+ITS+LEN+N WDIKTG+L+
Sbjct: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEG---SRTSPGQIITSSLENINCWDIKTGNLL 57

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
            TLSD +PPG+ DA+  KPAE  YLE H +T+LLA GYADGVIK+WD+ ++TVL+ FN H
Sbjct: 58  KTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSH 117

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
            AAIT L+FD +GTRLISGS+DSNII+WDLVGEVGL KLRSHKDSITG W + +DWLIST
Sbjct: 118 TAAITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLIST 177

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDG+IK+WD+K+QQC+ETH+AHT ECW L++ DDL++T   DS++K+W+L++E +  G 
Sbjct: 178 SKDGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLEREN-GS 236

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
           KL E G +EKQS+QR + ++ +TN  D   FFY+QNADKT                    
Sbjct: 237 KLKEKGIYEKQSRQRSVDVKIVTN-PDEVKFFYVQNADKTTEVFRIRTSSELSKALKKRE 295

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   +++EI + IK S+ + I+ PFQ VRS +K KSA+WT  + SKLELV TTSNN
Sbjct: 296 KRLKEKGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNN 355

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           TIEYYSIPY+ ++PT  A  K +TIELQG RTD+RSIDIS+DN+LLA ASNG LKIWN+ 
Sbjct: 356 TIEYYSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNIT 415

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  CIRTF+CGYAL CKFLPGG LV++GTR GELQLFDLASS +L+  E AHDAAIWSLD
Sbjct: 416 TQSCIRTFDCGYALCCKFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSLD 475

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           LTSDG+RL+TGSADKTVKFW+FQVE  L+  + DK+   L++ HDTTLEL +DILS++IS
Sbjct: 476 LTSDGRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKIS 535

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLSIDIS+DSK+IITSSADKNIKIW
Sbjct: 536 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIW 595

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCH+SLFAHQD+IM+VKF+P+SHNFFSC KD V+KYWDG KF+CIQKL AH+SEV
Sbjct: 596 GLDFGDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEV 655

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALA+S+DG F VS SHD SIR+WEETEDQVF           QYE+ LL++LE    D+
Sbjct: 656 WALALSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDE 715

Query: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780
            F  ++  ++   EV+ VHKQT+ESLKAGERLMEALDLGI+E+E  E Y R++ LW + K
Sbjct: 716 KFARNSEEDTDVTEVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNK 775

Query: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840
            G+ P+KPQ NS+LIAVNK PE+YIMDTL+RI+ +QLEDAL+V+PFSYVLKFLKFID+ +
Sbjct: 776 SGDQPMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASI 835

Query: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900
           + K L+++HLPLIC+NL +++K NHKEL++QKNEELK Q+++VK +LR ALK   DDLGF
Sbjct: 836 EKKQLVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGF 895

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETV 942
           N++GLKFIKQQWN++HN+EFVDEYDQ++ E+  ++KR F TV
Sbjct: 896 NIEGLKFIKQQWNVKHNFEFVDEYDQRDAETKSSKKRVFTTV 937

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 1297 bits (3356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/943 (65%), Positives = 760/943 (80%), Gaps = 5/943 (0%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWL-PASSRTKSGSGPGQLITSALENVNVWDIKTGDL 59
           MVKSYQRFEQ+  FGVI+SN+N VW+ P +S+ K+G+  GQ+I   LEN+ VWDIKTG+ 
Sbjct: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGN-LGQVIVGGLENILVWDIKTGEQ 59

Query: 60  MSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNG 119
           ++ L+DGLPPGASDA+ +KPAE T+L+ H +T+LLA GYADGVIK+WDL+SKTVL++FNG
Sbjct: 60  IAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNG 119

Query: 120 HKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIS 179
           HK+AIT+L FD TGTRLIS SKDS+IIVWDLVGE GLYKLRSHKD+ITG WC+ E+WLIS
Sbjct: 120 HKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIS 179

Query: 180 TSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLG 239
           TSKDG++K+WDLK+QQC+ETH+AHTGECW L + +D+ +T   DSQVKLWKL+++ +  G
Sbjct: 180 TSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAEN-G 238

Query: 240 GKLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXX 299
            KLTE G  EKQSKQRG++I+F     DG  FFYIQNADKT                   
Sbjct: 239 SKLTEKGIIEKQSKQRGVEIDFAV-APDGVKFFYIQNADKTIEIYRLRKEEEISRALKKR 297

Query: 300 XXXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSN 359
                    ++EEI +++  S  SL+ H FQ VRS YKIKSA WT  ++SKLELV+TTSN
Sbjct: 298 EKRLQDKGMSEEEIKEAM-GSPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSN 356

Query: 360 NTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNV 419
           N+IEYYSIPY KREPT PAPLK HTI+L GQRTD+RS  ISDDN+LLATASNGSLKIWN+
Sbjct: 357 NSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNI 416

Query: 420 KTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSL 479
           KT +CIR+FECGYALTCKFLPGG LV++GTRNGELQLFD+ASS++LD  E AHDAAIWSL
Sbjct: 417 KTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSL 476

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRI 539
           DLTSDG++LVTGSADKTV+FW F+V    V    +K +P+L+L HDTTLEL+DDILS+ I
Sbjct: 477 DLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVI 536

Query: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599
           SPDD+++A+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS+DSK+I+T SADKNIKI
Sbjct: 537 SPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKI 596

Query: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSE 659
           WGLDFGDCHKSLFAHQDSIM+VKFLPES+NFFSCSKDA VKYWDG+KFECIQKL AHQSE
Sbjct: 597 WGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSE 656

Query: 660 VWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGD 719
           VW++++S DG+FV+S+ HDHSIR+WEETEDQVF           QYEDTLLTSLE G GD
Sbjct: 657 VWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGD 716

Query: 720 DAFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRK 779
           +            +EV GVHKQT+ESLKAGERLMEAL++G+ +I  +E ++  +  W++ 
Sbjct: 717 EMLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKS 776

Query: 780 KLGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSI 839
           K G  PI+PQ N++L+A+ KTPE+YI++TL++I+ SQ+EDALMVMPFSY+LKFLKFID +
Sbjct: 777 KKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVV 836

Query: 840 MQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLG 899
               +LL  H+ L+CK LFF+I+FN+KELV+QKN  LK Q++RVK  LR +LKS  D+LG
Sbjct: 837 TTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELG 896

Query: 900 FNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETV 942
           FN++G+KFIKQQW L H+ EF DEY+++  E   ++KR F T+
Sbjct: 897 FNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKKRVFGTL 939

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 1286 bits (3327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/941 (64%), Positives = 746/941 (79%), Gaps = 7/941 (0%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQ+  FGV+ +N+NCVWLP+ ++    + PGQ+IT ALE V  W+IKTG+L+
Sbjct: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAK----NSPGQVITGALEEVKCWEIKTGELL 56

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
            T+ DGLPPGA D +  KPAE TYL+ H++T +LAVGYADG IK+WD+ ++TVL+ F+ H
Sbjct: 57  KTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSH 116

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180
            +AIT+L+FD TGTRLISGS+D+ II+WDLV E GL KLRSHKD+ITG WC+ +DWLIS 
Sbjct: 117 SSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISV 176

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240
           SKDG+IKLWD+K  QC+ETH+AHTGECW L+VKD+++IT   +S++KLW+L++E    G 
Sbjct: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPN-GS 235

Query: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXX 300
            L E G++EKQSKQR  ++ F T  +DG +FFY  N+DKT                    
Sbjct: 236 MLLEKGSYEKQSKQRCTELSF-TTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKRE 294

Query: 301 XXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360
                   +DEEI +S ++SY++L+LHPFQ VRSL+K+K++SWT  T SKLELV+TT+NN
Sbjct: 295 KRFKEKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANN 354

Query: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420
           TIEYYSIPY+K+EP  P  +K H+IE  G RTD+R+ DIS D++LLATASNG+LK+WN+K
Sbjct: 355 TIEYYSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIK 414

Query: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480
           T  CIR  +CGYAL CKFLPGG LVILGTR G+LQLFDLASS++L+ IE+AH AAIWSLD
Sbjct: 415 TKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLD 474

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
           LTSDGKRLVT SADKTVKFWDF+VE  LV GT DKF+P +KL HDTTL+L +D+  ++IS
Sbjct: 475 LTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKIS 534

Query: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           P+DR+LA+SLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS DSK+IITSSADKNIKIW
Sbjct: 535 PEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIW 594

Query: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660
           GLDFGDCHKSLFAHQDSIM+VKFLPESHNFFSCSKD  VKYWDG  F+CIQKLY HQ EV
Sbjct: 595 GLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEV 654

Query: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDD 720
           WALA+S+DG  VVS SHD SIR+WEETEDQVF           QYE TLLTSLE G+GDD
Sbjct: 655 WALAVSSDGQAVVSVSHDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDD 714

Query: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780
           AF  +   E+   E + VHKQT+ESLKAGERLMEALDLGI EI+  E Y + MKLW  KK
Sbjct: 715 AFISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWN-KK 773

Query: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840
           LG+ P KPQ N++L A++KTPE Y+M+TL +I+ SQLEDAL+V+PFSYVLKFLKFID  +
Sbjct: 774 LGDQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAI 833

Query: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900
           +N  +LH  LPL+CK L F+++ NHKELVSQKNEELK Q++RVK +LR AL+S  DDLGF
Sbjct: 834 KNDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGF 893

Query: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFET 941
           N+QGLKF++  WN+ HNY+F DEYDQ  KE   ++KR F T
Sbjct: 894 NIQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKKRLFPT 934

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 1171 bits (3030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/946 (61%), Positives = 727/946 (76%), Gaps = 15/946 (1%)

Query: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60
           MVKSYQRFEQS  FG+I+++   ++LPA++ T      G+LIT ALEN+ +W +KT ++ 
Sbjct: 1   MVKSYQRFEQSGLFGLISTSNQSIYLPATNST-----SGKLITGALENIQIWTLKTNEV- 54

Query: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
             L+DGLP GA +   +KP+  T +  H++T+LL VGY DGVIKVWDL+SK+VL+ FNGH
Sbjct: 55  EVLTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGH 114

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC-QGEDWLIS 179
           K+ +T+L+ D  GTRL+SGSKDS++I+WDLVGEVGL KLRSHKD+ITG W     DWLIS
Sbjct: 115 KSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLIS 174

Query: 180 TSKDGMIKLWDLKTQ-QCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKL 238
            +KDG+IK+WDLK   QC+ETH+AHTG+CW +++ ++++ITT  DSQ K+W+L++E    
Sbjct: 175 VAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSN- 233

Query: 239 GGKLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXX 298
           G K++E GTFE +SKQRG+  EFIT   +G  FFYIQN DKT                  
Sbjct: 234 GEKISERGTFETESKQRGVSTEFIT-APNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNR 292

Query: 299 XXXXXXXXXXTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTS 358
                     ++EEI +++  +  S++ H F TVRS YKIKS++W   ++SKLE+VLTTS
Sbjct: 293 REKRLRDKGASEEEIQEAVNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTS 352

Query: 359 NNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWN 418
           NNTIE Y IPY KR+  +  P++ + +ELQG RTD+RS+DISDD +LL+TASNG LK+WN
Sbjct: 353 NNTIESYQIPYSKRD--AEPPVRRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWN 410

Query: 419 VKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWS 478
           + T KCIRTF CGYAL  + LPGGLLV++GTR GELQLFDLASS+LL T E AH AAIWS
Sbjct: 411 LTTKKCIRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASSTLLSTTE-AHTAAIWS 469

Query: 479 LDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLR 538
           LDLTS+GKRLVTGSADK+ KFWDF+V   LVPGTKDK++P LKL HDTTLEL DDIL+++
Sbjct: 470 LDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVK 529

Query: 539 ISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598
           IS +DRYLA+SLLDNTVKVFF DS+KFYLSLYGHKLPVLSID S DSKM+ITSSADKNIK
Sbjct: 530 ISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIK 589

Query: 599 IWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658
           IWG+DFGDCHKS+FAHQDSIMSV+F  ++HNFFSC KD  VK WDG+KF+CIQKL  HQS
Sbjct: 590 IWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQS 649

Query: 659 EVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNG 718
           EVW +A+S DG  VVS+SHDHSIR+W+ET+DQVF           +YE+TLL SLE G+G
Sbjct: 650 EVWCIAVSPDGRTVVSTSHDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSG 709

Query: 719 DDAFKGDATG--ESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLW 776
           DD F  D     + V DEVSGV+KQTLESLKAGE+LMEALDLG+AEIE  E Y + +K W
Sbjct: 710 DDQFLRDKNSGDDGVIDEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKSW 769

Query: 777 QRKKLGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFI 836
           ++KK GE P+KPQ N++LIA+   PE+YIMDTL +I+ SQLED+L+V+PFSYV+KF KF 
Sbjct: 770 KKKKSGEPPMKPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFF 829

Query: 837 DSIMQNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTED 896
           D IM+ K L+  HL LICK LFFI++ N+KELV+QKNEELK ++ RVKT +R  L+   D
Sbjct: 830 DVIMKQKDLVLLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNAD 889

Query: 897 DLGFNVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRFFETV 942
           DLGFN+ GL FIKQQWNLRHN EF D+Y Q E E   A+KR FETV
Sbjct: 890 DLGFNIAGLNFIKQQWNLRHNLEFTDDYSQLEHEKKVAKKRVFETV 935

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score =  120 bits (302), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 144/610 (23%), Positives = 246/610 (40%), Gaps = 94/610 (15%)

Query: 126 LLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGED----WLI-ST 180
           ++  D T T +  G  D +IIV D+      +  + H  +I+     G +    WL+ S 
Sbjct: 123 IMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSG 182

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVK------DDL---LITTGTDSQVKLWKL 231
             +GM+K+WDL  + CI T   H     GL V+      D++   L++   D+ V LW+ 
Sbjct: 183 DTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIVNLWEF 242

Query: 232 NIENDKLGGKLTEMGTFEKQSKQRGL------KIEFITNTSDGNSFFYIQNADKTXXXXX 285
           N+   KL  KL +     +Q +  G       +++ I  T+ G + F + +  K      
Sbjct: 243 NLR--KLC-KLLKTLPVNQQVESCGFIHDHDNELQDIIYTAGGEAIFQLISLSK-----G 294

Query: 286 XXXXXXXXXXXXXXXXXXXXXXXTDEEITKSIKDSYSSL-------ILHPFQTVRSLYKI 338
                                  T+ ++   I  S  +L        L P +    + +I
Sbjct: 295 SVIKRTVKPTEELFIIGTLPFTATNNDLNSYIVMSDQTLQMINLTKALSPTELSNPIIEI 354

Query: 339 KSA---SWTTITSSKL------ELVLTTSNNTIEYYSIPYEKREPTSP------APLKTH 383
           +S    +  TI   K       +L L T++ T+    +P   +E   P      A L  +
Sbjct: 355 ESCIAGNHGTIADMKFVGQDLNKLALATNSPTLRIIPVPSTMKEAADPNTQDNSADLPIN 414

Query: 384 TIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGL 443
               +G    + S+  ++D + LATAS     I    + +  R F   YA   KF+    
Sbjct: 415 METYEGHTDLLNSLAATEDGQWLATASKDHTSILWKYSSETSRFF--AYA---KFI---- 465

Query: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKR-----LVTGSADKTVK 498
                                       H +++ ++ L +   R     L+T S D T+K
Sbjct: 466 ---------------------------GHSSSVTAVGLPNVLLRGYPEFLITASNDLTIK 498

Query: 499 FWDFQVENTLVPG--TKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVK 556
            W     +       +KDK   I+K++  T    + DI S+ ISP+D  +A    D + K
Sbjct: 499 KWKIPTPSKERSDDESKDK-THIIKVSEYTRHAHDKDINSISISPNDSLIATGSYDKSCK 557

Query: 557 VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616
           ++ LDS +   +L  HK  +  +      K+I T S DK IK+W LD     K+   H +
Sbjct: 558 LWNLDSGELVATLNNHKRGIWDVSFCQFDKLIATCSGDKTIKLWSLDTFAVLKTFAGHTN 617

Query: 617 SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSS 676
           ++    F+ +     S   D ++K WD    +C++ L  H + +WAL    DG  +VS+ 
Sbjct: 618 AVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGELIVSAD 677

Query: 677 HDHSIRIWEE 686
            D  ++ W +
Sbjct: 678 ADGVLQFWND 687

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 75/162 (46%), Gaps = 11/162 (6%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAI---TLLQFDG 131
           R A   +   + +  +  L+A G  D   K+W+L S  ++   N HK  I   +  QFD 
Sbjct: 528 RHAHDKDINSISISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFD- 586

Query: 132 TGTRLISG-SKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLW 189
              +LI+  S D  I +W L     L     H +++    +   +  L+S+  DG+IK+W
Sbjct: 587 ---KLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIW 643

Query: 190 DLKTQQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLW 229
           D  T  C++T   H    W L+  +D  L+++   D  ++ W
Sbjct: 644 DCTTGDCLKTLDGHDNRIWALTTWNDGELIVSADADGVLQFW 685

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 54/118 (45%)

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
           + H   + SI IS +  +I T S DK+ K+W LD G+   +L  H+  I  V F      
Sbjct: 529 HAHDKDINSISISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHKRGIWDVSFCQFDKL 588

Query: 630 FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEET 687
             +CS D  +K W  + F  ++    H + V           +VSS  D  I+IW+ T
Sbjct: 589 IATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCT 646

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 69/153 (45%), Gaps = 19/153 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +W++ +G+L++TL++         RG    + ++ +  +   L+A    D  IK+W L +
Sbjct: 558 LWNLDSGELVATLNN-------HKRGI--WDVSFCQFDK---LIATCSGDKTIKLWSLDT 605

Query: 111 KTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF- 169
             VL  F GH  A+    F     +L+S   D  I +WD      L  L  H + I    
Sbjct: 606 FAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTTGDCLKTLDGHDNRIWALT 665

Query: 170 -WCQGEDWLISTSKDGMIKLWDLKTQQCIETHI 201
            W  GE  ++S   DG+++ W+     C E  I
Sbjct: 666 TWNDGE-LIVSADADGVLQFWN----DCTELEI 693

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 86/186 (46%), Gaps = 26/186 (13%)

Query: 526 TTLELNDD--ILSLRISPDDRYL-AISLLDNTVKVFFLDSMKFYLSLYGHKL-------- 574
           TT+  ND+  I  L+++PD ++L +I+L    +K++ L +++   ++   +         
Sbjct: 56  TTITNNDEQEITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTMNTKQQSLQPIKTL 115

Query: 575 ----PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFL--PESH 628
               P   +D    S ++     D +I +  ++ G    S   H  +I SVKF    +++
Sbjct: 116 KLSSPSYIMDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTN 175

Query: 629 NFFSCSKD--AVVKYWDGEKFECIQKLYAHQSEVWAL---AISTDGSFVV----SSSHDH 679
            +  CS D   +VK WD  K  CI  L  H S V  L   ++S +   VV    S S D+
Sbjct: 176 CWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDN 235

Query: 680 SIRIWE 685
            + +WE
Sbjct: 236 IVNLWE 241

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 77/168 (45%), Gaps = 17/168 (10%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTY-LEVHQDTDLLAVGYA 99
           L + AL+  N+  I+    M+T    L P     +  K +  +Y ++    + L+AVG  
Sbjct: 83  LQSQALKIYNLTAIEGETTMNTKQQSLQP----IKTLKLSSPSYIMDCDSTSTLVAVGGT 138

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTR----LISGSKDSNIIVWDLVGEVG 155
           DG I V D+ +  +  +F GH   I+ ++F G        L SG  +  + +WDLV    
Sbjct: 139 DGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSGDTNGMVKIWDLVKRSC 198

Query: 156 LYKLRSHKDSITGFWCQGED--------WLISTSKDGMIKLWDLKTQQ 195
           ++ L+ H  ++ G   +            L+S S+D ++ LW+   ++
Sbjct: 199 IHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIVNLWEFNLRK 246

 Score = 33.5 bits (75), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 57/145 (39%), Gaps = 29/145 (20%)

Query: 117 FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLY----KLRSHKDSITGFWCQ 172
           + GH   +  L     G  L + SKD   I+W    E   +    K   H  S+T     
Sbjct: 418 YEGHTDLLNSLAATEDGQWLATASKDHTSILWKYSSETSRFFAYAKFIGHSSSVTAVGLP 477

Query: 173 G------EDWLISTSKDGMIKLWDLKT--------QQCIETHI---------AHTGECWG 209
                   ++LI+ S D  IK W + T        +   +THI         AH  +   
Sbjct: 478 NVLLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKDKTHIIKVSEYTRHAHDKDINS 537

Query: 210 LSVK-DDLLITTGT-DSQVKLWKLN 232
           +S+  +D LI TG+ D   KLW L+
Sbjct: 538 ISISPNDSLIATGSYDKSCKLWNLD 562

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score =  112 bits (280), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/378 (24%), Positives = 164/378 (43%), Gaps = 54/378 (14%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASN 411
           +L L T++ ++    +P +   P +  PL     E  G    + S+D ++D   +ATAS 
Sbjct: 352 KLALATNSPSLRIIPVP-DLSGPEASLPLDVEIYE--GHEDLLNSLDATEDGLWIATASK 408

Query: 412 GSLKI-WNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIED 470
            +  I W    + C                                FD+ +  +      
Sbjct: 409 DNTAIVWRYNENSC-------------------------------KFDIYAKYI------ 431

Query: 471 AHDAAIWSL---DLTSDG--KRLVTGSADKTVKFWDFQVENTLVP-GTKDKFLPILKLNH 524
            H AA+ ++   ++ S G  + L+T S D T+K W       ++P  T    + I+K++ 
Sbjct: 432 GHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKW-------IIPKPTASMDVQIIKVSE 484

Query: 525 DTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFD 584
            T      DI +L +SP+D   A +  D T K++ L++ +   +L  HK  +  +     
Sbjct: 485 YTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQY 544

Query: 585 SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDG 644
            K++ TSS DK +KIW LD     K+L  H +++    F+ +     SC  D ++K WD 
Sbjct: 545 DKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDC 604

Query: 645 EKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQ 704
              EC++ L  H + +WAL+   DG  +VS+  D   + W++  +Q             +
Sbjct: 605 SSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCTEQEIEEEQEKAKLQVE 664

Query: 705 YEDTLLTSLEEGNGDDAF 722
            E +L   + +G+  +AF
Sbjct: 665 QEQSLQNYMSKGDWTNAF 682

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 68/159 (42%), Gaps = 3/159 (1%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGT 134
           R A   +   L V  +  + A    D   K+W+L +  +      HK  +  + F     
Sbjct: 487 RHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDK 546

Query: 135 RLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKT 193
            L + S D  + +W L     +  L  H +++    +   +  LIS   DG+IK+WD  +
Sbjct: 547 LLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSS 606

Query: 194 QQCIETHIAHTGECWGLSVKD--DLLITTGTDSQVKLWK 230
            +C++T   H    W LS  +  D++++   D   + WK
Sbjct: 607 GECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWK 645

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 91/208 (43%), Gaps = 27/208 (12%)

Query: 41  LITSALENVNVWDIKTGD--LMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGY 98
           L T  L+ +N+ D+  G   ++  +S+               E T L++  D   L    
Sbjct: 32  LATPVLDEINIIDLTPGSRKILHKISN-----------EDEQEITALKLTPDGQYLTYVS 80

Query: 99  ADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYK 158
              ++K++ L +  V+ +      +  +L  D T T L  G  D +IIV D+      + 
Sbjct: 81  QAQLLKIFHLKTGKVVRSMKISSPSY-ILDADSTSTLLAVGGTDGSIIVVDIENGYITHS 139

Query: 159 LRSHKDSITGFWCQGE----DWLISTS-KDGMIKLWDLKTQQCIETHIAHTGECWGL--- 210
            + H  +I+     G+     WL+++   +GM+K+WDL  ++C+ T   HT    GL   
Sbjct: 140 FKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDII 199

Query: 211 SVKDD-----LLITTGTDSQVKLWKLNI 233
            V D+      L++ G D  + LW  N+
Sbjct: 200 EVPDNDEPSLNLLSGGRDDIINLWDFNM 227

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 72/162 (44%), Gaps = 12/162 (7%)

Query: 508 LVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
           L PG++       K+ H  + E   +I +L+++PD +YL        +K+F L + K   
Sbjct: 45  LTPGSR-------KILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVR 97

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           S+     P   +D    S ++     D +I +  ++ G    S   H  +I S+KF  + 
Sbjct: 98  SMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQL 156

Query: 628 HN----FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
           ++      S   + +VK WD  K +C+  L  H S V  L I
Sbjct: 157 NSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDI 198

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 60/141 (42%), Gaps = 15/141 (10%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGA-KPAECTYLEVHQDTDLLAVGYADGVIKVWDLM 109
           +W+++ G+L +TL       A+  RG    + C Y        LLA    D  +K+W L 
Sbjct: 517 IWNLENGELEATL-------ANHKRGLWDVSFCQY------DKLLATSSGDKTVKIWSLD 563

Query: 110 SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF 169
           + +V+    GH  A+    F     +LIS   D  I +WD      L  L  H + +   
Sbjct: 564 TFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWAL 623

Query: 170 WCQGE-DWLISTSKDGMIKLW 189
               + D ++S   DG+ + W
Sbjct: 624 STMNDGDMIVSADADGVFQFW 644

 Score = 38.5 bits (88), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 67/170 (39%), Gaps = 22/170 (12%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKT----VLLNFNGHKAAITLLQFDGTGTR----- 135
           L+  +D   +A    D    VW     +    +   + GH AA+T +      ++     
Sbjct: 394 LDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEF 453

Query: 136 LISGSKDSNIIVWDL----------VGEVGLYKLRSHKDSITGFWCQGEDWLIST-SKDG 184
           L++ S D  I  W +          + +V  Y   +H+  I        D + +T S D 
Sbjct: 454 LLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDK 513

Query: 185 MIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQVKLWKLN 232
             K+W+L+  +   T   H    W +S    D LL T+  D  VK+W L+
Sbjct: 514 TCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLD 563

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score =  111 bits (277), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 117/235 (49%), Gaps = 3/235 (1%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLA 547
           L++ S D TVK W  +V       T+D+ +P++K +  T      DI +L ISP+D   A
Sbjct: 447 LLSSSTDMTVKKW--KVPKPTQNPTEDE-IPVVKTSEYTRRAHEKDINALSISPNDSIFA 503

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ L + +   +L  HK  +  +      K+I T S DK IKIW L+  + 
Sbjct: 504 TASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLENYNI 563

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
             +L  H +++  + F+ ++    SC  D +VK WD    EC++ L AH + +WAL ++ 
Sbjct: 564 KATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALEVAD 623

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG   V++  D   + W++  ++             + E +L   L +G+  +AF
Sbjct: 624 DGDRFVTADADGLFQFWKDNSEEEHEQDLEKKRLKVEQEQSLQNYLSKGDWVNAF 678

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 94/235 (40%), Gaps = 10/235 (4%)

Query: 8   FEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALE-NVNVWDIKTGDLMSTLSDG 66
           F+Q A F   A +   V LP          P  L++S+ +  V  W +       T  D 
Sbjct: 417 FKQYAKFIGHAGSVTAVALP---NIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPT-EDE 472

Query: 67  LPPGASD--ARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAI 124
           +P   +    R A   +   L +  +  + A    D   K+WDL++  ++     HK  +
Sbjct: 473 IPVVKTSEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGL 532

Query: 125 TLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKD 183
             + F      + + S D  I +W L        L  H +++    +      L+S   D
Sbjct: 533 WDVSFCQHDKLIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGAD 592

Query: 184 GMIKLWDLKTQQCIETHIAHTGECWGLSVKD--DLLITTGTDSQVKLWKLNIEND 236
           G++K+WD  T +C+ T  AH    W L V D  D  +T   D   + WK N E +
Sbjct: 593 GLVKIWDCSTGECLRTLDAHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEEE 647

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 98/223 (43%), Gaps = 25/223 (11%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLEL 530
           AH+  I +L ++ +     T S DKT K WD      LV G     L     NH   L  
Sbjct: 485 AHEKDINALSISPNDSIFATASYDKTCKIWD------LVTGE----LVATLANHKRGL-- 532

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
                 +     D+ +A    D T+K++ L++     +L GH   V  I     +K +++
Sbjct: 533 ----WDVSFCQHDKLIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVS 588

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW-DGEKFEC 649
             AD  +KIW    G+C ++L AH + I +++   +   F +   D + ++W D  + E 
Sbjct: 589 CGADGLVKIWDCSTGECLRTLDAHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEEEH 648

Query: 650 IQ-----KLYAHQSEVWALAISTD---GSFVVSSSHDHSIRIW 684
            Q     +L   Q +     +S      +F+++ + DH +R++
Sbjct: 649 EQDLEKKRLKVEQEQSLQNYLSKGDWVNAFLLAMTLDHPMRLY 691

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 77/174 (44%), Gaps = 11/174 (6%)

Query: 520 LKLNHDTTLELNDD----ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLP 575
           LK  H+   ++N+D    I +L+++PD  YL     +  ++++ L S K   S+     P
Sbjct: 45  LKERHEIVHKINNDDEQEITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKVSS-P 103

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE--SHNFFSC 633
           V  +D    S +++    D ++ I+ ++ G    S   H   I SVKF  E    N+   
Sbjct: 104 VYVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLA 163

Query: 634 SKD--AVVKYWDGEKFECIQKLYAHQSEVWALAISTDGS--FVVSSSHDHSIRI 683
           S D   VVK WD  K  C+  +  H + V  L      S   ++S   D  I +
Sbjct: 164 SGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINL 217

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 78/157 (49%), Gaps = 10/157 (6%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140
           E T L++  D   L     + +++++ L SK ++ +     + + ++  D T T L+ G 
Sbjct: 62  EITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKV-SSPVYVMDCDETSTLLVIGG 120

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGE----DWLISTS-KDGMIKLWDLKTQQ 195
            D ++ ++D+      +  + H   I+     GE    +WL+++   +G++K+WDL  ++
Sbjct: 121 TDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLASGDTNGVVKIWDLVKRR 180

Query: 196 CIETHIAHTGECWGL--SVKDD--LLITTGTDSQVKL 228
           C+ T   HT    GL   VKD   LLI+ G D  + L
Sbjct: 181 CMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINL 217

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 62/118 (52%), Gaps = 6/118 (5%)

Query: 387 LQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYALTCK---FLPGG 442
           L   +  +  +     ++L+AT S + ++KIW+++ +    T E G+    +   F+   
Sbjct: 525 LANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLENYNIKATLE-GHTNAVQRISFINKN 583

Query: 443 LLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
             ++    +G ++++D ++   L T+ DAHD  IW+L++  DG R VT  AD   +FW
Sbjct: 584 KQLVSCGADGLVKIWDCSTGECLRTL-DAHDNRIWALEVADDGDRFVTADADGLFQFW 640

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 50/252 (19%), Positives = 98/252 (38%), Gaps = 62/252 (24%)

Query: 353 LVLTTSNNTIEYYSIPYEKREPTSP--APLKTHTIELQGQRTDMRSIDISDDNRLLATAS 410
           L+ ++++ T++ + +P   + PT      +KT     +    D+ ++ IS ++ + ATAS
Sbjct: 447 LLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPNDSIFATAS 506

Query: 411 NGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIED 470
                                Y  TCK                  ++DL +  L+ T+ +
Sbjct: 507 ---------------------YDKTCK------------------IWDLVTGELVATLAN 527

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLEL 530
            H   +W +      K + T S DKT+K W  +                   N   TLE 
Sbjct: 528 -HKRGLWDVSFCQHDKLIATCSGDKTIKIWSLE-----------------NYNIKATLEG 569

Query: 531 NDDILSLRIS--PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMI 588
           + + +  RIS    ++ L     D  VK++   + +   +L  H   + +++++ D    
Sbjct: 570 HTNAVQ-RISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALEVADDGDRF 628

Query: 589 ITSSADKNIKIW 600
           +T+ AD   + W
Sbjct: 629 VTADADGLFQFW 640

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 86/368 (23%), Positives = 148/368 (40%), Gaps = 96/368 (26%)

Query: 403 NRLLATA-SNGSLKIWNVKTHKCIRTFECGYA----LTCKFLPGGLLVILGTRNGELQL- 456
           N LLA+  +NG +KIW++   +C+ T +   A    L        +L+I G R+  + L 
Sbjct: 159 NWLLASGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINLH 218

Query: 457 -FDLASSS-LLDT-------------------IEDAHDAAIWSLDLTSDGKRLVTGS--- 492
            FD   +  LL T                   I  A D A++ +     GK++ +     
Sbjct: 219 HFDYKKTCKLLKTLPVKQQIEACGFIANHESLIYHAGDNAVYQIVCLQSGKQIKSSQKPQ 278

Query: 493 ---------------------ADKTVKFWDFQVENTLVPGTKDKFLPI---LKLNHDTTL 528
                                +D+T+   D  +E  L+   +D  +PI   +  NH T  
Sbjct: 279 EELFIIGVLSIENGSKHYLVLSDQTLFLLD--IEQALME--EDTTIPIKSKIAGNHGTIA 334

Query: 529 EL-----NDDILSLRI-SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL-SIDI 581
           ++     N D+L+L   SP  R +           F +++     ++YG  + +L ++D 
Sbjct: 335 DMKFVGPNLDMLALATNSPTLRIIKAPQASEEDGQFPVET-----NMYGGHVDLLNALDA 389

Query: 582 SFDSKMIITSSADKNIKIWGL--DFGDC--HKSLFAHQDSIMSVKF--LPESH--NF-FS 632
           S D   I T+S D  + +W      GD   +     H  S+ +V    + + H  NF  S
Sbjct: 390 SEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVALPNIMDQHFPNFLLS 449

Query: 633 CSKDAVVKYWDGEK---------------FECIQKLYAHQSEVWALAISTDGSFVVSSSH 677
            S D  VK W   K                E  ++  AH+ ++ AL+IS + S   ++S+
Sbjct: 450 SSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRR--AHEKDINALSISPNDSIFATASY 507

Query: 678 DHSIRIWE 685
           D + +IW+
Sbjct: 508 DKTCKIWD 515

 Score = 32.3 bits (72), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 55/140 (39%), Gaps = 25/140 (17%)

Query: 117 FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRS----HKDSITGFWCQ 172
           + GH   +  L     G  + + SKD  +++W    ++G +K  +    H  S+T     
Sbjct: 377 YGGHVDLLNALDASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVALP 436

Query: 173 G------EDWLISTSKDGMIKLWDL--KTQQCIETHI-----------AHTGECWGLSV- 212
                   ++L+S+S D  +K W +   TQ   E  I           AH  +   LS+ 
Sbjct: 437 NIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSIS 496

Query: 213 -KDDLLITTGTDSQVKLWKL 231
             D +  T   D   K+W L
Sbjct: 497 PNDSIFATASYDKTCKIWDL 516

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 115/239 (48%), Gaps = 11/239 (4%)

Query: 488 LVTGSADKTVKFWDFQVENTLVP---GTKDKF-LPILKLNHDTTLELNDDILSLRISPDD 543
           ++T S D TVK W        VP    + + F L ++K++  T      DI +L ++P+D
Sbjct: 445 ILTASNDLTVKKW-------AVPKPVASNESFELQVVKVSEYTRRAHEKDINALSVAPND 497

Query: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
              A +  D T KV+ L+S +   +L  H+  +  +      ++I T S DK IKIW LD
Sbjct: 498 STFATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLD 557

Query: 604 FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWAL 663
                K+   H +++    F+ +     S S D +VK WD    EC++ L  H + +WAL
Sbjct: 558 TFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWAL 617

Query: 664 AISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
            ++ DG  +VS+  D   + W+++ +Q             + E +L   L +G+  +AF
Sbjct: 618 CVAEDGDLIVSADADGVFQFWKDSTEQERQQHNEQQHLKVEQEQSLQNYLSQGDWTNAF 676

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 83/189 (43%), Gaps = 14/189 (7%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGT 134
           R A   +   L V  +    A    D   KVWDL S  V      H+  +  + F     
Sbjct: 481 RRAHEKDINALSVAPNDSTFATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYER 540

Query: 135 RLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKT 193
            + + S D  I +W L     +     H +++    +   +  L+S+S DG++K+WD  T
Sbjct: 541 LIATCSGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCST 600

Query: 194 QQCIETHIAHTGECWGLSVKD--DLLITTGTDSQVKLWKLNIENDKLGGKLTEMGTFEKQ 251
            +C++T   HT   W L V +  DL+++   D   + WK + E ++           ++ 
Sbjct: 601 GECVKTLDGHTNRIWALCVAEDGDLIVSADADGVFQFWKDSTEQER-----------QQH 649

Query: 252 SKQRGLKIE 260
           ++Q+ LK+E
Sbjct: 650 NEQQHLKVE 658

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 126/319 (39%), Gaps = 55/319 (17%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIEL-QGQRTDMRSIDISDDNRLLATAS 410
           +L L T++ T+    +  E   P          +EL +G +  + ++D ++D   LATAS
Sbjct: 347 KLALATNSPTLRIIPVSMEGGLPID--------VELYEGHKDLLNAVDATEDGLWLATAS 398

Query: 411 NGSLKI---WNVKTHKCI--RTFEC-GYALTCKFLPG----GLLVILGTRNGELQL---- 456
             S  I   +   ++K +    FE    A+T   LP     G    + T + +L +    
Sbjct: 399 KDSTAILWWYQSNSNKFVPYAKFEGHSSAVTAVGLPNIMHKGWPEFILTASNDLTVKKWA 458

Query: 457 ----------FDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF---Q 503
                     F+L    + +    AH+  I +L +  +     T S DKT K WD    +
Sbjct: 459 VPKPVASNESFELQVVKVSEYTRRAHEKDINALSVAPNDSTFATASYDKTCKVWDLESGE 518

Query: 504 VENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSM 563
           V+ TL              NH   L        +     +R +A    D T+K++ LD+ 
Sbjct: 519 VKATLA-------------NHRRGL------WDVAFCQYERLIATCSGDKTIKIWSLDTF 559

Query: 564 KFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
               +  GH   V           +++SSAD  +KIW    G+C K+L  H + I ++  
Sbjct: 560 AVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWALCV 619

Query: 624 LPESHNFFSCSKDAVVKYW 642
             +     S   D V ++W
Sbjct: 620 AEDGDLIVSADADGVFQFW 638

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 78/167 (46%), Gaps = 14/167 (8%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140
           + T L++  D   L       ++K++DL    ++ +      +  ++  D T T L  G 
Sbjct: 62  DITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISSPSY-VVDSDSTSTLLAIGG 120

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDSITG--FWCQ--GEDWLISTS-KDGMIKLWDLKTQQ 195
            D +I V D+      + L+ H  +I+   F+ +  GE WL+++   +GM+K+WDL  ++
Sbjct: 121 TDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKRK 180

Query: 196 CIETHIAHTGECWGLSVKDD--------LLITTGTDSQVKLWKLNIE 234
           CI T   HT    G+   +          LI+ G D  +  W+ N++
Sbjct: 181 CIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLK 227

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 82/190 (43%), Gaps = 23/190 (12%)

Query: 508 LVPGTKDKFLPILKLNHDTTLELND--DILSLRISPDDRYLAISLLDNTVKVFFLDSMKF 565
           LVP  K  F          T+E +D  DI +L+++ D RYL  +     +K+F L   K 
Sbjct: 45  LVPERKTLF----------TIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLREGKI 94

Query: 566 YLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP 625
             S+     P   +D    S ++     D +I +  ++ G    SL  H  +I SVKF  
Sbjct: 95  VRSMKISS-PSYVVDSDSTSTLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYG 153

Query: 626 ESHN----FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWAL----AISTDGS--FVVSS 675
           E +       S   + +VK WD  K +CI  +  H + V  +    + + D S  F++S 
Sbjct: 154 EQNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLISG 213

Query: 676 SHDHSIRIWE 685
             D  I  W+
Sbjct: 214 GRDDVINYWQ 223

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 81/188 (43%), Gaps = 27/188 (14%)

Query: 465 LDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNH 524
           L TIE+  +  I +L LT+DG+ L   S  + +K +D + E  +V   K    P   ++ 
Sbjct: 52  LFTIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLR-EGKIVRSMKISS-PSYVVDS 109

Query: 525 DTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDI--S 582
           D+T  L               LAI   D ++ V  +++     SL GH   + S+     
Sbjct: 110 DSTSTL---------------LAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGE 154

Query: 583 FDSKMIITSSADKN--IKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN------FFSCS 634
            + ++ + +S D N  +KIW L    C  ++  H  ++  + F    +N        S  
Sbjct: 155 QNGEVWLLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLISGG 214

Query: 635 KDAVVKYW 642
           +D V+ YW
Sbjct: 215 RDDVINYW 222

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 111/235 (47%), Gaps = 6/235 (2%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLA 547
           L+T S D T+K W      +++       + I+K++  T      DI +L +SP+D   A
Sbjct: 454 LLTASNDLTIKKWKVPKPTSIMD------VQIIKVSEYTRHAHEKDINALSVSPNDSIFA 507

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ L++ +   +L  HK  +  +      K++ TSS DK +KIW LD    
Sbjct: 508 TASYDKTCKIWSLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSV 567

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
            K+L  H +++    F+ +     SC  D ++K WD    EC+  L  H + +WAL    
Sbjct: 568 MKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMN 627

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG  +VS+  D   + W++  +Q             + E +L   + +G+  +AF
Sbjct: 628 DGDMIVSADADGVFQFWKDCSEQEKEEELEKAKVQVEQEQSLQNYISQGDWTNAF 682

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 126/315 (40%), Gaps = 46/315 (14%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASN 411
           +L L T++ ++    IP +     +  PL     E  G    + S+D ++D   +ATAS 
Sbjct: 352 KLALATNSPSLRIIPIP-DLSGADASLPLDVEIYE--GHEDLLNSLDATEDGLWIATASK 408

Query: 412 GSLKI---WNVKTHKC-IRTFECGY--ALTC----KFLPGGLLVILGTRNGEL------- 454
            +  I   +N +T K  I     G+  A+T       +P G    L T + +L       
Sbjct: 409 DNTAILWKYNERTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKWKV 468

Query: 455 ----QLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF---QVENT 507
                + D+    + +    AH+  I +L ++ +     T S DKT K W     ++E T
Sbjct: 469 PKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEAT 528

Query: 508 LVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
           L              NH   L        +     D+ LA S  D TVK++ LD+     
Sbjct: 529 LA-------------NHKRGL------WDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMK 569

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           +L GH   V         K +++  AD  IKIW    G+C  +L  H + + ++  + + 
Sbjct: 570 TLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMNDG 629

Query: 628 HNFFSCSKDAVVKYW 642
               S   D V ++W
Sbjct: 630 DMIVSADADGVFQFW 644

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 66/159 (41%), Gaps = 3/159 (1%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGT 134
           R A   +   L V  +  + A    D   K+W L +  +      HK  +  + F     
Sbjct: 487 RHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEATLANHKRGLWDVSFCQYDK 546

Query: 135 RLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKT 193
            L + S D  + +W L     +  L  H +++    +   +  L+S   DG+IK+WD  +
Sbjct: 547 LLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSS 606

Query: 194 QQCIETHIAHTGECWGLSVKD--DLLITTGTDSQVKLWK 230
            +C+ T   H    W L+  +  D++++   D   + WK
Sbjct: 607 GECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFWK 645

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 83/182 (45%), Gaps = 11/182 (6%)

Query: 514 DKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK 573
           D  L   K+ H  + E   +I +LR++PD +YLA       +K+F L + +   SL    
Sbjct: 44  DLTLGCRKILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISS 103

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE--SHNFF 631
            P   +D    S ++     D +I I  ++ G    SL  H  +I S+KF  +  S  + 
Sbjct: 104 -PSYILDTDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWL 162

Query: 632 SCSKD--AVVKYWDGEKFECIQKLYAHQSEVWALAI----STDGSF--VVSSSHDHSIRI 683
             S D   +VK WD  K +C+  L  H S V  L I    S DGS   ++S   D  + +
Sbjct: 163 LASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNV 222

Query: 684 WE 685
           W+
Sbjct: 223 WD 224

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 52/211 (24%), Positives = 93/211 (44%), Gaps = 22/211 (10%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140
           E T L +  D   LA      ++K++ L +  ++ +      +  +L  D T T L  G 
Sbjct: 63  EITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISSPSY-ILDTDPTSTLLAVGG 121

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDSITG--FWCQ--GEDWLISTS-KDGMIKLWDLKTQQ 195
            D +I++ D+      + L+ H  +I+   F+ Q   E WL+++   +GM+K+WDL  ++
Sbjct: 122 TDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWLLASGDTNGMVKVWDLVKRK 181

Query: 196 CIETHIAHTGECWGLSVKDD--------LLITTGTDSQVKLWKLNIENDKLGGKLTEMGT 247
           C+ T   H+    GL + +          L++ G D  V +W  ++   K   KL +   
Sbjct: 182 CLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWDFDM---KKKCKLVKTLP 238

Query: 248 FEKQSKQRGLKIEFITNTSDGNSFFYIQNAD 278
             +Q +  G    F+ N  DG    Y    D
Sbjct: 239 VNQQVESCG----FLKN-HDGKRIIYTAGGD 264

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 73/364 (20%), Positives = 138/364 (37%), Gaps = 91/364 (25%)

Query: 405 LLATA-SNGSLKIWNVKTHKCIRTF---------------ECGYALTCKFLPGGLLVILG 448
           LLA+  +NG +K+W++   KC+ T                E G   + K L GG      
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGG------ 215

Query: 449 TRNGELQLFDL---ASSSLLDTIEDAHDAAIWSLDLTSDGKRLV-TGSADKTVKFWDFQV 504
            R+  + ++D        L+ T+               DGKR++ T   D   +  D + 
Sbjct: 216 -RDDIVNVWDFDMKKKCKLVKTLPVNQQVESCGFLKNHDGKRIIYTAGGDAIFQLIDLES 274

Query: 505 ENTLVPGTKD-------KFLPILK---------------LNHDTTLELNDDILSLR---- 538
              L    K          LPI+                +N +  LE  +D ++ R    
Sbjct: 275 GTVLKRTNKPIEELFIIGVLPIMNDSEMFLVMSDQTLQLINIEEVLENENDTINARSTIA 334

Query: 539 -----------ISPDDRYLAISLLDNTVKVFFLD-------SMKFYLSLY-GHKLPVLSI 579
                      + P+   LA++    ++++  +        S+   + +Y GH+  + S+
Sbjct: 335 GNNGIIADMRFVGPELNKLALATNSPSLRIIPIPDLSGADASLPLDVEIYEGHEDLLNSL 394

Query: 580 DISFDSKMIITSSADKNIKIWGLDFG----DCHKSLFAHQDSIMSV---KFLPESHNFF- 631
           D + D   I T+S D    +W  +      D +     H  ++ +V     +P+ +  F 
Sbjct: 395 DATEDGLWIATASKDNTAILWKYNERTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEFL 454

Query: 632 -SCSKDAVVKYWDGEKFECIQKL----------YAHQSEVWALAISTDGSFVVSSSHDHS 680
            + S D  +K W   K   I  +          +AH+ ++ AL++S + S   ++S+D +
Sbjct: 455 LTASNDLTIKKWKVPKPTSIMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKT 514

Query: 681 IRIW 684
            +IW
Sbjct: 515 CKIW 518

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 100/200 (50%), Gaps = 2/200 (1%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKFLPI-LKLNHDTTLELNDDILSLRISPDDRYL 546
           ++T S D T+K W    + T      D F P  +KL+  T    + DI +L ISP+D   
Sbjct: 473 VITASNDSTIKKWKVP-KPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIF 531

Query: 547 AISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGD 606
           A +  D T K++ L+S     +L  HK  +  +      K I+T+S DK IK+W LD   
Sbjct: 532 ATASYDKTCKIWDLESGDLKATLVNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFT 591

Query: 607 CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
             K+   H +++   +F+ +     SC  D ++K WD    ECI+ L  H + +WAL++ 
Sbjct: 592 VVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVI 651

Query: 667 TDGSFVVSSSHDHSIRIWEE 686
            DG  ++S+  D   + W +
Sbjct: 652 NDGDVIISADADGVFQFWRD 671

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/235 (22%), Positives = 100/235 (42%), Gaps = 15/235 (6%)

Query: 6   QRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALEN-VNVWDIKTGDLMSTLS 64
           ++++  A F   AS+   V LP      + + P  +IT++ ++ +  W +         +
Sbjct: 441 EKYQIYAKFLGHASSVTAVGLP---NVLTKNYPDYVITASNDSTIKKWKVPKPTKNLDNN 497

Query: 65  DGLPPG----ASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
           D   P     +   R A   +   L +  +  + A    D   K+WDL S  +      H
Sbjct: 498 DSFKPHEVKLSEYTRRAHDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKATLVNH 557

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQ---GEDWL 177
           K  +  + F      +++ S D  I +W L     +     H +++    CQ    +  L
Sbjct: 558 KRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQR--CQFINKQKQL 615

Query: 178 ISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKD--DLLITTGTDSQVKLWK 230
           +S   DG+IK+WD  + +CI+T   H+   W LSV +  D++I+   D   + W+
Sbjct: 616 VSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFWR 670

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 97/226 (42%), Gaps = 31/226 (13%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ---VENTLVPGTKDKFLPILKLNHDTT 527
           AHD  I +L ++ +     T S DKT K WD +   ++ TLV             NH   
Sbjct: 514 AHDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKATLV-------------NHKRG 560

Query: 528 LELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           L        +     D+++  +  D T+K++ LD+     +  GH   V         K 
Sbjct: 561 L------WDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQ 614

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW----- 642
           +++  AD  IKIW    G+C K+L  H + I ++  + +     S   D V ++W     
Sbjct: 615 LVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFWRDCTG 674

Query: 643 -DGEKFECIQKLYAHQSEVWALAISTD---GSFVVSSSHDHSIRIW 684
            + EK    ++L   Q +     ++ +    +F+++ + DH +R++
Sbjct: 675 ENREKDLEKERLKVEQEQSLQNYLANEDWTNAFLLAMTLDHPLRLF 720

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 56/101 (55%), Gaps = 4/101 (3%)

Query: 403 NRLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRNGELQLFDL 459
           ++ + TAS + ++K+W++ T   ++TFE        C+F+     ++    +G ++++D 
Sbjct: 570 DKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLVSCGADGLIKIWDC 629

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
           +S   + T+ D H   IW+L + +DG  +++  AD   +FW
Sbjct: 630 SSGECIKTL-DGHSNRIWALSVINDGDVIISADADGVFQFW 669

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 83/177 (46%), Gaps = 25/177 (14%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF-------DGTGTRLI 137
           + + Q + LLAVG  DG + V D+ +  +  +F GH A I+ ++F       +  G  L 
Sbjct: 108 MSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLF 167

Query: 138 SGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-------WCQGED---WLISTSKDGMIK 187
           SG     I V D+V    LY  + H  +I G          + ++    L+S  +D ++ 
Sbjct: 168 SGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVN 227

Query: 188 LWDL---KTQQCIET-HIAHTGECWGL--SVKDDLLITTGTDSQVKLWKLNIENDKL 238
           LW+    +  + I+T  +    E  G      +DL+ T G+D+  ++  L+I ++K+
Sbjct: 228 LWEFNLRRKSKLIKTIPVYQQVEACGFLNGNYEDLIYTGGSDAIFQI--LSISSNKI 282

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 73/175 (41%), Gaps = 22/175 (12%)

Query: 531 NDD---ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL-YGHKLPVLSIDISFDSK 586
           NDD   I +L++SPD +YL  +  +  +K++ +   KF  SL       V+SID +  S 
Sbjct: 58  NDDEQEITALQLSPDGKYLCYASTNQLLKIYNIVEKKFVKSLKISSPSYVMSIDQT--ST 115

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN-------FFSCSKDAVV 639
           ++     D ++ +  ++      S   H  +I +VKF  ++          FS     ++
Sbjct: 116 LLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMI 175

Query: 640 KYWDGEKFECIQKLYAHQSEVWALAISTDGSFV---------VSSSHDHSIRIWE 685
           K  D  K  C+     H S +  L I    S V         +S   D  + +WE
Sbjct: 176 KVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVNLWE 230

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 81/358 (22%), Positives = 144/358 (40%), Gaps = 54/358 (15%)

Query: 380 LKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNV------KTHKCIRTFECGYA 433
            + HT  ++G    +    + +D  LL   S G   I N+      +  K I+T      
Sbjct: 189 FQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVNLWEFNLRRKSKLIKTIPVYQQ 248

Query: 434 L-TCKFLPGGL--LVILGTRNGELQLFDLASSSLLD-TIEDAHDAAIWSLDLTSDGKRLV 489
           +  C FL G    L+  G  +   Q+  ++S+ +L  T++   +  I  +    D  +  
Sbjct: 249 VEACGFLNGNYEDLIYTGGSDAIFQILSISSNKILKKTLKPIEELFIIGVLPILDNSKFY 308

Query: 490 TGSADKTVKFWDFQVENTLVPGTKDKFL--PILKL------NHDTTLELN--DDILS--- 536
              +D+T+   D + EN        +++   I+K+      NH T  ++   D  LS   
Sbjct: 309 LVLSDQTLLLVDVE-ENMAEDENPSEYVDHTIIKIENSIAGNHGTIADMRVVDPTLSKLA 367

Query: 537 -LRISPDDRYLAISLLDNTVKVF-FLDSMKFYLSLY-GHKLPVLSIDISFDSKMIITSSA 593
               SP  R + IS  +        L  +   + +Y GH   + S+D + DS  I T+S 
Sbjct: 368 LATNSPTLRIIPISEANEEADSKDALSRIPIDVDMYEGHTDLLNSLDSTEDSLWIATASK 427

Query: 594 DKNIKIWG----LDFGDCHKSLFAHQDSIMSVKFLPE--SHNF----FSCSKDAVVKYWD 643
           D +  +W     L+    +     H  S+ +V  LP   + N+     + S D+ +K W 
Sbjct: 428 DNSCILWRYNAVLEKYQIYAKFLGHASSVTAVG-LPNVLTKNYPDYVITASNDSTIKKWK 486

Query: 644 GEK-------------FECIQKLY---AHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
             K              E     Y   AH  ++ AL+IS + S   ++S+D + +IW+
Sbjct: 487 VPKPTKNLDNNDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIFATASYDKTCKIWD 544

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 116/239 (48%), Gaps = 11/239 (4%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKF---LP-ILKLNHDTTLELNDDILSLRISPDD 543
           L+T S D T+K W        VP   D+    LP I+K +  T      DI ++ +SP+D
Sbjct: 448 LLTASNDLTIKRWK-------VPNPNDRKAIELPHIVKASEYTRRAHEKDINAISMSPND 500

Query: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
              A +  D T K++ +D+ +   +L  HK  +  +       ++ T S D++I +W L+
Sbjct: 501 SIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRSINLWSLE 560

Query: 604 FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWAL 663
                K+L  H +++  V F+  +    S   D +VK WD    EC++ L AH + +WAL
Sbjct: 561 SFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWAL 620

Query: 664 AISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           A++ DG  ++++  D   + WE+  ++             + E +L   + EG+ ++AF
Sbjct: 621 AVANDGQLIITADADGVFQFWEDNSEEEHERNIEQEKLRVEQEQSLQNYISEGDWNNAF 679

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 143/673 (21%), Positives = 265/673 (39%), Gaps = 97/673 (14%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140
           + T L +  D   L     + +++ +DL +K    +      A  +L  D + T L  G 
Sbjct: 62  DVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAY-VLDCDESSTLLAVGG 120

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGED----WLISTS-KDGMIKLWDLKTQQ 195
            D ++ V+D+      + L+ H  +I+     GE     WL+++   +GM+K+WDL  ++
Sbjct: 121 TDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVKRR 180

Query: 196 CIETHIAHTGECWGLSVK-----DDLLITTGTDSQVKLWKLNIENDKLGGKLTEMGTFEK 250
           CI T   HT    GL ++     + LL++ G D  V +   ++   K   KL +    ++
Sbjct: 181 CIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHHFDM---KKKCKLLQTIPVKR 237

Query: 251 QSKQRGLKIEFITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXTD 310
           Q +  G    FI    D  S  Y    D                                
Sbjct: 238 QIESCG----FI---GDNTSLIYTAGGDAVYQIISLESGKSIKQTAQPVEELFIVGVLPV 290

Query: 311 EEITKS---IKDSYSSLI-----LHPFQTVRSLYKIKSASWTTITSSKL------ELVLT 356
           +  TK    + D    LI     L   + +  + K  + +  TI   +L       L L 
Sbjct: 291 QNSTKCYLVLSDQTLFLIDVEKALSQTEKMIEIEKKIAGNHGTIADMRLVGPSLNRLALA 350

Query: 357 TSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS-NGSLK 415
           T++ T+     P +  E      ++T   E  G    + S+D + D   LATAS + S+ 
Sbjct: 351 TNSPTLRIIPTP-QASEDKEVMEIETEMYE--GHTDLLNSLDATSDGLWLATASKDHSVI 407

Query: 416 IWNVKTHKCIRTFE-----CGYA--LTCKFLPGGL------LVILGTRNGELQLFDLASS 462
           +W  + ++   +FE      G+A  +T   LP  +       ++  + +  ++ + + + 
Sbjct: 408 LW--RYNEASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDLTIKRWKVPNP 465

Query: 463 SLLDTIE------------DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF---QVENT 507
           +    IE             AH+  I ++ ++ +     T S DKT K W+    +VE T
Sbjct: 466 NDRKAIELPHIVKASEYTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEAT 525

Query: 508 LVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
           L              NH   L        +     D  LA    D ++ ++ L+S     
Sbjct: 526 LA-------------NHKRGL------WGVAFCEYDWLLATCSGDRSINLWSLESFTVLK 566

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           +L GH   V  +     +K ++++ AD  +KIW    G+C ++L AH + I ++    + 
Sbjct: 567 TLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALAVANDG 626

Query: 628 HNFFSCSKDAVVKYWDG------EKFECIQKLYAHQSEVWALAIST---DGSFVVSSSHD 678
               +   D V ++W+       E+    +KL   Q +     IS    + +F+++ + D
Sbjct: 627 QLIITADADGVFQFWEDNSEEEHERNIEQEKLRVEQEQSLQNYISEGDWNNAFLLAMTLD 686

Query: 679 HSIRIWEETEDQV 691
           H +R++   E  +
Sbjct: 687 HPMRLYHVLERAI 699

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 82/189 (43%), Gaps = 14/189 (7%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGT 134
           R A   +   + +  +  + A    D   K+W++ +  V      HK  +  + F     
Sbjct: 484 RRAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDW 543

Query: 135 RLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKT 193
            L + S D +I +W L     L  L  H +++    +  G   L+ST  DG++K+WD  T
Sbjct: 544 LLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCST 603

Query: 194 QQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKLNIENDKLGGKLTEMGTFEKQ 251
            +C+ T  AH    W L+V +D  L+IT   D   + W+ N E +            E+ 
Sbjct: 604 GECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFWEDNSEEEH-----------ERN 652

Query: 252 SKQRGLKIE 260
            +Q  L++E
Sbjct: 653 IEQEKLRVE 661

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 72/167 (43%), Gaps = 8/167 (4%)

Query: 524 HDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISF 583
           H    E   D+ +LR++PD RYL  +  +  ++ + L++ +   S+     P   +D   
Sbjct: 53  HKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISS-PAYVLDCDE 111

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVV 639
            S ++     D ++ ++ +  G    SL  H  +I SVKF  E  +      S   + +V
Sbjct: 112 SSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMV 171

Query: 640 KYWDGEKFECIQKLYAHQSEVWALAISTD---GSFVVSSSHDHSIRI 683
           K WD  K  CI  +  H + V  L I       S ++S   D  + +
Sbjct: 172 KIWDLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHV 218

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 68/153 (44%), Gaps = 15/153 (9%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGA-KPAECTYLEVHQDTDLLAVGYADGVIKVWDLM 109
           +W++ TG++ +TL       A+  RG    A C Y        LLA    D  I +W L 
Sbjct: 514 IWNVDTGEVEATL-------ANHKRGLWGVAFCEY------DWLLATCSGDRSINLWSLE 560

Query: 110 SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF 169
           S TVL    GH  A+  + F     +L+S   D  + +WD      +  L +H + I   
Sbjct: 561 SFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTGECVRTLDAHNNRIWAL 620

Query: 170 WCQGEDWLISTS-KDGMIKLWDLKTQQCIETHI 201
               +  LI T+  DG+ + W+  +++  E +I
Sbjct: 621 AVANDGQLIITADADGVFQFWEDNSEEEHERNI 653

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 69/160 (43%), Gaps = 21/160 (13%)

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKL 522
           +++  IE+  +  + +L LT DG+ L   S ++ ++F+D + + T           +L  
Sbjct: 50  AIIHKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAYVLDC 109

Query: 523 NHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDI- 581
           +  +TL                 LA+   D +V VF + +     SL GH   + S+   
Sbjct: 110 DESSTL-----------------LAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFY 152

Query: 582 -SFDSKMIITSSADKN--IKIWGLDFGDCHKSLFAHQDSI 618
              DS M + +S D N  +KIW L    C  ++  H  ++
Sbjct: 153 GEVDSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAV 192

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 108/235 (45%), Gaps = 3/235 (1%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLA 547
           L+T S D T+K W     +    G ++     +K++  T      DI +L ISP+D   A
Sbjct: 423 LLTASNDLTIKKWKIPKPSA---GDEEVEFHDVKISEYTRRAHEKDINALSISPNDSIFA 479

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ L++ +   +L  HK  +  +      K+I T S DK IKIW LD    
Sbjct: 480 TASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLDTFSV 539

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
            K+L  H +++    F+ + +   S   D ++K WD    ECI  L  H + +WAL +  
Sbjct: 540 IKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALCVQN 599

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG  +VS+  D   + W +  D+             + E +L   L E +  +AF
Sbjct: 600 DGDLIVSADADGVFQFWRDCTDEQREEDMAKEKERIEQEQSLQNYLNERDWTNAF 654

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 100/235 (42%), Gaps = 18/235 (7%)

Query: 6   QRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALE-NVNVWDI---KTGDLMS 61
           Q+F Q A F   +S+   V LP        S P  L+T++ +  +  W I     GD   
Sbjct: 391 QKFTQYARFSGHSSSVTAVGLP---NVMPKSYPEYLLTASNDLTIKKWKIPKPSAGDEEV 447

Query: 62  TLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHK 121
              D     +   R A   +   L +  +  + A    D   K+WDL +   +   + HK
Sbjct: 448 EFHD--VKISEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHK 505

Query: 122 AA---ITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWL 177
                ++  QFD     + + S D  I +W L     +  L  H +++    +   ++ L
Sbjct: 506 RGLWDVSFCQFDKI---IATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQL 562

Query: 178 ISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKD--DLLITTGTDSQVKLWK 230
           +ST  DG+IK+WD+   +CI T   H    W L V++  DL+++   D   + W+
Sbjct: 563 VSTGADGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWR 617

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 93/229 (40%), Gaps = 37/229 (16%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLEL 530
           AH+  I +L ++ +     T S DKT K WD +   ++   +          NH   L  
Sbjct: 461 AHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLS----------NHKRGL-- 508

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
                 +     D+ +A    D T+K++ LD+     +L GH   V           +++
Sbjct: 509 ----WDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVS 564

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW-------- 642
           + AD  IKIW +  G+C  +L  H + I ++    +     S   D V ++W        
Sbjct: 565 TGADGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWRDCTDEQR 624

Query: 643 ------DGEKFECIQKLYAHQSEV-WALAISTDGSFVVSSSHDHSIRIW 684
                 + E+ E  Q L  + +E  W        +F+++ S DH +R++
Sbjct: 625 EEDMAKEKERIEQEQSLQNYLNERDWT------NAFLLAISLDHPMRLF 667

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 80/177 (45%), Gaps = 10/177 (5%)

Query: 518 PILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL 577
           P+ K+ H  +     +I +L+++PD +YL        +K+  + + K   S+     P  
Sbjct: 16  PVKKILHTISNNDEQEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKIIKSMKVSS-PSY 74

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPE--SHNFFSCSK 635
            ID    S ++     D ++ +  ++ G    SL  H  +I S+KF  E  S+ +  CS 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 636 D--AVVKYWDGEKFECIQKLYAHQSEVWALAI-----STDGSFVVSSSHDHSIRIWE 685
           D   +VK WD  K +CI  +  H S V  + I      TD   +V+   D+ +  WE
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWE 191

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 59/121 (48%), Gaps = 12/121 (9%)

Query: 126 LLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGE----DWLI-ST 180
           ++  D T T +  G  D +++V D+      + L+ H  +I+     GE     WL+ S 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDD-------LLITTGTDSQVKLWKLNI 233
             +GM+K+WDL  ++CI T   HT    G+ + +         L+T G D+ V  W+ N+
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWEFNL 194

Query: 234 E 234
           +
Sbjct: 195 K 195

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 57/101 (56%), Gaps = 4/101 (3%)

Query: 403 NRLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRNGELQLFDL 459
           ++++AT S + ++KIW++ T   I+T E        C F+     ++    +G ++++D+
Sbjct: 517 DKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDI 576

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
           ++   + T+ D H+  IW+L + +DG  +V+  AD   +FW
Sbjct: 577 SNGECISTL-DGHNNRIWALCVQNDGDLIVSADADGVFQFW 616

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 9/120 (7%)

Query: 119 GHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFW----CQGE 174
            H+  I  L      +   + S D    +WDL     +  L +HK    G W    CQ +
Sbjct: 461 AHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHK---RGLWDVSFCQFD 517

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQVKLWKLN 232
             + + S D  IK+W L T   I+T   HT      S   K + L++TG D  +K+W ++
Sbjct: 518 KIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDIS 577

 Score = 36.2 bits (82), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 37/67 (55%), Gaps = 6/67 (8%)

Query: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLT-----SDGKRLVTGSADKTVK 498
           L+  G  NG ++++DL     + T+++ H + +  +D+      +D  +LVTG  D  V 
Sbjct: 130 LLCSGDTNGMVKIWDLVKRKCIHTVQE-HTSPVRGVDIVESENDTDVLQLVTGGRDNIVN 188

Query: 499 FWDFQVE 505
           FW+F ++
Sbjct: 189 FWEFNLK 195

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 92/378 (24%), Positives = 161/378 (42%), Gaps = 54/378 (14%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS- 410
           +L L T++ ++    IP +    T+  PL     E  G    + S+D ++D   +ATAS 
Sbjct: 352 KLALATNSPSLRIIPIP-DLAGTTASLPLDVEIYE--GHEDLLNSLDATEDGLWIATASK 408

Query: 411 NGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIED 470
           + S  +W  K ++  R FE    +  K++                               
Sbjct: 409 DNSAIVW--KYNENTRKFE----VYSKYI------------------------------- 431

Query: 471 AHDAAIWSLDLTSDGKR-----LVTGSADKTVKFWDFQVENTLVPGTKDKF-LPILKLNH 524
            H +A+ ++ L     +     L+T S D T+K W        +P     F +  +K++ 
Sbjct: 432 GHSSAVTAVGLPKIMPKGYPEFLLTASNDLTIKKWK-------IPKPTFPFDVQTIKVSE 484

Query: 525 DTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFD 584
            T      DI +L ISP+D   A +  D T K++ L++ +   +L  HK  +  +     
Sbjct: 485 YTRHAHEKDINALSISPNDSIFATASYDKTCKIWNLENGELEATLSNHKRGLWDVTFCQY 544

Query: 585 SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDG 644
            K++ T S DK +KIW LD     K+L  H +++    F+ +     SC  D ++K WD 
Sbjct: 545 DKLLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDC 604

Query: 645 EKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQ 704
              EC++ L  H + +WAL    DG  +VS+  D   + W++  +Q             +
Sbjct: 605 SSGECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFWKDCTEQEKEEEQEKAKLQVE 664

Query: 705 YEDTLLTSLEEGNGDDAF 722
            E +L   + +G+  +AF
Sbjct: 665 QEQSLQNYISQGDWTNAF 682

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 71/162 (43%), Gaps = 9/162 (5%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAA---ITLLQFDG 131
           R A   +   L +  +  + A    D   K+W+L +  +    + HK     +T  Q+D 
Sbjct: 487 RHAHEKDINALSISPNDSIFATASYDKTCKIWNLENGELEATLSNHKRGLWDVTFCQYDK 546

Query: 132 TGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWD 190
               L + S D  + +W L     +  L  H +++    +   +  L+S   DG+IK+WD
Sbjct: 547 L---LATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWD 603

Query: 191 LKTQQCIETHIAHTGECWGLSVKD--DLLITTGTDSQVKLWK 230
             + +C++T   H    W L+  +  D++++   D   + WK
Sbjct: 604 CSSGECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFWK 645

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 81/177 (45%), Gaps = 19/177 (10%)

Query: 74  ARGAKPAECTY-LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGT 132
            R  K +  +Y L+    + LLAVG  DG I V D+ +  +  +F GH   I+ L+F G 
Sbjct: 96  VRSMKISSPSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQ 155

Query: 133 GTR----LISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF---WCQGEDW----LISTS 181
                  L SG  +  + VWDLV    L+ L+ H  ++ G      Q  D     L+S  
Sbjct: 156 LDSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGG 215

Query: 182 KDGMIKLWDL---KTQQCIETHIAH--TGECWGLSVKDD--LLITTGTDSQVKLWKL 231
           +D +I +WD    KT + I+T   +     C  L   DD  L+ T G D+  +L  L
Sbjct: 216 RDDIINIWDFNMKKTCKLIKTLPVNQQVESCGFLRYHDDKHLIYTAGGDAIFQLIDL 272

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 83/188 (44%), Gaps = 18/188 (9%)

Query: 508 LVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
           L PG+++       + H  + E   +I +L+++PD +YL        +K+F L + K   
Sbjct: 45  LTPGSRN-------IIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVR 97

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           S+     P   +D    S ++     D +I +  ++ G    S   H  +I S+KF  + 
Sbjct: 98  SMKISS-PSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQL 156

Query: 628 HN----FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI----STDGSF--VVSSSH 677
            +      S   + +VK WD  K +C+  L  H S V  L I    ++D  F  ++S   
Sbjct: 157 DSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGR 216

Query: 678 DHSIRIWE 685
           D  I IW+
Sbjct: 217 DDIINIWD 224

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 59/141 (41%), Gaps = 15/141 (10%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAE-CTYLEVHQDTDLLAVGYADGVIKVWDLM 109
           +W+++ G+L +TLS+         RG      C Y        LLA    D  +K+W L 
Sbjct: 517 IWNLENGELEATLSN-------HKRGLWDVTFCQY------DKLLATCSGDKTVKIWSLD 563

Query: 110 SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF 169
           + +V+    GH  A+    F     +L+S   D  I +WD      L  L  H + +   
Sbjct: 564 TFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWAL 623

Query: 170 WCQGE-DWLISTSKDGMIKLW 189
               + D ++S   DG+ + W
Sbjct: 624 NTMNDGDIIVSADADGVFQFW 644

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 7/70 (10%)

Query: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLT----SDGK--RLVTGSADKTV 497
           L+  G  NG ++++DL     L T+++ H +A+  LD+     SD    +L++G  D  +
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLHTLQE-HSSAVRGLDIVEVQNSDEPFLKLLSGGRDDII 220

Query: 498 KFWDFQVENT 507
             WDF ++ T
Sbjct: 221 NIWDFNMKKT 230

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 70/169 (41%), Gaps = 29/169 (17%)

Query: 102 VIKVWDLMSKTVLLN-----FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGL 156
           +I + DL   T  L      + GH+  +  L     G  + + SKD++ IVW        
Sbjct: 364 IIPIPDLAGTTASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNENTRK 423

Query: 157 YKLRS----HKDSITGFWCQG------EDWLISTSKDGMIKLW---------DLKTQQCI 197
           +++ S    H  ++T             ++L++ S D  IK W         D++T +  
Sbjct: 424 FEVYSKYIGHSSAVTAVGLPKIMPKGYPEFLLTASNDLTIKKWKIPKPTFPFDVQTIKVS 483

Query: 198 E-THIAHTGECWGLSV--KDDLLITTGTDSQVKLWKLNIENDKLGGKLT 243
           E T  AH  +   LS+   D +  T   D   K+W  N+EN +L   L+
Sbjct: 484 EYTRHAHEKDINALSISPNDSIFATASYDKTCKIW--NLENGELEATLS 530

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 115/237 (48%), Gaps = 9/237 (3%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKD--KFLPILKLNHDTTLELNDDILSLRISPDDRY 545
           L++ S D T+K W        VP  +D    + ++K +  T      DI +L +SP+D  
Sbjct: 486 LLSASNDLTIKKW-------AVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSV 538

Query: 546 LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            A +  D T K++ LD+ +   +L  HK  +  ++     K++ T S DK +KIW LD  
Sbjct: 539 FATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTY 598

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
              K+L  H +++    F+ ++    S   D +VK WD    EC++ L AH + +WAL++
Sbjct: 599 SVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSV 658

Query: 666 STDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
             DG  +V++  D   + W++   +             ++E +L   L +G+  +AF
Sbjct: 659 LKDGDIIVTADADGVFQFWKDCSKEEEERNLEKEKEKVEHEQSLQNYLSQGDWANAF 715

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 72/160 (45%), Gaps = 5/160 (3%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGT 134
           R A   +   L V  +  + A    D   K+W L +  +      HK  +  + F     
Sbjct: 520 RRAHEKDINALAVSPNDSVFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDK 579

Query: 135 RLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLK 192
            L + S D  + +W L     +  L  H +++    F  + +  L+S+  DG++KLWD  
Sbjct: 580 LLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQ-LVSSGADGLVKLWDCS 638

Query: 193 TQQCIETHIAHTGECWGLSV-KD-DLLITTGTDSQVKLWK 230
           T +C++T  AH    W LSV KD D+++T   D   + WK
Sbjct: 639 TGECVKTLDAHNNRIWALSVLKDGDIIVTADADGVFQFWK 678

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 84/172 (48%), Gaps = 8/172 (4%)

Query: 334 SLYKIKSASWTTITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIE--LQGQR 391
           +++ +K++ +T     K    L  S N   + +  Y+K        L T  +E  L   +
Sbjct: 509 TVHVVKASEYTRRAHEKDINALAVSPNDSVFATASYDK--TCKIWSLDTGELEATLANHK 566

Query: 392 TDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILG 448
             +  ++    ++LLAT S + ++KIW++ T+  ++T E        C F+     ++  
Sbjct: 567 RGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSS 626

Query: 449 TRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
             +G ++L+D ++   + T+ DAH+  IW+L +  DG  +VT  AD   +FW
Sbjct: 627 GADGLVKLWDCSTGECVKTL-DAHNNRIWALSVLKDGDIIVTADADGVFQFW 677

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 64/138 (46%), Gaps = 11/138 (7%)

Query: 69  PGASDARGAKPAECTY-LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLL 127
           P     R  K +   Y +E    + LLA+G  DG + + D+ +  V  +F GH   I+ +
Sbjct: 110 PSKKIVRSMKVSSPVYVMECDVTSTLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSV 169

Query: 128 QFDGTGT----RLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITG--FWCQGED----WL 177
           +F G       RL SG     + +WDLV    L+ ++ H  ++ G  F    ED     L
Sbjct: 170 KFHGELNSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQL 229

Query: 178 ISTSKDGMIKLWDLKTQQ 195
           IS  +D +I L+   +++
Sbjct: 230 ISGGRDNIINLYQFDSRK 247

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 70/168 (41%), Gaps = 24/168 (14%)

Query: 531 NDD---ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           NDD   I +LRI+PD ++L        ++V+ L S K   S+     PV  ++    S +
Sbjct: 77  NDDEQEITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKVSS-PVYVMECDVTSTL 135

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVVKYWD 643
           +     D ++ I  ++ G    S   H  +I SVKF  E ++      S     VVK WD
Sbjct: 136 LAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWD 195

Query: 644 GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691
             K +C+  +  H   V  L                  R+ +E EDQ+
Sbjct: 196 LVKRKCLHTVQEHTMAVRGL----------------DFRVLDEDEDQM 227

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 75/164 (45%), Gaps = 13/164 (7%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140
           E T L +  D   L       +++V+ L SK ++ +     + + +++ D T T L  G 
Sbjct: 82  EITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKV-SSPVYVMECDVTSTLLAIGG 140

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGE----DW-LISTSKDGMIKLWDLKTQQ 195
            D ++ + D+      +  + H  +I+     GE     W L S    G++K+WDL  ++
Sbjct: 141 TDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGELNSNVWRLASGDTTGVVKIWDLVKRK 200

Query: 196 CIETHIAHTGECWGLSVK------DDL-LITTGTDSQVKLWKLN 232
           C+ T   HT    GL  +      D + LI+ G D+ + L++ +
Sbjct: 201 CLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRDNIINLYQFD 244

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 59/141 (41%), Gaps = 15/141 (10%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAE-CTYLEVHQDTDLLAVGYADGVIKVWDLM 109
           +W + TG+L +TL       A+  RG      C Y        LLA    D  +K+W L 
Sbjct: 550 IWSLDTGELEATL-------ANHKRGLWDVNFCQY------DKLLATCSGDKTVKIWSLD 596

Query: 110 SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF 169
           + +V+    GH  A+    F     +L+S   D  + +WD      +  L +H + I   
Sbjct: 597 TYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWAL 656

Query: 170 WC-QGEDWLISTSKDGMIKLW 189
              +  D +++   DG+ + W
Sbjct: 657 SVLKDGDIIVTADADGVFQFW 677

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 64/171 (37%), Gaps = 23/171 (13%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLN----FNGHKAAITLLQFDGTGTR----- 135
           L+  +D   LA    D  + +W    +T L      F GH   +T +       R     
Sbjct: 426 LDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVGLPNVMNRPWPEF 485

Query: 136 LISGSKDSNIIVWDL-----------VGEVGLYKLRSHKDSITGFWCQGEDWLIST-SKD 183
           L+S S D  I  W +           V +   Y  R+H+  I        D + +T S D
Sbjct: 486 LLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFATASYD 545

Query: 184 GMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQVKLWKLN 232
              K+W L T +   T   H    W ++    D LL T   D  VK+W L+
Sbjct: 546 KTCKIWSLDTGELEATLANHKRGLWDVNFCQYDKLLATCSGDKTVKIWSLD 596

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 91/203 (44%), Gaps = 29/203 (14%)

Query: 309 TDEEI-TKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNNTIEYYSI 367
           TD  I T  ++ SYSSL L PF          +   T + +S L+ +     N ++    
Sbjct: 14  TDRRILTMDLRTSYSSLSLSPFYAGSGAVASVTEDGTLLATSVLDRI-----NIVQL--- 65

Query: 368 PYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGS-LKIWNVKTHKCIR 426
                  +SP  +  H IE   ++ ++ ++ I+ D + L   S    L+++++ + K +R
Sbjct: 66  -------SSPRQV-VHIIENDDEQ-EITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVR 116

Query: 427 TFECG---YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSL---- 479
           + +     Y + C  +   LL I GT +G + + D+ +  +  + +  H   I S+    
Sbjct: 117 SMKVSSPVYVMECD-VTSTLLAIGGT-DGSVSIIDIENGYVTHSFK-GHGGTISSVKFHG 173

Query: 480 DLTSDGKRLVTGSADKTVKFWDF 502
           +L S+  RL +G     VK WD 
Sbjct: 174 ELNSNVWRLASGDTTGVVKIWDL 196

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 58/135 (42%), Gaps = 22/135 (16%)

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLD----FGDCHKSLFAHQDSIMSVKFLPE 626
           GH+  + S+D + D   + T+S D  + +W  D        +     H   + +V  LP 
Sbjct: 418 GHEDLLNSLDATEDGMWLATASKDNFVILWRYDEQTELFKQYAKFVGHAGPVTAVG-LPN 476

Query: 627 SHN------FFSCSKDAVVKYW------DGEKFECIQKL-----YAHQSEVWALAISTDG 669
             N        S S D  +K W      DG+    + K       AH+ ++ ALA+S + 
Sbjct: 477 VMNRPWPEFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPND 536

Query: 670 SFVVSSSHDHSIRIW 684
           S   ++S+D + +IW
Sbjct: 537 SVFATASYDKTCKIW 551

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 52/253 (20%), Positives = 101/253 (39%), Gaps = 63/253 (24%)

Query: 352 ELVLTTSNN-TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS 410
           E +L+ SN+ TI+ +++P  +    +   +K      +    D+ ++ +S ++ + ATAS
Sbjct: 484 EFLLSASNDLTIKKWAVPKPEDGKDTVHVVKASEYTRRAHEKDINALAVSPNDSVFATAS 543

Query: 411 -NGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIE 469
            + + KIW++ T                              GEL+      ++L +   
Sbjct: 544 YDKTCKIWSLDT------------------------------GELE------ATLAN--- 564

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLE 529
             H   +W ++     K L T S DKTVK W     + +                  TLE
Sbjct: 565 --HKRGLWDVNFCQYDKLLATCSGDKTVKIWSLDTYSVM-----------------KTLE 605

Query: 530 LNDDILSLRIS--PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
            + + +  R S    ++ L  S  D  VK++   + +   +L  H   + ++ +  D  +
Sbjct: 606 GHTNAVQ-RCSFISKNKQLVSSGADGLVKLWDCSTGECVKTLDAHNNRIWALSVLKDGDI 664

Query: 588 IITSSADKNIKIW 600
           I+T+ AD   + W
Sbjct: 665 IVTADADGVFQFW 677

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score =  103 bits (258), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 110/235 (46%), Gaps = 2/235 (0%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLA 547
           ++T S D TVK W  +V +       D  + ++K++  T      DI +L I+P+D   A
Sbjct: 396 IITSSNDFTVKKW--KVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFA 453

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ LDS +   +L  HK  +  +      K I T+S DK IKIW L+    
Sbjct: 454 TASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKV 513

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
             +L  H +++    F+ +     S   D ++K WD    EC++ L  H + +WAL +  
Sbjct: 514 VNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVLR 573

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG  ++++  D   + W++  ++V            + E +L   +  G   +AF
Sbjct: 574 DGDMIITADADGVFQFWKDCTEEVKEQDLEKEKLRVEQEQSLRNFIANGEWTNAF 628

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 125/592 (21%), Positives = 230/592 (38%), Gaps = 97/592 (16%)

Query: 157 YKLRSHKDSITG--FWCQGED--WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV 212
           + L+ H  +I+   F+ + ED  WL+++    M+K+WDL  ++CI T   H+    G+  
Sbjct: 83  HSLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDF 142

Query: 213 KD-----DL--LITTGTDSQVKLWKLN-IENDKLGGKLTEMGTFEKQSKQRGLKIEFITN 264
           K      D+  L+T G D+ +  W ++ ++N KL      + TF    +       FI +
Sbjct: 143 KQSSTDSDIIHLVTGGRDNIINHWTISGLKNFKL------IRTFPVHQQVEACG--FIKS 194

Query: 265 TSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXTDEEITK---SIKDSY 321
           T D N   Y    D                                +  TK    + D  
Sbjct: 195 TEDDNCI-YTAGGDAVFQILSLSNGSVIKKTKKPTEELFIIGVLPIKNFTKLYLVLSDQT 253

Query: 322 SSLI--LHPFQTVRSLYKIKSA---SWTTITSSKL------ELVLTTSNNTIEYYSIPYE 370
             LI  +  F+    +  IKS+   +  TI   +L       + L T++ T+    +  E
Sbjct: 254 LQLIDLIDTFEEDSEIITIKSSIAGNHGTIADMRLVGPELKSIALATNSPTLRIIPVISE 313

Query: 371 KREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNV-----KTHKC 424
             +   P  ++ +     G    + S+D ++D   +ATAS + +  +W       K  K 
Sbjct: 314 DNKNNIPLGVELY----DGHEDLLNSLDATEDGLWIATASKDNTAMLWRFNDSENKFKKY 369

Query: 425 IRTFECGYALTCKFLPGGL------LVILGTRNGELQLFDLASSSLLDTIED-------- 470
            +      ++T   LP  +       +I  + +  ++ + + S +     +D        
Sbjct: 370 AQFIGHASSVTSVSLPNVINNGWPEFIITSSNDFTVKKWKVPSPTKKSDNDDDMHLIKVS 429

Query: 471 -----AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHD 525
                AH+  I +L +  +     T S DKT K WD             + +  L  NH 
Sbjct: 430 EYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWDLD---------SGELMATLA-NHK 479

Query: 526 TTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
             L        +     D+Y+A +  D T+K++ L++ K   +L GH   V         
Sbjct: 480 RGL------WDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQ 533

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGE 645
           K I+++ AD  IKIW    G+C K+L  H + I ++  L +     +   D V ++W   
Sbjct: 534 KQIVSTGADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWK-- 591

Query: 646 KFECIQKLYAHQSEVWALAISTDGS-------------FVVSSSHDHSIRIW 684
             +C +++     E   L +  + S             F+++ + DH +R++
Sbjct: 592 --DCTEEVKEQDLEKEKLRVEQEQSLRNFIANGEWTNAFLLAMTLDHPMRLY 641

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 112/281 (39%), Gaps = 13/281 (4%)

Query: 4   SYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALE-NVNVWDIKTGDLMST 62
           S  +F++ A F   AS+   V LP      +   P  +ITS+ +  V  W + +    S 
Sbjct: 362 SENKFKKYAQFIGHASSVTSVSLP---NVINNGWPEFIITSSNDFTVKKWKVPSPTKKSD 418

Query: 63  LSDG--LPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120
             D   L   +   R A   +   L +  +  + A    D   K+WDL S  ++     H
Sbjct: 419 NDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATLANH 478

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLIS 179
           K  +  + F      + + S D  I +W L     +  L  H +++    +   +  ++S
Sbjct: 479 KRGLWDVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVS 538

Query: 180 TSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQVKLWKLNIENDK 237
           T  DG+IK+WD  + +C++T   H    W L V    D++IT   D   + WK   E  K
Sbjct: 539 TGADGLIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWKDCTEEVK 598

Query: 238 LGGKLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNAD 278
                 E    E++   R     FI N    N+F      D
Sbjct: 599 EQDLEKEKLRVEQEQSLRN----FIANGEWTNAFLLAMTLD 635

 Score = 35.8 bits (81), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 74/358 (20%), Positives = 145/358 (40%), Gaps = 81/358 (22%)

Query: 387 LQGQRTDMRSIDI---SDDNRLLATASNGSLKIWN------VKTHKCIRTFE-------C 430
           LQ   + +R ID    S D+ ++   + G   I N      +K  K IRTF        C
Sbjct: 130 LQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIINHWTISGLKNFKLIRTFPVHQQVEAC 189

Query: 431 GYALT-----CKFLPGGLLVILGTRNGELQLFDLASSSLLD-TIEDAHDAAIWSLDLTSD 484
           G+  +     C +  GG        +   Q+  L++ S++  T +   +  I  +    +
Sbjct: 190 GFIKSTEDDNCIYTAGG--------DAVFQILSLSNGSVIKKTKKPTEELFIIGVLPIKN 241

Query: 485 GKRLVTGSADKTVKFWD----FQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540
             +L    +D+T++  D    F+ ++ ++          +  NH T  ++        + 
Sbjct: 242 FTKLYLVLSDQTLQLIDLIDTFEEDSEII-----TIKSSIAGNHGTIADMR------LVG 290

Query: 541 PDDRYLAISLLDNTVKVFFL------DSMKFYLSLY-GHKLPVLSIDISFDSKMIITSSA 593
           P+ + +A++    T+++  +      +++   + LY GH+  + S+D + D   I T+S 
Sbjct: 291 PELKSIALATNSPTLRIIPVISEDNKNNIPLGVELYDGHEDLLNSLDATEDGLWIATASK 350

Query: 594 DKNIKIWGLDFGDC------HKSLFAHQDSIMSVKFLPESHN------FFSCSKDAVVKY 641
           D    +W   F D       +     H  S+ SV  LP   N        + S D  VK 
Sbjct: 351 DNTAMLWR--FNDSENKFKKYAQFIGHASSVTSVS-LPNVINNGWPEFIITSSNDFTVKK 407

Query: 642 W----------DGEKFECIQ----KLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           W          + +    I+       AH+ ++ AL+I+ + S   ++S+D + +IW+
Sbjct: 408 WKVPSPTKKSDNDDDMHLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWD 465

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (45%), Gaps = 17/148 (11%)

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTG--TRLISGSKDSNII-VWDLVGEVGLY 157
           G + V D+    +  +  GH A I+ L+F G    +  +  S D+N++ VWDLV    ++
Sbjct: 70  GPVSVLDI-ENYITHSLKGHGATISSLKFYGESEDSVWLLASGDTNMVKVWDLVKRKCIH 128

Query: 158 KLRSHKDSITG--FWCQGED----WLISTSKDGMIKLW---DLKTQQCIETHIAHTG-EC 207
            L+ H  ++ G  F     D     L++  +D +I  W    LK  + I T   H   E 
Sbjct: 129 TLQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIINHWTISGLKNFKLIRTFPVHQQVEA 188

Query: 208 WGL--SVKDDLLI-TTGTDSQVKLWKLN 232
            G   S +DD  I T G D+  ++  L+
Sbjct: 189 CGFIKSTEDDNCIYTAGGDAVFQILSLS 216

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 55/123 (44%), Gaps = 7/123 (5%)

Query: 36  SGPGQLITSALENVNVWDIKTGDLMSTLS-DGLPPGASDARGAKPAECTYLEVHQDTDLL 94
           +G G L+T+ +EN +  D   G  +S L  +     +    GA  +   +    +D+  L
Sbjct: 49  AGNGTLLTT-VENDDEQDXXXGGPVSVLDIENYITHSLKGHGATISSLKFYGESEDSVWL 107

Query: 95  AVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGT-----RLISGSKDSNIIVWD 149
                  ++KVWDL+ +  +     H +A+  + F  + T      L++G +D+ I  W 
Sbjct: 108 LASGDTNMVKVWDLVKRKCIHTLQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIINHWT 167

Query: 150 LVG 152
           + G
Sbjct: 168 ISG 170

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 112/235 (47%), Gaps = 5/235 (2%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLA 547
           ++T S D T+K W         P + D  +  +K++  T      DI +L ISP+D   A
Sbjct: 466 IITASNDLTIKKWSVPK-----PTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFA 520

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ +DS +   +L  HK  +  +      K++ T S DK IK+W L+    
Sbjct: 521 TASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSV 580

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
            K+L  H +++    F+  +    S   D ++K WD    ECI+ L AH + +WAL++ +
Sbjct: 581 VKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLS 640

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG   V++  D   + W++  ++             + E +L   + +G+  +AF
Sbjct: 641 DGKEFVTADADGVFQFWKDCSEEEQKENLENQKLMVEQEQSLQNYMAQGDWTNAF 695

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 76/178 (42%), Gaps = 17/178 (9%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAA---ITLLQFDG 131
           R A   +   L +  +  + A    D   K+W++ S  +      HK     +T  Q+D 
Sbjct: 500 RRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDK 559

Query: 132 TGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWD 190
               L + S D  I VW L     +  L  H +++    +      ++ST  DG+IK+WD
Sbjct: 560 L---LATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWD 616

Query: 191 LKTQQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLW--------KLNIENDKL 238
           L T +CI T  AH+   W LSV  D    +T   D   + W        K N+EN KL
Sbjct: 617 LSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWKDCSEEEQKENLENQKL 674

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 58/101 (57%), Gaps = 4/101 (3%)

Query: 403 NRLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRNGELQLFDL 459
           ++LLAT S + ++K+W++++   ++T E        C F+     ++    +G ++++DL
Sbjct: 558 DKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDL 617

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
           ++   + T+ DAH   IW+L + SDGK  VT  AD   +FW
Sbjct: 618 STGECIRTL-DAHSNRIWALSVLSDGKEFVTADADGVFQFW 657

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 106/251 (42%), Gaps = 33/251 (13%)

Query: 41  LITSALENVNVWDIK-TGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYA 99
           L TS ++ VN+ ++  T  L+ T+ +               E T L++  + + L     
Sbjct: 32  LATSVVDEVNIMELSPTKRLIHTIEND-----------DEQEITALKLTPNGEYLCFVSQ 80

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
             +++++ L SK ++ +     + + ++  D + T +  G  D ++ V D+      +  
Sbjct: 81  AQLLRIYKLSSKKIIRSMKV-SSPVYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSF 139

Query: 160 RSHKDSITGFWCQGED----W-LISTSKDGMIKLWDLKTQQCIETHIAHTGECWG----L 210
           + H  +I+     GE     W L S    GM+K+WDL  + CI T   H     G    L
Sbjct: 140 KGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGLDFRL 199

Query: 211 SVKDD---LLITTGTDSQVKLWKLNIENDKLGGKLTEMGTFEKQSKQRGLKIEFITNTSD 267
           S  DD    L+T G D  V L++LN        KL       +Q +  G    FI ++ D
Sbjct: 200 SPADDGVLELLTGGRDDIVNLFQLNSTKK---AKLMRTIPVHQQIEACG----FIRDSPD 252

Query: 268 GNSFFYIQNAD 278
           G S FY    D
Sbjct: 253 G-SLFYTAGGD 262

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 62/150 (41%), Gaps = 5/150 (3%)

Query: 518 PILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL 577
           P  +L H    +   +I +L+++P+  YL        ++++ L S K   S+     PV 
Sbjct: 47  PTKRLIHTIENDDEQEITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKVSS-PVY 105

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESH----NFFSC 633
            +D    S ++     D ++ +  ++ G    S   H  +I SVKF  E         S 
Sbjct: 106 VMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASG 165

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWAL 663
               +VK WD  +  CI  +  H + V  L
Sbjct: 166 DTSGMVKVWDLVRRNCIHTIQEHAAAVRGL 195

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 100/253 (39%), Gaps = 63/253 (24%)

Query: 352 ELVLTTSNN-TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS 410
           E ++T SN+ TI+ +S+P           +K      +    D+ ++ IS ++ + ATAS
Sbjct: 464 EFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATAS 523

Query: 411 -NGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIE 469
            + + KIWNV +                              GEL+           T+ 
Sbjct: 524 YDKTCKIWNVDS------------------------------GELE----------GTLA 543

Query: 470 DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLE 529
           + H   +W +      K L T S DKT+K W  +             + ++K     TLE
Sbjct: 544 N-HKRGLWDVTFCQYDKLLATCSGDKTIKVWSLES------------MSVVK-----TLE 585

Query: 530 LNDDILSLRISPDDRYLAI--SLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
            + + +  R S  +R   I  +  D  +KV+ L + +   +L  H   + ++ +  D K 
Sbjct: 586 GHTNAVQ-RCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKE 644

Query: 588 IITSSADKNIKIW 600
            +T+ AD   + W
Sbjct: 645 FVTADADGVFQFW 657

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 73/180 (40%), Gaps = 24/180 (13%)

Query: 528 LELNDDILSLRISPDDRYLAISLLDN-TVKVFFLDSMKFYLSLY-GHKLPVLSIDISFDS 585
           L  N   L +  +P  ++ A    D  T KV   + +   + LY GH   + S+D S + 
Sbjct: 353 LATNSPALRVITAPVTKHNAAEKEDEPTSKVDIQNCLPLEVELYEGHTDLLNSLDSSENG 412

Query: 586 KMIITSSADKNIKIWGLDFGDCHK-----SLFAHQDSIMSVKFLPESHN-----FFSCSK 635
           + + T S D  + +W L+  D  K         H   + +V       N       + S 
Sbjct: 413 EWLATCSKDHTVILWKLN-ADSEKFKPYARFTGHAGPVTAVGLPNVMRNTWPEFIITASN 471

Query: 636 DAVVKYWDGEK-------FECIQ----KLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           D  +K W   K          I+       AH+ ++ AL+IS + S   ++S+D + +IW
Sbjct: 472 DLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIW 531

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 98/203 (48%), Gaps = 5/203 (2%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLA 547
           L+T S D T+K W     N   P  K + + ++K +  T      DI +L +SP+D   A
Sbjct: 488 LLTASNDLTIKKW-----NIPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFA 542

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ L++ +   +L  HK  +  +      K++ T S DK IKIW LD    
Sbjct: 543 TASYDKTSKIWDLETGELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSV 602

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
            ++L  H +++    F+ +     S   D ++K WD    EC++ L  H + +WAL I  
Sbjct: 603 VRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTIQR 662

Query: 668 DGSFVVSSSHDHSIRIWEETEDQ 690
           DG  + S+  D   + W +  +Q
Sbjct: 663 DGELIASADADGVFQFWTDCSEQ 685

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 97/228 (42%), Gaps = 10/228 (4%)

Query: 7   RFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALE-NVNVWDI-KTGDLMSTLS 64
           +F+  A F   +S+   V LP          P  L+T++ +  +  W+I K  D M  + 
Sbjct: 457 KFKPYAKFIGHSSSVTAVGLP---NVMLRHWPEFLLTASNDLTIKKWNIPKPSDKMEGIH 513

Query: 65  DGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAI 124
             L  G+   R A   +   L V  +  + A    D   K+WDL +  +      HK  +
Sbjct: 514 --LIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELTATLANHKRGL 571

Query: 125 TLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSIT-GFWCQGEDWLISTSKD 183
             + F      L + S D  I +W L     +  L  H +++    +   +  L+S+  D
Sbjct: 572 WDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGAD 631

Query: 184 GMIKLWDLKTQQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLW 229
           G+IK+WD  + +C++T   H    W L+++ D  L+ +   D   + W
Sbjct: 632 GLIKIWDCSSGECVKTLDGHANRIWALTIQRDGELIASADADGVFQFW 679

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 67/148 (45%), Gaps = 16/148 (10%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGA-KPAECTYLEVHQDTDLLAVGYADGVIKVWDLM 109
           +WD++TG+L +TL       A+  RG    + C Y        LLA    D  IK+W L 
Sbjct: 552 IWDLETGELTATL-------ANHKRGLWDVSFCQY------DKLLATCSGDKTIKIWSLD 598

Query: 110 SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF 169
           + +V+    GH  A+    F    T+L+S   D  I +WD      +  L  H + I   
Sbjct: 599 TFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWAL 658

Query: 170 WCQGEDWLISTS-KDGMIKLW-DLKTQQ 195
             Q +  LI+++  DG+ + W D   QQ
Sbjct: 659 TIQRDGELIASADADGVFQFWTDCSEQQ 686

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 79/179 (44%), Gaps = 4/179 (2%)

Query: 325 ILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHT 384
           I  P   +  ++ IK + +T     K    L+ S N   + +  Y+K            T
Sbjct: 502 IPKPSDKMEGIHLIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELT 561

Query: 385 IELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPG 441
             L   +  +  +     ++LLAT S + ++KIW++ T   +RT E        C F+  
Sbjct: 562 ATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINK 621

Query: 442 GLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
              ++    +G ++++D +S   + T+ D H   IW+L +  DG+ + +  AD   +FW
Sbjct: 622 QTQLVSSGADGLIKIWDCSSGECVKTL-DGHANRIWALTIQRDGELIASADADGVFQFW 679

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 87/191 (45%), Gaps = 18/191 (9%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140
           E T L++  D   L       ++K+ ++ +  V+ +      +  ++  + T T +  G 
Sbjct: 92  EITALKLTADGKYLCFTSQAQLLKIVEVATGKVMRSMKISSPSY-IMDSEATSTLVAVGG 150

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGED----WLISTS-KDGMIKLWDLKTQQ 195
            D +IIV D+      +  + H  +I+     GE     WL+++   +GMIK+W+L T++
Sbjct: 151 TDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASGDTNGMIKVWNLVTRK 210

Query: 196 CIETHIAHTGECWGL---SVKDDL------LITTGTDSQVKLWKLNIENDKLGGKLTEMG 246
           C  T   HT    G+   S+ DD       +I+ G D  V  W+L   ++K   KL +  
Sbjct: 211 CTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWEL---DNKKKCKLLQTI 267

Query: 247 TFEKQSKQRGL 257
              +Q +Q G 
Sbjct: 268 PAHQQVEQCGF 278

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 114/235 (48%), Gaps = 5/235 (2%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLA 547
           ++T S D T+K W         PG +     ++K++  T    + DI +L ISP+D   A
Sbjct: 469 IITASNDLTIKKWTVPK-----PGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFA 523

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T KV+ +DS +   +L  HK  +  +      K++ T S DK +K+W LD    
Sbjct: 524 TASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSV 583

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
            K+L  H +++    F+ ++    S   D ++K WD    EC++ L AH++ +WAL++  
Sbjct: 584 VKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSVLH 643

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG   V++  D   + W++  ++             + + +L   + +G+  +AF
Sbjct: 644 DGDEFVTADADGVFQFWKDCSEEQEKENLENHKRKVEQDQSLQNYMSQGDWTNAF 698

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 105/232 (45%), Gaps = 25/232 (10%)

Query: 466 DTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHD 525
           D    AHD  I +L ++ +     T S DKT K WD  V++  + GT          NH 
Sbjct: 500 DYTRRAHDKDINALSISPNDSTFATASYDKTCKVWD--VDSGELQGT--------LANHK 549

Query: 526 TTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
             L        +     D+ LA    D TVKV+ LD++    +L GH   V        +
Sbjct: 550 RGL------WDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKN 603

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW-DG 644
           K ++++ AD  IK+W L  G+C ++L AH++ I ++  L +   F +   D V ++W D 
Sbjct: 604 KQLVSTGADGLIKLWDLSTGECVRTLDAHENRIWALSVLHDGDEFVTADADGVFQFWKDC 663

Query: 645 EKFECIQKLYAHQSEV--------WALAISTDGSFVVSSSHDHSIRIWEETE 688
            + +  + L  H+ +V        +        +F+++ + DH +R++   E
Sbjct: 664 SEEQEKENLENHKRKVEQDQSLQNYMSQGDWTNAFLLAMTLDHPMRLYRVLE 715

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 94/230 (40%), Gaps = 10/230 (4%)

Query: 6   QRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALE-NVNVWDI-KTGDLMSTL 63
           ++F+  A F   A     V LP   R+   + P  +IT++ +  +  W + K G    T 
Sbjct: 437 EKFKAYAKFTGHAGPVTAVGLPNVMRS---AWPEFIITASNDLTIKKWTVPKPG--HETA 491

Query: 64  SDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAA 123
              +   +   R A   +   L +  +    A    D   KVWD+ S  +      HK  
Sbjct: 492 EPHVVKVSDYTRRAHDKDINALSISPNDSTFATASYDKTCKVWDVDSGELQGTLANHKRG 551

Query: 124 ITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSK 182
           +  + F      L + S D  + VW L     +  L  H +++    +      L+ST  
Sbjct: 552 LWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGA 611

Query: 183 DGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQVKLWK 230
           DG+IKLWDL T +C+ T  AH    W LSV    D  +T   D   + WK
Sbjct: 612 DGLIKLWDLSTGECVRTLDAHENRIWALSVLHDGDEFVTADADGVFQFWK 661

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 80/195 (41%), Gaps = 47/195 (24%)

Query: 352 ELVLTTSNN-TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS 410
           E ++T SN+ TI+ +++P    E   P  +K      +    D+ ++ IS ++   ATAS
Sbjct: 467 EFIITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFATAS 526

Query: 411 -------------------------------------------NGSLKIWNVKTHKCIRT 427
                                                      + ++K+W++ T   ++T
Sbjct: 527 YDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKT 586

Query: 428 FE--CGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDG 485
            E        C F+     ++    +G ++L+DL++   + T+ DAH+  IW+L +  DG
Sbjct: 587 LEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTL-DAHENRIWALSVLHDG 645

Query: 486 KRLVTGSADKTVKFW 500
              VT  AD   +FW
Sbjct: 646 DEFVTADADGVFQFW 660

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 72/168 (42%), Gaps = 14/168 (8%)

Query: 531 NDD---ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           NDD   I +L+++PD  YL        ++++ L S +   S+     PV  ID    S +
Sbjct: 57  NDDEQEITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSS-PVYVIDCDPSSTL 115

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVVKYWD 643
           +     D ++ +  ++ G    SL  H  +I SVKF  E ++      S   + VVK WD
Sbjct: 116 VALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRLGSGDTNGVVKVWD 175

Query: 644 GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691
             +  C+  +  H + V  L       F VS + D  + +     D +
Sbjct: 176 LVRRSCLHTIQEHAAAVRGL------DFRVSDADDDVLELLSGGRDDI 217

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 70/162 (43%), Gaps = 29/162 (17%)

Query: 93  LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDG----TGTRLISGSKDSNIIVW 148
           L+A+G  DG + V D+ +  V  +  GH A I+ ++F G    T  RL SG  +  + VW
Sbjct: 115 LVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGELNSTTWRLGSGDTNGVVKVW 174

Query: 149 DLVGEVGLYKLRSHKDSITGFWCQGEDW------LISTSKDGMIKLWDLKT--------- 193
           DLV    L+ ++ H  ++ G   +  D       L+S  +D ++ L+ L +         
Sbjct: 175 DLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVNLYQLGSTKKVKLVKT 234

Query: 194 ----QQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKL 231
               QQ       H GE        DL  T G D+  ++  L
Sbjct: 235 IPVHQQIEACGFIHDGE------HQDLFYTAGGDAVYQILSL 270

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 70/163 (42%), Gaps = 21/163 (12%)

Query: 48  NVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYL-EVHQDTDLLAVGYADGVIKVW 106
           +V+V DI+ G +  +L            GA  +   +  E++  T  L  G  +GV+KVW
Sbjct: 124 SVSVIDIENGYVTHSLK---------GHGATISSVKFFGELNSTTWRLGSGDTNGVVKVW 174

Query: 107 DLMSKTVLLNFNGHKAAITLLQF-----DGTGTRLISGSKDSNIIVWDL--VGEVGLYKL 159
           DL+ ++ L     H AA+  L F     D     L+SG +D  + ++ L    +V L K 
Sbjct: 175 DLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVNLYQLGSTKKVKLVKT 234

Query: 160 RSHKDSI--TGFWCQGE--DWLISTSKDGMIKLWDLKTQQCIE 198
                 I   GF   GE  D   +   D + ++  L T   I+
Sbjct: 235 IPVHQQIEACGFIHDGEHQDLFYTAGGDAVYQILSLATASVIK 277

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 129/278 (46%), Gaps = 39/278 (14%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++DL+S  +L T++  H+  I+SLD    G +LV+G
Sbjct: 371 YIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 429

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +SP D +Y+A   
Sbjct: 430 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 472

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD TV+V      F ++ +     L  GHK  V S+  + D + +++ S D+++K+W L 
Sbjct: 473 LDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLR 532

Query: 603 ------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
                     C  +   H+D ++SV    +     S SKD  V +WD      +  L  H
Sbjct: 533 GLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGH 592

Query: 657 QSEVWALAI------STDGSFVVSSSHDHSIRIWEETE 688
           ++ V ++A+        D     + S D   RIW+ T+
Sbjct: 593 RNSVISVAVVNGFPLGPDIGVFATGSGDCKARIWKYTK 630

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 114/243 (46%), Gaps = 33/243 (13%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDF-------QVENTLVPGTKDKFLPILKLNH 524
           H + +  +  ++DG+ L TG  +KT + +         ++ +  V G  ++   ++  N 
Sbjct: 292 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGELVARLSDDSVSGINNESSSVVAGNG 350

Query: 525 DTTLELNDD--------------ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY 570
            T  E  D+              I S+  SPD +YLA    D  ++++ L S K  ++L 
Sbjct: 351 AT--EKGDESSATIQPGSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQ 408

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH+  + S+D       +++ S D+ ++IW L  G C  +L + +D + +V   P    +
Sbjct: 409 GHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKY 467

Query: 631 FSC-SKDAVVKYWDGEKFECIQKL-------YAHQSEVWALAISTDGSFVVSSSHDHSIR 682
            +  S D  V+ WD E    +++L         H+  V+++  + DG  VVS S D S++
Sbjct: 468 IAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVK 527

Query: 683 IWE 685
           +W+
Sbjct: 528 LWD 530

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 127/271 (46%), Gaps = 38/271 (14%)

Query: 394 MRSIDISDDNRLLATASNGSL-KIWNVKTHKCIRTFECG----YALTCKFLPGGLLVILG 448
           +RS+  S D + LAT +   L +IW++ + K + T +      Y+L   + P G  ++ G
Sbjct: 372 IRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSL--DYFPAGDKLVSG 429

Query: 449 TRNGELQLFDLASS--SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEN 506
           + +  ++++DL +   SL  +IED       S     DGK +  GS D+TV+ WD     
Sbjct: 430 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLDRTVRVWD----- 481

Query: 507 TLVPGTKDKFLPILKLNHDTTLELN--DDILSLRISPDDRYLAISLLDNTVKVFFLDSMK 564
                ++  FL + +L+ +  L     D + S+  + D R +    LD +VK++ L  + 
Sbjct: 482 -----SETGFL-VERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLN 535

Query: 565 FY-------LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDS 617
                    ++  GHK  VLS+  + D + I++ S D+ +  W    G+    L  H++S
Sbjct: 536 GQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNS 595

Query: 618 IMSVKFL------PESHNFFSCSKDAVVKYW 642
           ++SV  +      P+   F + S D   + W
Sbjct: 596 VISVAVVNGFPLGPDIGVFATGSGDCKARIW 626

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 99/226 (43%), Gaps = 37/226 (16%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASD-------ARGA-----------KPAEC 82
           L T   +   V+ + TG+L++ LSD    G ++         GA           +P   
Sbjct: 308 LATGCNKTTQVYKVSTGELVARLSDDSVSGINNESSSVVAGNGATEKGDESSATIQPGSS 367

Query: 83  TYLEVHQ-----DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLI 137
           + L +       D   LA G  D +I++WDL SK +L+   GH+  I  L +   G +L+
Sbjct: 368 SDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLV 427

Query: 138 SGSKDSNIIVWDL-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQ 194
           SGS D  + +WDL  G+  L    S +D +T       D  ++ + S D  +++WD +T 
Sbjct: 428 SGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 485

Query: 195 QCIET-------HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKL 231
             +E           H    + +   +D   + +G+ D  VKLW L
Sbjct: 486 FLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDL 531

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 109/232 (46%), Gaps = 26/232 (11%)

Query: 385 IELQGQRTDMRSID-ISDDNRLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL-PG- 441
           + LQG   D+ S+D     ++L++ + + +++IW+++T +C  T      +T   + PG 
Sbjct: 405 MTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 464

Query: 442 GLLVILGTRNGELQLFDLASSSLLDTIED------AHDAAIWSLDLTSDGKRLVTGSADK 495
           G  +  G+ +  ++++D  +  L++ ++        H  +++S+  T DG+ +V+GS D+
Sbjct: 465 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDR 524

Query: 496 TVKFWDFQVENTLVPGTKDKF-LPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNT 554
           +VK WD +  N    G K      +    H       D +LS+  + DD Y+     D  
Sbjct: 525 SVKLWDLRGLN----GQKSHATCEVTYTGH------KDFVLSVATTQDDEYILSGSKDRG 574

Query: 555 VKVFFLDSMKFYLSLYGHKLPVLSIDI------SFDSKMIITSSADKNIKIW 600
           V  +   S    L L GH+  V+S+ +        D  +  T S D   +IW
Sbjct: 575 VLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIW 626

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 101/248 (40%), Gaps = 49/248 (19%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + PA  +  SGSG           V +WD++TG    TLS  DG+   A       P + 
Sbjct: 419 YFPAGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGVTTVA-----VSPGDG 465

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
            Y+         A G  D  ++VWD  +  ++   +       GHK ++  + F   G  
Sbjct: 466 KYI---------AAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRS 516

Query: 136 LISGSKDSNIIVWDLVGEVGL-------YKLRSHKDSITGFWC-QGEDWLISTSKDGMIK 187
           ++SGS D ++ +WDL G  G             HKD +      Q +++++S SKD  + 
Sbjct: 517 VVSGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVL 576

Query: 188 LWDLKTQQCIETHIAHTGECWGLSV-------KDDLLITTGT-DSQVKLWKLN--IENDK 237
            WD  +   +     H      ++V        D  +  TG+ D + ++WK      +  
Sbjct: 577 FWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIWKYTKKTSSSS 636

Query: 238 LGGKLTEM 245
             GK+ E+
Sbjct: 637 TAGKVKEV 644

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 110/235 (46%), Gaps = 6/235 (2%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLA 547
           L+T S D T+K W       +   T    + I+K++  T      DI +L +SP+D   A
Sbjct: 455 LLTASNDLTIKKW------KIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFA 508

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ L++ +   +L  HK  +  +      K++ T S DK +KIW L+    
Sbjct: 509 TASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSV 568

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
            K+L  H +++    F+ +     SC  D ++K WD    EC++ L  H + +WAL    
Sbjct: 569 MKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNTMN 628

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG  +VS+  D   + W++  +Q             + E +L   + +G+  +AF
Sbjct: 629 DGDTIVSADADGIFQFWKDCTEQEKEEELEKTKIQVEQEQSLQNYMSQGDWTNAF 683

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 67/159 (42%), Gaps = 3/159 (1%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGT 134
           R A   +   L V  +  + A    D   K+W+L +  +      HK  +  + F     
Sbjct: 488 RHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDK 547

Query: 135 RLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKT 193
            L + S D  + +W L     +  L  H +++    +   +  L+S   DG+IK+WD  +
Sbjct: 548 LLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYS 607

Query: 194 QQCIETHIAHTGECWGLSVKD--DLLITTGTDSQVKLWK 230
            +C++T   H    W L+  +  D +++   D   + WK
Sbjct: 608 GECLKTLDGHNNRLWALNTMNDGDTIVSADADGIFQFWK 646

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 89/212 (41%), Gaps = 23/212 (10%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140
           E T L++  D   L       ++K++ L +  V+ +      +  +L  D T T L  G 
Sbjct: 63  EITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISSPSY-ILDTDSTSTLLAVGG 121

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGE----DWLISTS-KDGMIKLWDLKTQQ 195
            D +IIV D+      + L+ H  +I+     G+     WL+++   +GM+K+WDL  ++
Sbjct: 122 TDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTNGMVKVWDLVKRK 181

Query: 196 CIETHIAHTGECWGLSVKDD---------LLITTGTDSQVKLWKLNIENDKLGGKLTEMG 246
           C+ T   HT    GL + +           LI+ G D  V  W  ++   K   KL +  
Sbjct: 182 CLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWDFDM---KKKCKLIKTL 238

Query: 247 TFEKQSKQRGLKIEFITNTSDGNSFFYIQNAD 278
              +Q +  G       NT DG    Y    D
Sbjct: 239 PVNQQVESCGF-----LNTRDGKHIIYTAGGD 265

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 56/101 (55%), Gaps = 4/101 (3%)

Query: 403 NRLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRNGELQLFDL 459
           ++LLAT S + ++KIW+++T   ++T E        C F+     ++    +G ++++D 
Sbjct: 546 DKLLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDC 605

Query: 460 ASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
            S   L T+ D H+  +W+L+  +DG  +V+  AD   +FW
Sbjct: 606 YSGECLKTL-DGHNNRLWALNTMNDGDTIVSADADGIFQFW 645

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 77/176 (43%), Gaps = 12/176 (6%)

Query: 521 KLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSID 580
           K+ H  + E   +I +L+++PD +YL        +K+F L + K   S+     P   +D
Sbjct: 51  KILHKISNEDEQEITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISS-PSYILD 109

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKD 636
               S ++     D +I +  ++ G    SL  H  +I S+KF  +  +      S   +
Sbjct: 110 TDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASGDTN 169

Query: 637 AVVKYWDGEKFECIQKLYAHQSEVWALAIS----TDGSF---VVSSSHDHSIRIWE 685
            +VK WD  K +C+  L  H S V  L I+     DG     ++S   D  +  W+
Sbjct: 170 GMVKVWDLVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWD 225

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 60/141 (42%), Gaps = 15/141 (10%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGA-KPAECTYLEVHQDTDLLAVGYADGVIKVWDLM 109
           +W+++ G+L +TL       A+  RG    + C Y        LLA    D  +K+W L 
Sbjct: 518 IWNLENGELEATL-------ANHKRGLWDVSFCQY------DKLLATCSGDKTVKIWSLE 564

Query: 110 SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF 169
           + +V+    GH  A+    F     +L+S   D  I +WD      L  L  H + +   
Sbjct: 565 TFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWAL 624

Query: 170 WCQGE-DWLISTSKDGMIKLW 189
               + D ++S   DG+ + W
Sbjct: 625 NTMNDGDTIVSADADGIFQFW 645

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 81/347 (23%), Positives = 148/347 (42%), Gaps = 55/347 (15%)

Query: 380 LKTHTIELQG-QRTDMRSIDISDDNRLLATASNGSLKIWNV---KTHKCIRTFECGYAL- 434
           L+ HT  ++G   T++ + D     +L++   +  +  W+    K  K I+T      + 
Sbjct: 186 LQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWDFDMKKKCKLIKTLPVNQQVE 245

Query: 435 TCKFL---PGGLLVILGTRNGELQLFDLASSSLLD----TIEDAHDAAIWSLDLTSDGKR 487
           +C FL    G  ++     +   QL DL S S+L      IE+ +   I  L + SD K 
Sbjct: 246 SCGFLNTRDGKHIIYTAGGDAIFQLIDLESGSMLKRTNKPIEELY--IIGVLPIMSDSKM 303

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKFLPI---LKLNHDTTL-------ELNDDILSL 537
            +  S D+T++     +E  L   +K++ +     +  NH           ELN   L+ 
Sbjct: 304 FLVMS-DQTLQL--INIEEAL--ESKEEIIQAESSIAGNHGIIADMRFVGPELNKLALAT 358

Query: 538 RISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY-GHKLPVLSIDISFDSKMIITSSADKN 596
             SP  R + I  L +T     LD     + +Y GH+  + S+D + D   I T+S D +
Sbjct: 359 N-SPALRIIPIPDLTSTESSLPLD-----VEIYEGHEDLLNSLDATEDGLWIATASKDNS 412

Query: 597 IKIWGLDFG----DCHKSLFAHQDSIMSV---KFLPESHNFF--SCSKDAVVKYWDGEKF 647
             +W  +      D +     H  ++ +V     +P+ +  F  + S D  +K W   K 
Sbjct: 413 AIVWKYNNDTSKFDIYAKYIGHSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKWKIPKP 472

Query: 648 ECIQKL----------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
                +          +AH+ ++ AL++S + S   ++S+D + +IW
Sbjct: 473 TSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIW 519

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 58/282 (20%), Positives = 113/282 (40%), Gaps = 58/282 (20%)

Query: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLT----SDGK---RLVTGSADKT 496
           L+  G  NG ++++DL     L T+++ H +A+  LD+T    +DG    +L++G  D  
Sbjct: 162 LLASGDTNGMVKVWDLVKRKCLHTLQE-HTSAVRGLDITEVENNDGPSHLKLISGGRDDI 220

Query: 497 VKFWDF----------------QVENTLVPGTKDKFLPILKLNHDTTLELND----DILS 536
           V FWDF                QVE+     T+D    I     D   +L D     +L 
Sbjct: 221 VNFWDFDMKKKCKLIKTLPVNQQVESCGFLNTRDGKHIIYTAGGDAIFQLIDLESGSMLK 280

Query: 537 LRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKN 596
               P +    I +L        +   K +L +    L +++I+ + +SK  I  +    
Sbjct: 281 RTNKPIEELYIIGVLP------IMSDSKMFLVMSDQTLQLINIEEALESKEEIIQA---- 330

Query: 597 IKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA----VVKYWDGEKFEC--- 649
                        S+  +   I  ++F+    N  + + ++    ++   D    E    
Sbjct: 331 -----------ESSIAGNHGIIADMRFVGPELNKLALATNSPALRIIPIPDLTSTESSLP 379

Query: 650 --IQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETED 689
             ++    H+  + +L  + DG ++ ++S D+S  +W+   D
Sbjct: 380 LDVEIYEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNND 421

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 67/165 (40%), Gaps = 53/165 (32%)

Query: 352 ELVLTTSNN-TIEYYSIPYEKREPTSPAP---LKTHTIELQGQRTDMRSIDISDDNRLLA 407
           E +LT SN+ TI+ + IP    +PTS      +K           D+ ++ +S ++ + A
Sbjct: 453 EFLLTASNDLTIKKWKIP----KPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFA 508

Query: 408 TAS-NGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLD 466
           TAS + + KIWN++                              NGEL+      ++L +
Sbjct: 509 TASYDKTCKIWNLE------------------------------NGELE------ATLAN 532

Query: 467 TIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD---FQVENTL 508
                H   +W +      K L T S DKTVK W    F V  TL
Sbjct: 533 -----HKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMKTL 572

 Score = 32.0 bits (71), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 59/148 (39%), Gaps = 24/148 (16%)

Query: 117 FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLY----KLRSHKDSITGFWCQ 172
           + GH+  +  L     G  + + SKD++ IVW    +   +    K   H  ++T     
Sbjct: 385 YEGHEDLLNSLDATEDGLWIATASKDNSAIVWKYNNDTSKFDIYAKYIGHSSAVTAVGLP 444

Query: 173 G------EDWLISTSKDGMIKLWDLKTQ------QCIE----THIAHTGECWGLSV--KD 214
                   ++L++ S D  IK W +         Q I+    T  AH  +   LSV   D
Sbjct: 445 NVMPKGYPEFLLTASNDLTIKKWKIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPND 504

Query: 215 DLLITTGTDSQVKLWKLNIENDKLGGKL 242
            +  T   D   K+W  N+EN +L   L
Sbjct: 505 SIFATASYDKTCKIW--NLENGELEATL 530

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 130/304 (42%), Gaps = 53/304 (17%)

Query: 440 PGGLLVILGTRNGELQLFDLASSS----LLDT-IEDAHDAAIWSLDLTSDGKRLVTGSAD 494
           PG   + L T +  L++  +  +S     LD  + + H+  + SLD T DG  L T S D
Sbjct: 343 PGLNKIALATNSPALRIIPIPQTSENSLPLDVEVYEGHEDLLNSLDATEDGLWLATCSKD 402

Query: 495 KTVKFWDFQVENT-------------------------------LVPGTKDKFLPILKLN 523
            +   W F VE                                 L+  + D  +   K+ 
Sbjct: 403 SSAILWRFNVETAKFFPYAKFTGHSASVTAVALPNVMLRGWPEFLITASNDLTVKRWKVP 462

Query: 524 HDTTLELND----------------DILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYL 567
                +++D                DI +L ++P+D   A +  D T K++ +++ +   
Sbjct: 463 KPANEDISDLLTIKQSEYTFHVHAKDINALSLAPNDSLFATASYDKTCKIWDVETGESKA 522

Query: 568 SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES 627
           +L GHK  +  +      K++ TSS DK IKIW LD   C K+L  H +++    F+ + 
Sbjct: 523 TLAGHKRGLWDVSFCQYDKLLATSSGDKTIKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQ 582

Query: 628 HNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEE- 686
               S   D ++K WD    +C++ L  H + +WA+ +  DG  ++S+  D   + W + 
Sbjct: 583 KQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAMNVCNDGDLIISADADGVFQFWRDC 642

Query: 687 TEDQ 690
           TE+Q
Sbjct: 643 TEEQ 646

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 67/149 (44%), Gaps = 3/149 (2%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           L +  +  L A    D   K+WD+ +        GHK  +  + F      L + S D  
Sbjct: 492 LSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSSGDKT 551

Query: 145 IIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
           I +W+L     +  L  H +++    +   +  L+S+  DG+IK+WD  T  C++T   H
Sbjct: 552 IKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGH 611

Query: 204 TGECWGLSVKD--DLLITTGTDSQVKLWK 230
               W ++V +  DL+I+   D   + W+
Sbjct: 612 GNRIWAMNVCNDGDLIISADADGVFQFWR 640

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 81/174 (46%), Gaps = 4/174 (2%)

Query: 330 QTVRSLYKIKSASWTTITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQG 389
           + +  L  IK + +T    +K    L+ + N   + +  Y+K               L G
Sbjct: 467 EDISDLLTIKQSEYTFHVHAKDINALSLAPNDSLFATASYDKTCKIWDVETGESKATLAG 526

Query: 390 QRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVI 446
            +  +  +     ++LLAT+S + ++KIWN+ T  C++T E        C F+     ++
Sbjct: 527 HKRGLWDVSFCQYDKLLATSSGDKTIKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLV 586

Query: 447 LGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
               +G ++++D  +   L T+ D H   IW++++ +DG  +++  AD   +FW
Sbjct: 587 SSGADGLIKIWDCITGDCLKTL-DGHGNRIWAMNVCNDGDLIISADADGVFQFW 639

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 74/176 (42%), Gaps = 9/176 (5%)

Query: 518 PILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL 577
           P  KL H    +   +I +LR++PD RYL        +K+F LDSMK   S+     P  
Sbjct: 47  PTQKLLHTIENDDEQEITALRLTPDGRYLCYVSQAQQLKIFSLDSMKITRSMKISS-PSY 105

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSC 633
            +D    S +I     D +I +  ++ G    S   H  +I S+KF  E +       S 
Sbjct: 106 VMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGELNGDKWLLASG 165

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAI----STDGSFVVSSSHDHSIRIWE 685
             + V K WD  K  C+  +  H S +  L        D   ++S   D  + +WE
Sbjct: 166 DTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWE 221

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 61/140 (43%), Gaps = 13/140 (9%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +WD++TG+  +TL+ G   G  D      + C Y        LLA    D  IK+W+L +
Sbjct: 512 IWDVETGESKATLA-GHKRGLWDV-----SFCQY------DKLLATSSGDKTIKIWNLDT 559

Query: 111 KTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF- 169
            + +    GH  A+    F     +L+S   D  I +WD +    L  L  H + I    
Sbjct: 560 FSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTLDGHGNRIWAMN 619

Query: 170 WCQGEDWLISTSKDGMIKLW 189
            C   D +IS   DG+ + W
Sbjct: 620 VCNDGDLIISADADGVFQFW 639

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 62/149 (41%), Gaps = 45/149 (30%)

Query: 93  LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVG 152
           L+A+G  DG I V D+ +  +  +F GH   I+ L+F G                     
Sbjct: 115 LIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGE-------------------- 154

Query: 153 EVGLYKLRSHKDSITGFWCQGEDWLISTS-KDGMIKLWDLKTQQCIETHIAHTGECWGLS 211
                               G+ WL+++   +G+ K+WDL  ++C+ T   HT    GL 
Sbjct: 155 ------------------LNGDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLD 196

Query: 212 VK----DDL--LITTGTDSQVKLWKLNIE 234
            K    +D   L++ G D  V LW+ N++
Sbjct: 197 FKEVEGEDCVKLLSGGRDDIVNLWEFNMK 225

 Score = 40.8 bits (94), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 60/120 (50%), Gaps = 7/120 (5%)

Query: 86  EVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGT----GTRLISGSK 141
           E++ D  LLA G  +GV KVWDL+ +  L     H +AI  L F         +L+SG +
Sbjct: 154 ELNGDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGR 213

Query: 142 DSNIIVWDLVGEVGLYKLRS---HKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
           D  + +W+   +     L++   H+   +  + +  D + +   + +++L  L++Q+ I+
Sbjct: 214 DDIVNLWEFNMKKHSKLLKTVPVHQQVESCGFVRESDLVYTAGGEAVLQLISLESQKVIK 273

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score =  100 bits (250), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 128/278 (46%), Gaps = 39/278 (14%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++DL +  +L T++  H+  I+SLD    G +LV+G
Sbjct: 354 YIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQ-GHEQDIYSLDYFPAGDKLVSG 412

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +SP D +Y+A   
Sbjct: 413 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 455

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD TV+V      F ++ +     L  GHK  V S+  + D + +I+ S D+++K+W L 
Sbjct: 456 LDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLR 515

Query: 603 ------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
                     C  +   H+D ++SV    +     S SKD  V +WD      +  L  H
Sbjct: 516 GLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGH 575

Query: 657 QSEVWALAI------STDGSFVVSSSHDHSIRIWEETE 688
           ++ V ++A+        D     + S D   RIW+ T+
Sbjct: 576 RNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKYTK 613

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 127/271 (46%), Gaps = 38/271 (14%)

Query: 394 MRSIDISDDNRLLATASNGSL-KIWNVKTHKCIRTFECG----YALTCKFLPGGLLVILG 448
           +RS+  S D + LAT +   L +IW++ T K + T +      Y+L   + P G  ++ G
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSL--DYFPAGDKLVSG 412

Query: 449 TRNGELQLFDLASS--SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVEN 506
           + +  ++++DL +   SL  +IED       S     DGK +  GS D+TV+ WD     
Sbjct: 413 SGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVS---PGDGKYIAAGSLDRTVRVWD----- 464

Query: 507 TLVPGTKDKFLPILKLNHDTTLELN--DDILSLRISPDDRYLAISLLDNTVKVFFLDSMK 564
                ++  FL + +L+ +  L     D + S+  + D + +    LD +VK++ L  + 
Sbjct: 465 -----SETGFL-VERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLN 518

Query: 565 FY-------LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDS 617
                    ++  GHK  VLS+  + D + I++ S D+ +  W    G+    L  H++S
Sbjct: 519 GQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNS 578

Query: 618 IMSVKFL------PESHNFFSCSKDAVVKYW 642
           ++SV  +      P+   F + S D   + W
Sbjct: 579 VISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/226 (25%), Positives = 96/226 (42%), Gaps = 37/226 (16%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAE----------CTYLEVHQD 90
           L T   +   V+ + TG+L++ LSD    G ++     PA              ++    
Sbjct: 291 LATGCNKTTQVYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNGGENSATIQPASS 350

Query: 91  TDL-------------LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLI 137
           +DL             LA G  D +I++WDL +K +L+   GH+  I  L +   G +L+
Sbjct: 351 SDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLV 410

Query: 138 SGSKDSNIIVWDL-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQ 194
           SGS D  + +WDL  G+  L    S +D +T       D  ++ + S D  +++WD +T 
Sbjct: 411 SGSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETG 468

Query: 195 QCIET-------HIAHTGECWGLSVKDD--LLITTGTDSQVKLWKL 231
             +E           H    + +    D   +I+   D  VKLW L
Sbjct: 469 FLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDL 514

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 109/232 (46%), Gaps = 26/232 (11%)

Query: 385 IELQGQRTDMRSID-ISDDNRLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL-PG- 441
           + LQG   D+ S+D     ++L++ + + +++IW+++T +C  T      +T   + PG 
Sbjct: 388 MTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 447

Query: 442 GLLVILGTRNGELQLFDLASSSLLDTIED------AHDAAIWSLDLTSDGKRLVTGSADK 495
           G  +  G+ +  ++++D  +  L++ ++        H  +++S+  T DG+ +++GS D+
Sbjct: 448 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDR 507

Query: 496 TVKFWDFQVENTLVPGTKDKF-LPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNT 554
           +VK WD +  N    G K      +    H       D +LS+  + DD Y+     D  
Sbjct: 508 SVKLWDLRGLN----GQKSHATCEVTYTGH------KDFVLSVATTQDDEYILSGSKDRG 557

Query: 555 VKVFFLDSMKFYLSLYGHKLPVLSIDI------SFDSKMIITSSADKNIKIW 600
           V  +   S    L L GH+  V+S+ +        D  +  T S D   +IW
Sbjct: 558 VLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 92/215 (42%), Gaps = 26/215 (12%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELN 531
           H + +  +  ++DG+ L TG  +KT + +       L            +L+ D+   +N
Sbjct: 275 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTGELLA-----------RLSDDSVAGVN 322

Query: 532 DDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITS 591
           ++       P +   A +  +N+  +    S   Y         + S+  S D K + T 
Sbjct: 323 NEA---STGPANNGTADNGGENSATIQPASSSDLY---------IRSVCFSPDGKYLATG 370

Query: 592 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
           + DK I+IW L       +L  H+  I S+ + P      S S D  V+ WD    +C  
Sbjct: 371 AEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSL 430

Query: 652 KLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
            L + +  V  +A+S  DG ++ + S D ++R+W+
Sbjct: 431 TL-SIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 464

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 102/248 (41%), Gaps = 49/248 (19%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + PA  +  SGSG           V +WD++TG    TLS  DG+           P + 
Sbjct: 402 YFPAGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV-----TTVAVSPGDG 448

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
            Y+         A G  D  ++VWD  +  ++   +       GHK ++  + F   G  
Sbjct: 449 KYI---------AAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQG 499

Query: 136 LISGSKDSNIIVWDLVGEVGL-------YKLRSHKDSITGFWC-QGEDWLISTSKDGMIK 187
           +ISGS D ++ +WDL G  G             HKD +      Q +++++S SKD  + 
Sbjct: 500 VISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVL 559

Query: 188 LWDLKTQQCIETHIAHTGECWGLSV-------KDDLLITTGT-DSQVKLWKLNIENDK-- 237
            WD  +   +     H      ++V        D  +  TG+ D + ++WK   +++   
Sbjct: 560 FWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKYTKKSNPTA 619

Query: 238 LGGKLTEM 245
            G KL E+
Sbjct: 620 TGAKLQEL 627

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score =  101 bits (251), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 89/341 (26%), Positives = 146/341 (42%), Gaps = 52/341 (15%)

Query: 352 ELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASN 411
           +L L T++ T+    +P  ++E     P+     E  G    + S+D +DD   +ATAS 
Sbjct: 352 KLALATNSPTLRIIPVPSSEQEE---LPINVEMYE--GHEDLLNSLDTTDDGLWMATASK 406

Query: 412 GSLKI-WNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIED 470
               I W  K +  I  F+  Y    KF+                               
Sbjct: 407 DHTAIVW--KYNSIINKFQ-PYV---KFI------------------------------- 429

Query: 471 AHDAAIWSLDLTSDGKR-----LVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHD 525
            H A + ++ L +   R     L+T S D T+K W     +T V    ++   I+K++  
Sbjct: 430 GHSATVTAVGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTV----EEDCQIVKVSEY 485

Query: 526 TTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
           T      DI +L ISP+D   A +  D T K++ L++ +   +L  HK  +  +      
Sbjct: 486 TRRAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYD 545

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGE 645
           K+I T S DK IKIW LD     K+L  H +++    F+ +     S   D ++K WD  
Sbjct: 546 KLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCS 605

Query: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEE 686
             +C++ L  H + +WAL    DG  +VS+  D   + W++
Sbjct: 606 TGDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFWKD 646

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 70/159 (44%), Gaps = 3/159 (1%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGT 134
           R A   +   L +  +  + A    D   K+WDL +  +    + HK  +  + F     
Sbjct: 487 RRAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDK 546

Query: 135 RLISGSKDSNIIVWDLVGEVGLYKLRSHKDSIT-GFWCQGEDWLISTSKDGMIKLWDLKT 193
            + + S D  I +W L     +  L  H +++    +   +  L+S+  DG+IK+WD  T
Sbjct: 547 LIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCST 606

Query: 194 QQCIETHIAHTGECWGLS-VKD-DLLITTGTDSQVKLWK 230
             C++T   H    W L+ + D D++++   D   + WK
Sbjct: 607 GDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFWK 645

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 81/166 (48%), Gaps = 15/166 (9%)

Query: 80  AECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTR---- 135
           + C  ++    + L+A+G  DG I V D+ +  +  +  GH A I+ L+F G        
Sbjct: 107 SPCYIMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWL 166

Query: 136 LISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQ--GEDW-LISTSKDGMIKLWDLK 192
           L SG  +  + VWDLV    L+ ++ H +++ G   +  G++W LIS  +D +  LW+  
Sbjct: 167 LCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFN 226

Query: 193 -TQQC-----IETHIAHTGECWGLSVK-DDLLITTGTDSQVKLWKL 231
             ++C     I  H      C  ++ + DDL+ T G D+ ++   L
Sbjct: 227 LKKKCTLLKTIPVH-QQVESCGFINHEHDDLIYTAGGDALLQFISL 271

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 61/144 (42%), Gaps = 21/144 (14%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGA-KPAECTYLEVHQDTDLLAVGYADGVIKVWDLM 109
           +WD++ G+L +TLS+         RG    A C Y        L+A    D  IK+W L 
Sbjct: 517 IWDLENGELTATLSN-------HKRGLWDVAFCQY------DKLIATCSGDKTIKIWSLD 563

Query: 110 SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF 169
           + +V+    GH  A+    F     +L+S   D  I +WD      L  L  H + I   
Sbjct: 564 TFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRI--- 620

Query: 170 WCQGE----DWLISTSKDGMIKLW 189
           W   E    D ++S   DG+ + W
Sbjct: 621 WALTEINDGDMIVSADADGVFQFW 644

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 77/167 (46%), Gaps = 13/167 (7%)

Query: 531 NDD---ILSLRISPDDRYLAISLLDNTVKVFFLDSMK----FYLSLYGHKLPVLSIDISF 583
           NDD   I +L+++PD +YL+    +  +K+F LD  K      +       P   +D   
Sbjct: 57  NDDEQEITALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKMSSPCYIMDCDS 116

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN--FFSCSKD--AVV 639
            S ++     D +I +  ++ G    SL  H  +I ++KF  ++++  +  CS D   +V
Sbjct: 117 TSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMV 176

Query: 640 KYWDGEKFECIQKLYAHQSEVWALAISTDGS--FVVSSSHDHSIRIW 684
           K WD  K +C+  +  H + V  L +   G    ++S   D+   +W
Sbjct: 177 KVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLW 223

 Score = 35.4 bits (80), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 53/267 (19%), Positives = 113/267 (42%), Gaps = 43/267 (16%)

Query: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGK--RLVTGSADKTVKFWD 501
           L+  G  NG ++++DL     L T+++ H  A+  LD+   G   +L++G  D     W+
Sbjct: 166 LLCSGDTNGMVKVWDLVKRKCLHTMQE-HSNAVRGLDVREVGDEWQLISGGRDNVCTLWN 224

Query: 502 FQVENTLVPGTKDKFLPILK-------LNH---DTTLELNDDILSLRISPDDRYLAISLL 551
           F ++      T  K +P+ +       +NH   D       D L   IS +   +     
Sbjct: 225 FNLKKKC---TLLKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQFISLEKATMIKKTK 281

Query: 552 DNTVKVFF------LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            +  ++F       L++ K YL +    L ++ I     S ++  SS          D  
Sbjct: 282 KHIEELFIIGVLPILENDKMYLVMSDQTLELVDIK----SNLLNESS----------DII 327

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA----VVKYWDGEKFEC---IQKLYAHQS 658
           +    +  +  +I  +KF+  +H+  + + ++    ++     E+ E    ++    H+ 
Sbjct: 328 EIESCIAGNNGTIADMKFVGPNHDKLALATNSPTLRIIPVPSSEQEELPINVEMYEGHED 387

Query: 659 EVWALAISTDGSFVVSSSHDHSIRIWE 685
            + +L  + DG ++ ++S DH+  +W+
Sbjct: 388 LLNSLDTTDDGLWMATASKDHTAIVWK 414

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 106/238 (44%), Gaps = 10/238 (4%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKF-LPILKLNHD--TTLELNDDILSLRISPDDR 544
           L+T S D TVK W        VP   D+F + I  ++    T      DI  L ISP+D 
Sbjct: 471 LITASNDLTVKKWK-------VPKPTDRFDIEIYSISSSEYTRRAHEKDINMLSISPNDS 523

Query: 545 YLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDF 604
             A +  D T K++ L++ +   +L  HK  +  +      K I T+S DK +KIW LD 
Sbjct: 524 IFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDT 583

Query: 605 GDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALA 664
               K+L  H +++    F  +     S   D +VK WD    ECI  L  H + +WAL 
Sbjct: 584 FTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALN 643

Query: 665 ISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           +  DG  V+++  D   + W++  ++             +   TL   +  G+  +AF
Sbjct: 644 VIKDGDIVITADADGVFQFWKDRTEEAREEDIEKEKLKVEQMQTLENYISSGDWTNAF 701

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 83/186 (44%), Gaps = 13/186 (6%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGT 134
           R A   +   L +  +  + A    D   K+WDL +  +    N HK  +  + F     
Sbjct: 506 RRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDK 565

Query: 135 RLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKT 193
            + + S D  + +W L     +  L  H +++    +   +  L+ST  DG++KLWD  T
Sbjct: 566 FIATASGDKTVKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCST 625

Query: 194 QQCIETHIAHTGECWGLSV-KD-DLLITTGTDSQVKLWK--------LNIENDKLGGKLT 243
            +CI T   H    W L+V KD D++IT   D   + WK         +IE +KL  K+ 
Sbjct: 626 GECINTLDGHDNRIWALNVIKDGDIVITADADGVFQFWKDRTEEAREEDIEKEKL--KVE 683

Query: 244 EMGTFE 249
           +M T E
Sbjct: 684 QMQTLE 689

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 80/174 (45%), Gaps = 4/174 (2%)

Query: 335 LYKIKSASWTTITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDM 394
           +Y I S+ +T     K   +L+ S N   + +  Y+K               L   +  +
Sbjct: 496 IYSISSSEYTRRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKRGL 555

Query: 395 RSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGLLVILGTRN 451
             +     ++ +ATAS + ++KIW++ T   ++T E        C F      ++    +
Sbjct: 556 WDVSFCQYDKFIATASGDKTVKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGAD 615

Query: 452 GELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
           G ++L+D ++   ++T+ D HD  IW+L++  DG  ++T  AD   +FW  + E
Sbjct: 616 GLVKLWDCSTGECINTL-DGHDNRIWALNVIKDGDIVITADADGVFQFWKDRTE 668

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 61/120 (50%), Gaps = 12/120 (10%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDG---TGTRLI-SGS 140
           LE    + LLA+G  DG + V D+ +  +  +  GH A I+ L+F G   T T L+ SG 
Sbjct: 120 LETDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGD 179

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQ------GED--WLISTSKDGMIKLWDLK 192
            +  + +WDLV    ++ L+ H  ++ G   +       ED   LI+ ++D +I  W+ K
Sbjct: 180 TNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHWEFK 239

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 70/169 (41%), Gaps = 15/169 (8%)

Query: 531 NDD---ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           NDD   I +L ++PD +YL        +K+F L + K   S+     P   ++    S +
Sbjct: 70  NDDEQEITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISS-PSYVLETDPTSTL 128

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVVKYWD 643
           +     D ++ +  ++ G    SL  H  +I S+KF  E H       S   + +VK WD
Sbjct: 129 LAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWD 188

Query: 644 GEKFECIQKLYAHQSEVWALAI-------STDGSFVVSSSHDHSIRIWE 685
               + I  L  H S V  +         S D   +++ + D  I  WE
Sbjct: 189 LVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHWE 237

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 84  YLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQF-------DGTGTRL 136
           Y E H +T LL+ G  +G++K+WDL+S+  +     H +A+  + F            +L
Sbjct: 165 YGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKKNSEDSLQL 224

Query: 137 ISGSKDSNIIVWDL 150
           I+G++D  I  W+ 
Sbjct: 225 ITGARDDVINHWEF 238

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 36/63 (57%), Gaps = 8/63 (12%)

Query: 448 GTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDL-------TSDGKRLVTGSADKTVKFW 500
           G  NG ++++DL S   + T+++ H++A+  +D        + D  +L+TG+ D  +  W
Sbjct: 178 GDTNGMVKIWDLVSRKAIHTLQE-HNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHW 236

Query: 501 DFQ 503
           +F+
Sbjct: 237 EFK 239

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 99/424 (23%), Positives = 175/424 (41%), Gaps = 113/424 (26%)

Query: 357 TSNNTIEYYSIPYEKR-EPTSPAP-----LKTHTIE--LQGQRTDM---------RSIDI 399
           TS     +Y +PY++R   T P P     L + TI   L+ Q  D          R+ID+
Sbjct: 284 TSATKESHYLVPYDQRANHTKPIPPFLLDLDSQTIPAGLKKQTDDYYILYNPALPRNIDV 343

Query: 400 -----------------SDDNRLLATASNGSLKIWNVKTHKCI----------------- 425
                            S+D + LAT  N + +++NV + + I                 
Sbjct: 344 ELHKSLDHTSVVCCVRFSNDGKFLATGCNKTTQVYNVASGELIARLSDDSASHITPGQNS 403

Query: 426 RTFECG-------------------YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLD 466
           +  E G                   Y  +  F P G  +  G  +  ++++D+A   ++ 
Sbjct: 404 KDSEGGEENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIM 463

Query: 467 TIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDT 526
            ++  H+  I+SLD    G++LV+GS D+TV+ WD +     +                 
Sbjct: 464 VLQ-GHEQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSL----------------- 505

Query: 527 TLELNDDILSLRISPDD-RYLAISLLDNTVKV------FFLDSMKFYLSL-YGHKLPVLS 578
           TL + D + ++ +SP+D +Y+A   LD  V+V      F ++ +     L  GHK  V S
Sbjct: 506 TLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYS 565

Query: 579 IDISFDSKMIITSSADKNIKIWGLD-----------FGDCHKSLFAHQDSIMSVKFLPES 627
           +  + D   +++ S D+++K+W L+            G C  +   H+D ++SV      
Sbjct: 566 VVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGD 625

Query: 628 HNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS------TDGSFVVSSSHDHSI 681
               S SKD  V +WD +    +  L  H++ V ++A++      T+     + S D   
Sbjct: 626 EYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKA 685

Query: 682 RIWE 685
           RIW+
Sbjct: 686 RIWK 689

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 106/231 (45%), Gaps = 36/231 (15%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDG----LPPG--ASDARGAKPAECT----------- 83
           L T   +   V+++ +G+L++ LSD     + PG  + D+ G +    T           
Sbjct: 367 LATGCNKTTQVYNVASGELIARLSDDSASHITPGQNSKDSEGGEENNDTTTYSTSATTSS 426

Query: 84  --YLE---VHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLIS 138
             Y+       D   LA G  D +I++WD+  K +++   GH+  I  L +  +G +L+S
Sbjct: 427 DLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVS 486

Query: 139 GSKDSNIIVWDL-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQQ 195
           GS D  + +WDL  G+  L    S +D +T      ED  ++ + S D  +++WD +T  
Sbjct: 487 GSGDRTVRIWDLRTGQCSL--TLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGF 544

Query: 196 CIET-------HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKLNIENDK 237
            +E           H    + +   +D   + +G+ D  VKLW LN  N+K
Sbjct: 545 LVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNK 595

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 93/235 (39%), Gaps = 51/235 (21%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD++TG    TLS  DG+               
Sbjct: 477 YFPSGEKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV--------------T 514

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
           T     +D   +A G  D  ++VWD  +  ++   +       GHK ++  + F   G  
Sbjct: 515 TVAVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNN 574

Query: 136 LISGSKDSNIIVWDL-----------VGEVGLYKLRSHKDSITGFWC-QGEDWLISTSKD 183
           ++SGS D ++ +W+L           V          HKD +      QG+++++S SKD
Sbjct: 575 VVSGSLDRSVKLWNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKD 634

Query: 184 GMIKLWDLKTQQCIETHIAHTGECWGLSVKD--------DLLITTGTDSQVKLWK 230
             +  WD K+   +     H      ++V +         +  T   D + ++WK
Sbjct: 635 RGVLFWDTKSGNPLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKARIWK 689

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 108/235 (45%), Gaps = 4/235 (1%)

Query: 488 LVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLA 547
           ++T S D T+K W        V   + + L ++K +  T      DI ++ ISP+D   A
Sbjct: 456 IITASNDLTIKKWKVPK----VTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLFA 511

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            +  D T K++ LD  +F  +L  HK  +  +      K++ T S DK IKIW L+    
Sbjct: 512 TASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAV 571

Query: 608 HKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST 667
            K+L  H +++    F+ ++    S   D +V  WD    E ++ L AH + +WALA+  
Sbjct: 572 VKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMN 631

Query: 668 DGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           DG   V++  D     W +  ++             + E +L   L EG+  +AF
Sbjct: 632 DGESFVTADADGFFEFWRDNSEEEHERNLEQEKLKIEQEQSLQNYLSEGDWTNAF 686

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 76/189 (40%), Gaps = 14/189 (7%)

Query: 75  RGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGT 134
           R A   +   + +  +  L A    D   K+W+L           HK  +  + F     
Sbjct: 491 RRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDK 550

Query: 135 RLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKT 193
            L + S D  I +W L     +  L  H +++    +      LIST  DG++ +WDL T
Sbjct: 551 LLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLST 610

Query: 194 QQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKLNIENDKLGGKLTEMGTFEKQ 251
            + ++T  AH    W L+V +D    +T   D   + W+ N E +            E+ 
Sbjct: 611 GESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFWRDNSEEEH-----------ERN 659

Query: 252 SKQRGLKIE 260
            +Q  LKIE
Sbjct: 660 LEQEKLKIE 668

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/226 (23%), Positives = 97/226 (42%), Gaps = 31/226 (13%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFW---DFQVENTLVPGTKDKFLPILKLNHDTT 527
           AH+  I ++ ++ +     T S DKT K W   D + + TL              NH   
Sbjct: 493 AHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLA-------------NHKRG 539

Query: 528 LELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           L        +     D+ LA    D T+K++ L+S     +L GH   V        +K 
Sbjct: 540 L------WDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQ 593

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW----- 642
           +I++ AD  + IW L  G+  K+L AH + I ++  + +  +F +   D   ++W     
Sbjct: 594 LISTGADGLVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFWRDNSE 653

Query: 643 -DGEKFECIQKLYAHQSEVWALAIST---DGSFVVSSSHDHSIRIW 684
            + E+    +KL   Q +     +S      +F+++ + DH +R++
Sbjct: 654 EEHERNLEQEKLKIEQEQSLQNYLSEGDWTNAFLLAMTLDHPMRLY 699

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 84/196 (42%), Gaps = 48/196 (24%)

Query: 352 ELVLTTSNN-TIEYYSIP-YEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATA 409
           E ++T SN+ TI+ + +P     EP     +KT     +    D+ +I IS ++ L ATA
Sbjct: 454 EFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPNDSLFATA 513

Query: 410 S-------------------------------------------NGSLKIWNVKTHKCIR 426
           S                                           + ++KIW+++++  ++
Sbjct: 514 SYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVK 573

Query: 427 TFE--CGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSD 484
           T E        C F+     +I    +G + ++DL++   + T+ DAH+  IW+L + +D
Sbjct: 574 TLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTL-DAHNNRIWALAVMND 632

Query: 485 GKRLVTGSADKTVKFW 500
           G+  VT  AD   +FW
Sbjct: 633 GESFVTADADGFFEFW 648

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 58/141 (41%), Gaps = 15/141 (10%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGA-KPAECTYLEVHQDTDLLAVGYADGVIKVWDLM 109
           +W++  G+  +TL       A+  RG    A C Y        LLA    D  IK+W L 
Sbjct: 521 IWNLDDGEFQATL-------ANHKRGLWDVAFCQY------DKLLATCSGDKTIKIWSLE 567

Query: 110 SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF 169
           S  V+    GH  A+    F     +LIS   D  +I+WDL     +  L +H + I   
Sbjct: 568 SYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIWAL 627

Query: 170 WCQGE-DWLISTSKDGMIKLW 189
               + +  ++   DG  + W
Sbjct: 628 AVMNDGESFVTADADGFFEFW 648

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 75  RGAKPAECTY-LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTG 133
           R  K +   Y +   Q + LLA+G  DG + V D+ +  V  +  GH A I+ ++F G  
Sbjct: 96  RSMKISSPVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGEL 155

Query: 134 T----RLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITG--FWCQGED----WLISTSKD 183
                +L SG  +  I VWDLV       ++ H  ++ G  F    E+     L+S  +D
Sbjct: 156 NSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEEKGTLQLLSGGRD 215

Query: 184 GMIKLWDLKTQQ 195
            ++ L++  + +
Sbjct: 216 NILNLFEFNSTK 227

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 60/144 (41%), Gaps = 5/144 (3%)

Query: 524 HDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISF 583
           H    E   DI +L ++PD  YL        ++V+ L   +   S+     PV  ++   
Sbjct: 53  HSVDTEDEQDITALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRSMKISS-PVYVMNCDQ 111

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN----FFSCSKDAVV 639
            S ++     D ++ +  ++ G    SL  H  +I SVKF  E ++      S   + ++
Sbjct: 112 TSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMI 171

Query: 640 KYWDGEKFECIQKLYAHQSEVWAL 663
           K WD  K  C   +  H + V  L
Sbjct: 172 KVWDLVKRNCQCTIQEHTTAVRGL 195

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 73/164 (44%), Gaps = 13/164 (7%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140
           + T L +  D   L       +++V+ L  + ++ +     + + ++  D T T L  G 
Sbjct: 62  DITALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRSMK-ISSPVYVMNCDQTSTLLAIGG 120

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGE----DW-LISTSKDGMIKLWDLKTQQ 195
            D ++ V D+      + L+ H  +I+     GE     W L S   +GMIK+WDL  + 
Sbjct: 121 TDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRN 180

Query: 196 CIETHIAHTGECWGL--SVKDD-----LLITTGTDSQVKLWKLN 232
           C  T   HT    GL   V D+      L++ G D+ + L++ N
Sbjct: 181 CQCTIQEHTTAVRGLDFRVTDEEKGTLQLLSGGRDNILNLFEFN 224

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 58/136 (42%), Gaps = 23/136 (16%)

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV---K 622
           GH   + S+D + D   + T+S D ++ +W       DF    K    H  S+ +V    
Sbjct: 388 GHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTK-FVGHVGSVNAVGLPN 446

Query: 623 FLPESHNFF--SCSKDAVVKYWDGEKFECIQK------------LYAHQSEVWALAISTD 668
            +P S   F  + S D  +K W   K    +               AH+ ++ A++IS +
Sbjct: 447 VMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAISISPN 506

Query: 669 GSFVVSSSHDHSIRIW 684
            S   ++S+D + +IW
Sbjct: 507 DSLFATASYDKTCKIW 522

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 133/295 (45%), Gaps = 40/295 (13%)

Query: 393 DMRSIDISDDNRLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRN 451
           DM S++ SDD+RL A     S +K+W++           G +L    +P         + 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLD----------GSSLISNKIPS-------YKR 526

Query: 452 GELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPG 511
            E++  D A+S+L+      H  +++S   + D + L++GS DKTV+ W       LV  
Sbjct: 527 KEMETTDPATSTLI-----GHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALV-- 579

Query: 512 TKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                         +    N  +  ++ SP   Y A +  D T +++  D +       G
Sbjct: 580 --------------SYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAG 625

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V ++    +   + T S+DK  ++W +  GD  +  + H   I+S    P+     
Sbjct: 626 HLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLC 685

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           + S D ++  WD    + I+++  H ++ V +L ++ +G+ ++S   DHS+R+W+
Sbjct: 686 TGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWD 740

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 74/174 (42%), Gaps = 19/174 (10%)

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYL-------------------SLYG 571
           N D+ SL  S D R  A    D+ +K++ LD                         +L G
Sbjct: 482 NRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIG 541

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V S   S DS+ +++ S DK +++W LD      S   H   +  VKF P  H F 
Sbjct: 542 HSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFA 601

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           + S D   + W  +    ++    H S+V  ++   +G +V + S D + R+W+
Sbjct: 602 TASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWD 655

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 64/160 (40%), Gaps = 24/160 (15%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+   
Sbjct: 600 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDI--- 656

Query: 154 VGLYKLRSHKDSITGFWCQGED-----------WLISTSKDGMIKLWDLKTQQCIETHIA 202
                  S  DS+  FW                WL + S DG+I LWD+ T + I+    
Sbjct: 657 -------STGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRG 709

Query: 203 HTGEC---WGLSVKDDLLITTGTDSQVKLWKLNIENDKLG 239
           H         L+ + ++L++ G D  V++W L    ++ G
Sbjct: 710 HGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLKKATNEPG 749

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 64/132 (48%), Gaps = 4/132 (3%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRNGELQLFDLASS 462
           +   +S+ + ++W++ T   +R F       L+    P G  +  G+ +G + L+D+ + 
Sbjct: 642 VFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTG 701

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKL 522
             +  +      A+ SL L  +G  L++G AD +V+ WD + + T  PG + +  P +  
Sbjct: 702 KRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK-KATNEPGLEPE-QPFIGH 759

Query: 523 NHDTTLELNDDI 534
             D T  +N D+
Sbjct: 760 IGDVTASINQDV 771

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/175 (20%), Positives = 64/175 (36%), Gaps = 24/175 (13%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLN-------------------FNGHK 121
           + T LE   D+ L A G+ D  IK+W L   +++ N                     GH 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHS 543

Query: 122 AAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI--TGFWCQGEDWLIS 179
            ++    F      L+SGS+D  + +W L     L   + H   +    F   G  +  +
Sbjct: 544 GSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGH-YFAT 602

Query: 180 TSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKLN 232
            S D   +LW       +     H  +   +S   +   + T  +D   ++W ++
Sbjct: 603 ASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDIS 657

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 46/108 (42%), Gaps = 13/108 (12%)

Query: 44  SALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVI 103
           S+ +   +WDI TGD +        P  S              V  D   L  G  DG+I
Sbjct: 646 SSDKTCRMWDISTGDSVRYFWVHTAPILSTV------------VTPDGRWLCTGSDDGLI 693

Query: 104 KVWDLMSKTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
            +WD+ +   +    GH K A+  L  +  G  L+SG  D ++ VWDL
Sbjct: 694 NLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDL 741

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 2/107 (1%)

Query: 88  HQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F  H A I        G  L +GS D  I +
Sbjct: 636 HPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINL 695

Query: 148 WDLVGEVGLYKLRSH-KDSITGFWCQGE-DWLISTSKDGMIKLWDLK 192
           WD+     + ++R H K+++       E + L+S   D  +++WDLK
Sbjct: 696 WDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 54/143 (37%), Gaps = 22/143 (15%)

Query: 109 MSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVG------EVGLYK---- 158
           +    +  F+     +T L+F        +G +DS I +W L G      ++  YK    
Sbjct: 470 LPTVCMYTFHNTNRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEM 529

Query: 159 ---------LRSHKDSI-TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECW 208
                    L  H  S+ +  +     +L+S S+D  ++LW L T   + ++  H    W
Sbjct: 530 ETTDPATSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVW 589

Query: 209 GL--SVKDDLLITTGTDSQVKLW 229
            +  S       T   D   +LW
Sbjct: 590 DVKFSPLGHYFATASHDQTARLW 612

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 111/240 (46%), Gaps = 10/240 (4%)

Query: 486 KRLVTGSADKTVKFWDFQVENTLVPGTKDKF--LP-ILKLNHDTTLELNDDILSLRISPD 542
           K ++T S D TVK W+       +P  K+    +P I+K +  T      DI ++ ++P+
Sbjct: 454 KYIITASNDLTVKKWE-------IPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPN 506

Query: 543 DRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           D   A +  D T K++ +D+ +   +L  HK  +  +      K I T S DK +KIW L
Sbjct: 507 DSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSL 566

Query: 603 DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWA 662
           +     K+L  H +++    F+ +     S   D ++K WD    +CI+ L  H + +WA
Sbjct: 567 ESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWA 626

Query: 663 LAISTDGSFVVSSSHDHSIRIWEETEDQVFXXXXXXXXXXXQYEDTLLTSLEEGNGDDAF 722
           L++  DG  ++S+  D   + W++  +              + E +L   +  G   +AF
Sbjct: 627 LSVLEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVRVEQEQSLTNYMNNGEWSNAF 686

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 100/242 (41%), Gaps = 33/242 (13%)

Query: 6   QRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALE-NVNVWDIKTGDLMSTLS 64
           +RF   A+F   A++ + V LP        + P  +IT++ +  V  W+I          
Sbjct: 424 KRFYIYATFVGHAASVSAVCLP---NVMEKNYPKYIITASNDLTVKKWEI---------- 470

Query: 65  DGLPPGASD-------------ARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSK 111
              PP  +D              R A   +   + +  +  + A    D   K+W++ + 
Sbjct: 471 ---PPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTG 527

Query: 112 TVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-W 170
             +     HK  +  + F  +   + + S D  + +W L     L  L  H +++    +
Sbjct: 528 EPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSF 587

Query: 171 CQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKD--DLLITTGTDSQVKL 228
              +  L+S   DG+IK+WD+ +  CI+    H+   W LSV +  DL+I+   DS  + 
Sbjct: 588 MNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQF 647

Query: 229 WK 230
           WK
Sbjct: 648 WK 649

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 85/175 (48%), Gaps = 17/175 (9%)

Query: 75  RGAKPAECTYLEVHQDTD-LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGT- 132
           R  K +  +Y+     T  L+A+G  DG I V D+ +  +  +F GH   I+ L+F G  
Sbjct: 98  RSLKVSSPSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGEL 157

Query: 133 GTRL-ISGSKDSNII--VWDLVGEVGLYKLRSHKDSITGF-WCQGEDW----LISTSKDG 184
           GT + + GS D+N +  VWDLV     + ++ H  +I G  + + +D     LI+  +D 
Sbjct: 158 GTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDN 217

Query: 185 MIKLWDL----KTQQCIETHIAHTG-ECWGLSVKDD--LLITTGTDSQVKLWKLN 232
           ++ LW      K+ + ++T  AH   E  G    +D     T G D+  ++  LN
Sbjct: 218 VLNLWRFNIKGKSSKLVKTIPAHLQIEACGFITHNDETFAYTAGGDAVFQIIDLN 272

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 65/152 (42%), Gaps = 17/152 (11%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +W++ TG+ ++TL       A+  RG    + ++ E  +    +A    D  +K+W L S
Sbjct: 521 LWNVDTGEPVATL-------ANHKRGL--WDVSFCESEK---WIATCSGDKTVKIWSLES 568

Query: 111 KTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFW 170
            TVL    GH  A+    F     +L+S   D  I VWD+     +  L  H + I    
Sbjct: 569 FTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALS 628

Query: 171 C-QGEDWLISTSKDGMIKLWDLKTQQCIETHI 201
             +  D +IS   D + + W    + C E  I
Sbjct: 629 VLEDGDLIISADADSVFQFW----KDCTEAEI 656

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 58/117 (49%), Gaps = 4/117 (3%)

Query: 387 LQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFE--CGYALTCKFLPGGL 443
           L   +  +  +   +  + +AT S + ++KIW++++   ++T E        C F+    
Sbjct: 533 LANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQK 592

Query: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
            ++    +G ++++D+AS   +  + D H   IW+L +  DG  +++  AD   +FW
Sbjct: 593 QLVSAGADGLIKVWDIASGDCIKNL-DGHSNRIWALSVLEDGDLIISADADSVFQFW 648

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 56/130 (43%), Gaps = 9/130 (6%)

Query: 108 LMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSIT 167
            + K+ +   + H+  I  +      +   + S D    +W++     +  L +HK    
Sbjct: 482 FIVKSSIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHK---R 538

Query: 168 GFW----CQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTG 221
           G W    C+ E W+ + S D  +K+W L++   ++T   HT      S   K   L++ G
Sbjct: 539 GLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAG 598

Query: 222 TDSQVKLWKL 231
            D  +K+W +
Sbjct: 599 ADGLIKVWDI 608

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 51/251 (20%), Positives = 94/251 (37%), Gaps = 62/251 (24%)

Query: 354 VLTTSNN-TIEYYSIPYEKREPTS-PAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS- 410
           ++T SN+ T++ + IP  K +    P  +K+          D+ +I ++ ++ + ATAS 
Sbjct: 456 IITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDSIFATASY 515

Query: 411 NGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIED 470
           + + K+WNV T + + T                                           
Sbjct: 516 DKTCKLWNVDTGEPVATLA----------------------------------------- 534

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLEL 530
            H   +W +      K + T S DKTVK W  +               +LK     TLE 
Sbjct: 535 NHKRGLWDVSFCESEKWIATCSGDKTVKIWSLES------------FTVLK-----TLEG 577

Query: 531 NDD-ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMII 589
           + + +         + L  +  D  +KV+ + S     +L GH   + ++ +  D  +II
Sbjct: 578 HTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLII 637

Query: 590 TSSADKNIKIW 600
           ++ AD   + W
Sbjct: 638 SADADSVFQFW 648

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 97.8 bits (242), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 84/357 (23%), Positives = 152/357 (42%), Gaps = 70/357 (19%)

Query: 379 PLKTHTIELQGQRTDMR-----SIDISDDNRLLATASNGSLKIWNVKTHKCIRTF----E 429
           P +   I+++  RT +       +  S++   LAT  N + KI+ V T   +       +
Sbjct: 301 PTQPKDIDIELHRTLLHDSVVCCVKFSNNGEYLATGCNKTTKIFEVATGNLVTELVDDTK 360

Query: 430 CG------------YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIW 477
            G            Y  +  F P G  +  G  +  ++++D+A   ++  +   H+  I+
Sbjct: 361 TGTEDANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLR-GHEQDIY 419

Query: 478 SLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSL 537
           SLD    G +LV+GS D+T++ WD       +                 TL + D + ++
Sbjct: 420 SLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSL-----------------TLSIEDGVTTV 462

Query: 538 RISPDD-RYLAISLLDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKM 587
            +SP +  Y+A   LD TV+V+  DS   +L         +  GHK  V S+  + D K 
Sbjct: 463 AVSPGNGNYVAAGSLDRTVRVW--DSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKN 520

Query: 588 IITSSADKNIKIWGLDF-------------GDCHKSLFAHQDSIMSVKFLPESHNFFSCS 634
           I++ S D+++K+W L               G+C  +   H+D ++SV          S S
Sbjct: 521 IVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGS 580

Query: 635 KDAVVKYWDGEKFECIQKLYAHQSEVWALAIS------TDGSFVVSSSHDHSIRIWE 685
           KD  V +WD      +  L  H++ V ++A++       + +   + S D   +IW+
Sbjct: 581 KDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWK 637

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 97/205 (47%), Gaps = 16/205 (7%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEV--HQDTDLLAVGY 98
           L T   +   ++++ TG+L++ L D    G  DA  A  A+     V    D   LA G 
Sbjct: 333 LATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATGA 392

Query: 99  ADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL-VGEVGLY 157
            D +I++WD+  + +++   GH+  I  L +  +G +L+SGS D  I +WDL  G+  L 
Sbjct: 393 EDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSL- 451

Query: 158 KLRSHKDSITGFWCQ--GEDWLISTSKDGMIKLWDLKTQQCI-------ETHIAHTGECW 208
              S +D +T         +++ + S D  +++WD  +   +       ET + H    +
Sbjct: 452 -TLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVY 510

Query: 209 GLS-VKDDLLITTGT-DSQVKLWKL 231
            +   +D   I +G+ D  VKLW L
Sbjct: 511 SVVFTRDGKNIVSGSLDRSVKLWNL 535

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 82/214 (38%), Gaps = 45/214 (21%)

Query: 49  VNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVW 106
           + +WD+ TG    TLS  DG+   A       P    Y         +A G  D  ++VW
Sbjct: 439 IRIWDLHTGQCSLTLSIEDGVTTVA-----VSPGNGNY---------VAAGSLDRTVRVW 484

Query: 107 DLMSKTVLLNFN-------GHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGL--- 156
           D  S  ++   +       GHK ++  + F   G  ++SGS D ++ +W+L    G    
Sbjct: 485 DSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTS 544

Query: 157 ----------YKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
                          HKD +      + + +++S SKD  +  WD  +   +     H  
Sbjct: 545 PQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRN 604

Query: 206 ECWGLSVKD--------DLLITTGTDSQVKLWKL 231
               ++V +        ++  T   D + K+WK 
Sbjct: 605 SVISVAVANGKPLGANYNVFATGSGDCKAKIWKF 638

 Score = 38.9 bits (89), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 68/167 (40%), Gaps = 29/167 (17%)

Query: 49  VNVWDIKTGDLMSTL-SDGLPPGASDARGAKPAECTYLEVH-QDTDLLAVGYADGVIKVW 106
           V VWD  +G L+  L S+G         G    +  Y  V  +D   +  G  D  +K+W
Sbjct: 481 VRVWDSNSGFLVERLDSEG-------ETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLW 533

Query: 107 DLMS-------------KTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
           +L +                 + + GHK  +  +        ++SGSKD  +I WD V  
Sbjct: 534 NLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSG 593

Query: 154 VGLYKLRSHKDSITGFWCQ-----GEDWLI--STSKDGMIKLWDLKT 193
           V L  L+ H++S+           G ++ +  + S D   K+W  +T
Sbjct: 594 VPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWKFQT 640

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 77/330 (23%), Positives = 142/330 (43%), Gaps = 60/330 (18%)

Query: 397 IDISDDNRLLATASNGSLKIWNVKTHKCIRTFECG--------------------YALTC 436
           +  S+D + LAT  N + +++   T + I T                        Y  + 
Sbjct: 404 VRFSNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSV 463

Query: 437 KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKT 496
            F P G  +  G  +  ++++D+ +  ++  I   H+  I+SLD    G++LV+GS DKT
Sbjct: 464 CFSPDGKFLAAGAEDKLIRIWDITTKQIV-MILKGHEQDIYSLDYFPSGEKLVSGSGDKT 522

Query: 497 VKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD-RYLAISLLDNTV 555
           V+ WD +     +                 TL + D + ++  SP++ +++A   LD + 
Sbjct: 523 VRIWDLRTGQCSL-----------------TLSIEDGVTTVSSSPNNGKFIAAGSLDRSA 565

Query: 556 KV------FFLDSMKFYLSLY-GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGD-- 606
           ++      F L  +     L  GHK  + S+  + D K +++ S D+++K+W LD  +  
Sbjct: 566 RIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNN 625

Query: 607 ----CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWA 662
               C  +   H+D ++SV          S SKD  V +WD      +  L  H++ V +
Sbjct: 626 SNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNSVIS 685

Query: 663 LAISTD-------GSFVVSSSHDHSIRIWE 685
           +A++         G F   S  D + +IW 
Sbjct: 686 VAVANGQPLGPEFGVFSTGSG-DFTAKIWR 714

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 110/227 (48%), Gaps = 18/227 (7%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLEL 530
           +H + +  +  ++DG+ L TG  +KT + +       +     D   P    N ++  + 
Sbjct: 396 SHPSVVCCVRFSNDGQFLATG-CNKTTRVYKTSTGELIATLLVD---PQSSNNSNSEQQT 451

Query: 531 NDD-----ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDS 585
           N +     I S+  SPD ++LA    D  ++++ + + +  + L GH+  + S+D     
Sbjct: 452 NPESSDLYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSG 511

Query: 586 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYWDG 644
           + +++ S DK ++IW L  G C  +L + +D + +V   P +  F +  S D   + WD 
Sbjct: 512 EKLVSGSGDKTVRIWDLRTGQCSLTL-SIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDT 570

Query: 645 EKFECIQKL-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           E    +++L         H+  +++++ + DG  +VS S D S+++W
Sbjct: 571 ETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLW 617

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 105/229 (45%), Gaps = 25/229 (10%)

Query: 387 LQGQRTDMRSID-ISDDNRLLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGL 443
           L+G   D+ S+D      +L++ + + +++IW+++T +C  T   E G          G 
Sbjct: 495 LKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGK 554

Query: 444 LVILGTRNGELQLFDLASSSLLDTI------EDAHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+ +   +++D  +  LL  +      ++ H  +I+S+  T DGK+LV+GS D++V
Sbjct: 555 FIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSV 614

Query: 498 KFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKV 557
           K W+    N       ++   +  + H       D +LS+  S +D Y+     D  V  
Sbjct: 615 KLWNLDTTN----NNSNESCEVTFIGH------KDFVLSVTTSQNDEYVLSGSKDRGVLF 664

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKM------IITSSADKNIKIW 600
           +  +S    L L GHK  V+S+ ++    +        T S D   KIW
Sbjct: 665 WDTNSGNPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIW 713

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 99/220 (45%), Gaps = 21/220 (9%)

Query: 36  SGPGQ-LITSALENVNVWDIKTGDLMSTL-SDGLPPGASDARGAKPAECTYLEVHQ---- 89
           S  GQ L T   +   V+   TG+L++TL  D      S++      E + L +      
Sbjct: 407 SNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYIRSVCFS 466

Query: 90  -DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVW 148
            D   LA G  D +I++WD+ +K +++   GH+  I  L +  +G +L+SGS D  + +W
Sbjct: 467 PDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIW 526

Query: 149 DL-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKT-------QQCIE 198
           DL  G+  L    S +D +T       +  ++ + S D   ++WD +T           +
Sbjct: 527 DLRTGQCSL--TLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTD 584

Query: 199 THIAHTGECWGLSVKDD--LLITTGTDSQVKLWKLNIEND 236
               H    + +S   D   L++   D  VKLW L+  N+
Sbjct: 585 LQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNN 624

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/230 (23%), Positives = 94/230 (40%), Gaps = 46/230 (20%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG         + V +WD++TG    TLS  DG+   +S     K    
Sbjct: 507 YFPSGEKLVSGSGD--------KTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGK---- 554

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNF-------NGHKAAITLLQFDGTGTR 135
                      +A G  D   ++WD  +  +L          NGHK +I  + F   G +
Sbjct: 555 ----------FIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKK 604

Query: 136 LISGSKDSNIIVWDL------VGEVGLYKLRSHKDSITGFWC-QGEDWLISTSKDGMIKL 188
           L+SGS D ++ +W+L        E        HKD +      Q +++++S SKD  +  
Sbjct: 605 LVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLF 664

Query: 189 WDLKTQQCIETHIAHTGECWGLSVKDDL-------LITTGT-DSQVKLWK 230
           WD  +   +     H      ++V +         + +TG+ D   K+W+
Sbjct: 665 WDTNSGNPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIWR 714

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 129/276 (46%), Gaps = 41/276 (14%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++DL +  ++ T++  H+  I+SLD    G +LV+G
Sbjct: 408 YIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLK-GHEQDIYSLDYFPSGNKLVSG 466

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISP-DDRYLAISL 550
           S D+TV+ WD      L  GT              TL + D + ++ +SP + +++A   
Sbjct: 467 SGDRTVRIWD------LTTGT-----------CSLTLSIEDGVTTVAVSPGEGKFIAAGS 509

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD TV+V      F ++ +     L  GH+  V S+  + D K +++ S D+++K+W L+
Sbjct: 510 LDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

Query: 604 -------FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
                    +C  +   H+D ++SV          S SKD  V +WD +    +  L  H
Sbjct: 570 GLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGH 629

Query: 657 QSEVWALAISTD-------GSFVVSSSHDHSIRIWE 685
           ++ V ++ ++         G F   S  D   RIW+
Sbjct: 630 RNSVISVTVANGHPLGPEYGVFATGSG-DCKARIWK 664

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 69/153 (45%), Gaps = 10/153 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WDL +K +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 417 DGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWD 476

Query: 150 LVGEVGLYKLRSHKDSITGFWCQGEDWLIST-SKDGMIKLWDLKTQQCIET-------HI 201
           L        L       T     GE   I+  S D  +++WD  T   +E          
Sbjct: 477 LTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGT 536

Query: 202 AHTGECWGLS-VKDDLLITTGT-DSQVKLWKLN 232
            H    + +   +D   + +G+ D  VKLW LN
Sbjct: 537 GHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 105/231 (45%), Gaps = 24/231 (10%)

Query: 385 IELQGQRTDMRSID-ISDDNRLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL-PG- 441
           + L+G   D+ S+D     N+L++ + + +++IW++ T  C  T      +T   + PG 
Sbjct: 442 MTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGE 501

Query: 442 GLLVILGTRNGELQLFDLASSSLLDTIED------AHDAAIWSLDLTSDGKRLVTGSADK 495
           G  +  G+ +  ++++D  +  L++ ++        H  +++S+  T DGK +V+GS D+
Sbjct: 502 GKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDR 561

Query: 496 TVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTV 555
           +VK W+    N L          +    H       D +LS+  + +D Y+     D  V
Sbjct: 562 SVKLWNL---NGLSGQKSHAECEVTYTGH------KDFVLSVATTQNDEYILSGSKDRGV 612

Query: 556 KVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM------IITSSADKNIKIW 600
             +   S    L L GH+  V+S+ ++    +        T S D   +IW
Sbjct: 613 LFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIW 663

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 2/113 (1%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + DK I+IW L+      +L  H+  I S+ + P  +   S 
Sbjct: 407 LYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSG 466

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
           S D  V+ WD     C   L + +  V  +A+S  +G F+ + S D ++R+W+
Sbjct: 467 SGDRTVRIWDLTTGTCSLTL-SIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWD 518

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 98/238 (41%), Gaps = 47/238 (19%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+ ++  SGSG           V +WD+ TG    TLS  DG+   A       P E 
Sbjct: 456 YFPSGNKLVSGSGD--------RTVRIWDLTTGTCSLTLSIEDGVTTVA-----VSPGEG 502

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
            ++         A G  D  ++VWD  +  ++   +       GH+ ++  + F   G  
Sbjct: 503 KFI---------AAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKG 553

Query: 136 LISGSKDSNIIVWDLVGEVGL-------YKLRSHKDSITGFWC-QGEDWLISTSKDGMIK 187
           ++SGS D ++ +W+L G  G             HKD +      Q +++++S SKD  + 
Sbjct: 554 VVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVL 613

Query: 188 LWDLKTQQCIETHIAHTGECWGLSVKD--------DLLITTGTDSQVKLWKLNIENDK 237
            WD K+   +     H      ++V +         +  T   D + ++WK + +N +
Sbjct: 614 FWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIWKYSKKNSQ 671

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 40/70 (57%)

Query: 618 IMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSH 677
           I SV F P+     + ++D +++ WD E  + +  L  H+ ++++L     G+ +VS S 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSG 468

Query: 678 DHSIRIWEET 687
           D ++RIW+ T
Sbjct: 469 DRTVRIWDLT 478

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 87/383 (22%), Positives = 163/383 (42%), Gaps = 77/383 (20%)

Query: 362 IEYYSIPYEKREPT-------SPAPLKTHTIELQG---QRTDMRSIDISDDNRLLATASN 411
           ++Y  +P   R+ T       +PA  +T  +EL       + +  +  S+D + LAT  N
Sbjct: 276 LDYKQVPENLRKKTEEYDVLYNPALPRTLEVELHKSLEHTSVVCCVKFSNDGQYLATGCN 335

Query: 412 GSLKIWNVKTHKCIR--------TFECG-----------YALTCKFLPGGLLVILGTRNG 452
            + +++ V   + +         + + G           Y  +  F P G  +  G  + 
Sbjct: 336 KTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGKFLATGAEDR 395

Query: 453 ELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGT 512
            ++++DLA   ++  ++  HD  ++SLD    G +LV+GS D+TV+ WD +     +   
Sbjct: 396 LIRIWDLAQQKIVMVLQ-GHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSL--- 451

Query: 513 KDKFLPILKLNHDTTLELNDDILSLRISP-DDRYLAISLLDNTVKV------FFLDSMKF 565
                         TL + D + ++ +SP D +Y+A   LD  V+V      F ++ +  
Sbjct: 452 --------------TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDS 497

Query: 566 YLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL-------DFGD---------CH 608
              L  GH+  V S+  + D   +++SS D+++K+W L       +  D         C 
Sbjct: 498 ENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEKENAADNNKSQSSVVCE 557

Query: 609 KSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST- 667
            +   H+D ++SV          S SKD  V +WD      +  L  H++ V ++A++  
Sbjct: 558 VTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTNTGNPLLMLQGHRNSVISVAVANG 617

Query: 668 -----DGSFVVSSSHDHSIRIWE 685
                +     + S D   RIW+
Sbjct: 618 HPLGPEYQVFATGSGDCRARIWK 640

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/214 (25%), Positives = 95/214 (44%), Gaps = 19/214 (8%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQ-----DTDLLA 95
           L T   +   V+ +  G+L++ LSD   P   +      +  T L +       D   LA
Sbjct: 330 LATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLYIRSVCFSPDGKFLA 389

Query: 96  VGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL-VGEV 154
            G  D +I++WDL  + +++   GH   +  L +  +G +L+SGS D  + +WDL  G+ 
Sbjct: 390 TGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQC 449

Query: 155 GLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQQCIET-------HIAHTG 205
            L    S +D +T       D  ++ + S D  +++WD +T   +E           H  
Sbjct: 450 SL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHRD 507

Query: 206 ECWGLSVKDD--LLITTGTDSQVKLWKLNIENDK 237
             + +    D   ++++  D  VKLW L   N+K
Sbjct: 508 SVYSVVFTRDGNKVVSSSLDRSVKLWNLRGYNEK 541

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/242 (20%), Positives = 93/242 (38%), Gaps = 56/242 (23%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD+KTG    TLS  DG+   A       P + 
Sbjct: 423 YFPSGDKLVSGSGD--------RTVRIWDLKTGQCSLTLSIEDGVTTVA-----VSPGDG 469

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
            Y+         A G  D  ++VWD  +  ++   +       GH+ ++  + F   G +
Sbjct: 470 KYI---------AAGSLDRAVRVWDSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNK 520

Query: 136 LISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQ-----------------GEDWLI 178
           ++S S D ++ +W+L G         +  S +   C+                  +++++
Sbjct: 521 VVSSSLDRSVKLWNLRGYNEKENAADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVL 580

Query: 179 STSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKD--------DLLITTGTDSQVKLWK 230
           S SKD  +  WD  T   +     H      ++V +         +  T   D + ++WK
Sbjct: 581 SGSKDRGVLFWDTNTGNPLLMLQGHRNSVISVAVANGHPLGPEYQVFATGSGDCRARIWK 640

Query: 231 LN 232
            +
Sbjct: 641 FS 642

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 126/282 (44%), Gaps = 48/282 (17%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++D+ +  ++  I   H+  I+SLD    G +LV+G
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +SP D +Y+A   
Sbjct: 504 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 547 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD +    
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 664

Query: 650 IQKLYAHQSEVWALAISTDGSF------VVSSSHDHSIRIWE 685
           +  L  H++ V ++A++             + S D   RIW+
Sbjct: 665 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 83/172 (48%), Gaps = 14/172 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+ ++ +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 454 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 513

Query: 150 L-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQQCI-------ET 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +       E+
Sbjct: 514 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 571

Query: 200 HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKLNIENDKLGGKLTEMGTFE 249
              H    + +   +D   + +G+ D  VKLW L   N+K   K    GT E
Sbjct: 572 GTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 623

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 109/229 (47%), Gaps = 19/229 (8%)

Query: 387 LQGQRTDMRSID-ISDDNRLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL-PG-GL 443
           LQG   D+ S+D     ++L++ + + +++IW+++T +C  T      +T   + PG G 
Sbjct: 481 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 540

Query: 444 LVILGTRNGELQLFDLASSSLLDTIED------AHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+ +  ++++D  +  L++ ++        H  +++S+  T DG+ +V+GS D++V
Sbjct: 541 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV 600

Query: 498 KFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKV 557
           K W+ Q  N       D   P       T +   D +LS+  + +D Y+     D  V  
Sbjct: 601 KLWNLQNAN----NKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 656

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKM------IITSSADKNIKIW 600
           +   S    L L GH+  V+S+ ++  S +        T S D   +IW
Sbjct: 657 WDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L + +  V  +A+S  DG ++ + S D ++R+W+
Sbjct: 504 SGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 96/238 (40%), Gaps = 56/238 (23%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD++TG    TLS  DG+   A       P + 
Sbjct: 493 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGVTTVA-----VSPGDG 539

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLL---------NFNGHKAAITLLQFDGTG 133
            Y+         A G  D  ++VWD  S+T  L         +  GHK ++  + F   G
Sbjct: 540 KYI---------AAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDG 588

Query: 134 TRLISGSKDSNIIVWDLVGEVGLYKLRS------------HKDSITGFWC-QGEDWLIST 180
             ++SGS D ++ +W+L         ++            HKD +      Q +++++S 
Sbjct: 589 QSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 648

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKD--------DLLITTGTDSQVKLWK 230
           SKD  +  WD K+   +     H      ++V +        ++  T   D + ++WK
Sbjct: 649 SKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/295 (24%), Positives = 128/295 (43%), Gaps = 39/295 (13%)

Query: 393 DMRSIDISDDNRLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRN 451
           DM  ++ SDD RL AT    S +KIW++           G +L    LP         + 
Sbjct: 481 DMSCLEFSDDCRLAATGFQDSFIKIWSLD----------GSSLVTNKLPS-------YKK 523

Query: 452 GELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPG 511
            E+      +SSLL      H  A++S   + D K L++GS DKTV+ W      TLV  
Sbjct: 524 EEILTTGDETSSLLI----GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLV-- 577

Query: 512 TKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                         +    N  +  ++ SP   Y A +  D T +++  D +       G
Sbjct: 578 --------------SYKGHNHPVWDVKFSPMGHYFATASHDQTARLWSCDHIYPLRIFAG 623

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V ++    +   + T SADK  ++W +  GD  +    H   +++    P+     
Sbjct: 624 HLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLC 683

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           +  +D V+  WD    + ++++  H ++ + + + + +G+ ++S   DHS+R+W+
Sbjct: 684 TGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWD 738

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 73/175 (41%), Gaps = 20/175 (11%)

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLS--------------------LY 570
           N D+  L  S D R  A    D+ +K++ LD      +                    L 
Sbjct: 479 NKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEILTTGDETSSLLI 538

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V S   S D+K +++ S DK +++W +D      S   H   +  VKF P  H F
Sbjct: 539 GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYF 598

Query: 631 FSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            + S D   + W  +    ++    H ++V  ++   +G +V + S D + R+W+
Sbjct: 599 ATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWD 653

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 47/108 (43%), Gaps = 13/108 (12%)

Query: 44  SALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVI 103
           SA +   +WDI TGD +        P  + A            V  D   L  G  DGVI
Sbjct: 644 SADKTCRMWDISTGDSVRLFLGHTAPVLTTA------------VTPDGRWLCTGGEDGVI 691

Query: 104 KVWDLMSKTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
            VWD+ +   L    GH K AI    F+  G  LISG  D ++ VWDL
Sbjct: 692 NVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDL 739

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 52/107 (48%), Gaps = 2/107 (1%)

Query: 88  HQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIV 147
           H +   +  G AD   ++WD+ +   +  F GH A +        G  L +G +D  I V
Sbjct: 634 HPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGGEDGVINV 693

Query: 148 WDLVGEVGLYKLRSH-KDSITGFWCQGE-DWLISTSKDGMIKLWDLK 192
           WD+     L ++R H K++I  F    E + LIS   D  +++WDLK
Sbjct: 694 WDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK 740

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 64/160 (40%), Gaps = 10/160 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 552 DNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTARLWS 611

Query: 150 LVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
                 L     H + +    F   G  ++ + S D   ++WD+ T   +   + HT   
Sbjct: 612 CDHIYPLRIFAGHLNDVETVSFHPNGC-YVFTGSADKTCRMWDISTGDSVRLFLGHTAPV 670

Query: 208 WGLSVKDD--LLITTGTDSQVKLWKLNIENDKLGGKLTEM 245
              +V  D   L T G D  + +W +       G +L +M
Sbjct: 671 LTTAVTPDGRWLCTGGEDGVINVWDIGT-----GKRLKQM 705

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 59/143 (41%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 598 FATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTG 657

Query: 154 VGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---W 208
             +     H   +  T     G  WL +  +DG+I +WD+ T + ++    H       +
Sbjct: 658 DSVRLFLGHTAPVLTTAVTPDGR-WLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSF 716

Query: 209 GLSVKDDLLITTGTDSQVKLWKL 231
             + + ++LI+ G D  V++W L
Sbjct: 717 SFNKEGNILISGGADHSVRVWDL 739

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 63/188 (33%), Gaps = 36/188 (19%)

Query: 79  PAECTY-----------LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLN----------- 116
           P+ C Y           LE   D  L A G+ D  IK+W L   +++ N           
Sbjct: 468 PSVCMYTFHNTNKDMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEIL 527

Query: 117 ---------FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI- 166
                      GH  A+    F      L+SGS+D  + +W +     L   + H   + 
Sbjct: 528 TTGDETSSLLIGHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVW 587

Query: 167 -TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDD--LLITTGTD 223
              F   G  +  + S D   +LW       +     H  +   +S   +   + T   D
Sbjct: 588 DVKFSPMGH-YFATASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSAD 646

Query: 224 SQVKLWKL 231
              ++W +
Sbjct: 647 KTCRMWDI 654

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 127/284 (44%), Gaps = 46/284 (16%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++D+A   ++  ++  H+  I+SLD    G +LV+G
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 435

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISP-DDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +SP D +++A   
Sbjct: 436 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 478

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 479 LDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 538

Query: 603 -----------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
                        G C  +   H+D ++SV          S SKD  V +WD +    + 
Sbjct: 539 GDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNPLL 598

Query: 652 KLYAHQSEVWALAISTD-------GSFVVSSSHDHSIRIWEETE 688
            L  H++ V ++A++         G F   S  D   RIW+ T+
Sbjct: 599 MLQGHRNSVISVAVANGFPLGPQYGVFATGSG-DCKARIWKYTK 641

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 83/173 (47%), Gaps = 16/173 (9%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 386 DGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 445

Query: 150 L-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQQCIET------- 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +E        
Sbjct: 446 LRTGQCSL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENEL 503

Query: 200 HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKLNIE-NDKLGGKLTEMGTFE 249
              H    + +   +D   + +G+ D  VKLW L  + N+   GK T  GT E
Sbjct: 504 GTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRGDKNNSSSGKPTP-GTCE 555

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 90/215 (41%), Gaps = 28/215 (13%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELN 531
           H + +  +  ++DG+ L TG  +KT +   F+V +  +                    L+
Sbjct: 300 HTSVVCCVRFSNDGEYLATG-CNKTTQV--FRVSDGAL-----------------IARLS 339

Query: 532 DDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITS 591
           DD  S   +P          +N V  F + +      LY     + S+  S D K + T 
Sbjct: 340 DDAASQVAAPAGSPANADEPNNDVNSF-VTAKSASSDLY-----IRSVCFSPDGKFLATG 393

Query: 592 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
           + D+ I+IW +        L  H+  I S+ + P      S S D  V+ WD    +C  
Sbjct: 394 AEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL 453

Query: 652 KLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
            L + +  V  +A+S  DG F+ + S D ++R+W+
Sbjct: 454 TL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD 487

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 53/236 (22%), Positives = 96/236 (40%), Gaps = 52/236 (22%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD++TG    TLS  DG+               
Sbjct: 425 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV--------------T 462

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
           T      D   +A G  D  ++VWD  +  ++   +       GHK ++  + F   G  
Sbjct: 463 TVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNG 522

Query: 136 LISGSKDSNIIVWDLVGE----------VGLYKL--RSHKDSITGFW-CQGEDWLISTSK 182
           ++SGS D ++ +W+L G+           G  ++    HKD +      Q + +++S SK
Sbjct: 523 VVSGSLDRSVKLWNLRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSK 582

Query: 183 DGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDL-------LITTGT-DSQVKLWK 230
           D  +  WD ++   +     H      ++V +         +  TG+ D + ++WK
Sbjct: 583 DRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWK 638

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 126/282 (44%), Gaps = 45/282 (15%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++D+A   ++  ++  H+  I+SLD    G +LV+G
Sbjct: 464 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 522

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISP-DDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +SP D +Y+A   
Sbjct: 523 SGDRTVRIWDLRNGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 565

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 566 LDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLR 625

Query: 604 -----------FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQK 652
                       G C  +   H+D ++SV          S SKD  V +WD +    +  
Sbjct: 626 GDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLM 685

Query: 653 LYAHQSEVWALAISTD-------GSFVVSSSHDHSIRIWEET 687
           L  H++ V ++A++         G F   S  D   RIW+ T
Sbjct: 686 LQGHRNSVISVAVANGFPLGPNVGVFATGSG-DCKARIWKYT 726

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 78/160 (48%), Gaps = 14/160 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 473 DGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 532

Query: 150 LV-GEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQQCIET------- 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +E        
Sbjct: 533 LRNGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENEL 590

Query: 200 HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKLNIENDK 237
              H    + +   +D   + +G+ D  VKLW L  +N++
Sbjct: 591 GTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQ 630

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/235 (22%), Positives = 97/235 (41%), Gaps = 51/235 (21%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD++ G    TLS  DG+           P + 
Sbjct: 512 YFPSGDKLVSGSG--------DRTVRIWDLRNGQCSLTLSIEDGV-----TTVAVSPGDG 558

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
            Y+         A G  D  ++VWD  +  ++   +       GHK ++  + F   G  
Sbjct: 559 KYI---------AAGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNN 609

Query: 136 LISGSKDSNIIVWDLVGE---------VGLYKLR--SHKDSITGFWC-QGEDWLISTSKD 183
           ++SGS D ++ +W+L G+          G  ++    HKD +      Q +++++S SKD
Sbjct: 610 VVSGSLDRSVKLWNLRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKD 669

Query: 184 GMIKLWDLKTQQCIETHIAHTGECWGLSVKDDL-------LITTGT-DSQVKLWK 230
             +  WD K+   +     H      ++V +         +  TG+ D + ++WK
Sbjct: 670 RGVLFWDTKSGNPLLMLQGHRNSVISVAVANGFPLGPNVGVFATGSGDCKARIWK 724

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 95.5 bits (236), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 138/316 (43%), Gaps = 48/316 (15%)

Query: 399 ISDDNRLLATASNGSLKIWNVKTHKCIRTFECG--YALTCKFLPGGLLVILGTRNGELQL 456
           +S+D     + ++ S    N K    + T      Y  +  F P G  +  G  +  +++
Sbjct: 437 LSEDASSAPSGADASATSENAKASPAVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRI 496

Query: 457 FDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKF 516
           +DLA+  ++ T++  H+  I+SLD    G +LV+GS D+TV+ WD +     +       
Sbjct: 497 WDLATRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL------- 548

Query: 517 LPILKLNHDTTLELNDDILSLRISP-DDRYLAISLLDNTVKV------FFLDSMKFYLSL 569
                     TL + D + ++ +SP D + +A   LD TV++      F ++ +     L
Sbjct: 549 ----------TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENEL 598

Query: 570 -YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL------------DFGDCHKSLFAHQD 616
             GHK  V S+  + D   +++ S D+++K+W L            +      +   H+D
Sbjct: 599 GTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKD 658

Query: 617 SIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTD-------G 669
            ++SV          S SKD  V +WD      +  L  H++ V ++A++ D       G
Sbjct: 659 FVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYG 718

Query: 670 SFVVSSSHDHSIRIWE 685
            F   S  D   RIW+
Sbjct: 719 VFATGSG-DCKARIWK 733

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 103/224 (45%), Gaps = 31/224 (13%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSD---GLPPGA-----SDARGAKPAECT------YLE 86
           L T   +   V+ + TG+L++ LS+     P GA     S+   A PA  T      Y+ 
Sbjct: 415 LATGCNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAKASPAVATSASSDLYIR 474

Query: 87  ---VHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDS 143
                 D   LA G  D +I++WDL ++ +++   GH+  I  L +  +G +L+SGS D 
Sbjct: 475 SVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDR 534

Query: 144 NIIVWDL-VGEVGLYKLRSHKDSITGFWCQ-GEDWLIST-SKDGMIKLWDLKTQQCIET- 199
            + +WDL  G+  L    S +D +T      G+  LI+  S D  +++WD +T   +E  
Sbjct: 535 TVRIWDLRTGQCSL--TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERL 592

Query: 200 ------HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKLNIEN 235
                    H    + +   +D   + +G+ D  VKLW L   N
Sbjct: 593 DSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSAN 636

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 98/251 (39%), Gaps = 52/251 (20%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD++TG    TLS  DG+               
Sbjct: 520 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV--------------T 557

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
           T      D  L+A G  D  +++WD  +  ++   +       GHK ++  + F   G  
Sbjct: 558 TVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHG 617

Query: 136 LISGSKDSNIIVWDLVGEVG------------LYKLRSHKDSITGFW-CQGEDWLISTSK 182
           ++SGS D ++ +W+L    G                  HKD +      Q +++++S SK
Sbjct: 618 VVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSK 677

Query: 183 DGMIKLWDLKTQQCIETHIAHTGECWGLSVKDD--------LLITTGTDSQVKLWKLNIE 234
           D  +  WD  +   +     H      ++V +D        +  T   D + ++WK + +
Sbjct: 678 DRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYSKQ 737

Query: 235 NDKLGGKLTEM 245
                 KL E+
Sbjct: 738 TSNAEPKLREV 748

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 127/295 (43%), Gaps = 34/295 (11%)

Query: 393 DMRSIDISDDNRLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRN 451
           DM S+D S+D+RL A     S +K+W++      +  +                +  + +
Sbjct: 521 DMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGD----------------VSSSPS 564

Query: 452 GELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPG 511
                 D  S    +T    H  A++S   + D K L++GS DKTV+ W      TLV  
Sbjct: 565 PSATTADKYSKDFTNTTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLV-- 622

Query: 512 TKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                         +    N  +  ++ SP   Y A +  D T +++  D +       G
Sbjct: 623 --------------SYKGHNHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYPLRIFAG 668

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V  +    +   + T S+DK  ++W +  GD  +    H   ++S    P+     
Sbjct: 669 HLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLS 728

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           + S+D ++  WD    + ++ +  H ++ +++L+ S +G+ +VSS  DHS+R+W+
Sbjct: 729 TGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWD 783

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 78/180 (43%), Gaps = 25/180 (13%)

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLD--SMKFY---------------------- 566
           N D+ SL  S D R  A    D+ +K++ LD  S+K Y                      
Sbjct: 519 NRDMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFT 578

Query: 567 -LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP 625
             +L GH   V S   S D+K +I+ S DK +++W LD      S   H   +  VKF P
Sbjct: 579 NTTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSP 638

Query: 626 ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
             H F + S D   + W  +    ++    H S+V  ++   +G +V + S D + R+W+
Sbjct: 639 LGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWD 698

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 63/143 (44%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+   
Sbjct: 643 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 702

Query: 154 VGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWGL 210
             +     H   +  T     G  WL + S+DG+I +WD+ T + ++    H     + L
Sbjct: 703 DSVRLFLGHTAPVISTAVSPDGR-WLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSL 761

Query: 211 SV--KDDLLITTGTDSQVKLWKL 231
           S   + ++L+++G D  V++W L
Sbjct: 762 SYSKEGNVLVSSGADHSVRVWDL 784

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/148 (21%), Positives = 59/148 (39%), Gaps = 9/148 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W L + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 597 DNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLWS 656

Query: 150 LVGEVGLYKLRSHKDSITGFWC----QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
                 +Y LR     ++   C        ++ + S D   ++WD+ T   +   + HT 
Sbjct: 657 C---DHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTA 713

Query: 206 ECWGLSVKDD--LLITTGTDSQVKLWKL 231
                +V  D   L T   D  + +W +
Sbjct: 714 PVISTAVSPDGRWLSTGSEDGIINVWDI 741

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +        G  L +GS+D  
Sbjct: 676 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGI 735

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L  +R H K++I    + +  + L+S+  D  +++WDLK
Sbjct: 736 INVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLK 785

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 61/181 (33%), Gaps = 36/181 (19%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDL----------------------------MSKT 112
           + T L+  +D+ L A G+ D  IK+W L                             + T
Sbjct: 521 DMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNT 580

Query: 113 VLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI--TGFW 170
            L+   GH  A+    F      LISGS+D  + +W L     L   + H   +    F 
Sbjct: 581 TLI---GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFS 637

Query: 171 CQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWGLSVKDDLLITTGTDSQVKL 228
             G  +  + S D   +LW       +     H    +C         + T  +D   ++
Sbjct: 638 PLGH-YFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRM 696

Query: 229 W 229
           W
Sbjct: 697 W 697

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 125/282 (44%), Gaps = 48/282 (17%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++D+ +  ++  I   H+  I+SLD    G +LV+G
Sbjct: 445 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +SP D +Y+A   
Sbjct: 504 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 546

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 547 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWN 604

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD      
Sbjct: 605 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSGNP 664

Query: 650 IQKLYAHQSEVWALAISTDGSF------VVSSSHDHSIRIWE 685
           +  L  H++ V ++A++             + S D   RIW+
Sbjct: 665 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 83/172 (48%), Gaps = 14/172 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+ ++ +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 454 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 513

Query: 150 L-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQQCI-------ET 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +       E+
Sbjct: 514 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 571

Query: 200 HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKLNIENDKLGGKLTEMGTFE 249
              H    + +   +D   + +G+ D  VKLW L   N+K   K    GT E
Sbjct: 572 GTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 623

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 109/229 (47%), Gaps = 19/229 (8%)

Query: 387 LQGQRTDMRSID-ISDDNRLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL-PG-GL 443
           LQG   D+ S+D     ++L++ + + +++IW+++T +C  T      +T   + PG G 
Sbjct: 481 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 540

Query: 444 LVILGTRNGELQLFDLASSSLLDTIED------AHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+ +  ++++D  +  L++ ++        H  +++S+  T DG+ +V+GS D++V
Sbjct: 541 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV 600

Query: 498 KFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKV 557
           K W+ Q  N       D   P       T +   D +LS+  + +D Y+     D  V  
Sbjct: 601 KLWNLQNAN----NKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 656

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKM------IITSSADKNIKIW 600
           +   S    L L GH+  V+S+ ++  S +        T S D   +IW
Sbjct: 657 WDKTSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIW 705

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 444 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 503

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L + +  V  +A+S  DG ++ + S D ++R+W+
Sbjct: 504 SGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 555

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 96/238 (40%), Gaps = 56/238 (23%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD++TG    TLS  DG+   A       P + 
Sbjct: 493 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGVTTVA-----VSPGDG 539

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLL---------NFNGHKAAITLLQFDGTG 133
            Y+         A G  D  ++VWD  S+T  L         +  GHK ++  + F   G
Sbjct: 540 KYI---------AAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDG 588

Query: 134 TRLISGSKDSNIIVWDL----------VGEVGLYKLR--SHKDSITGFWC-QGEDWLIST 180
             ++SGS D ++ +W+L              G  ++    HKD +      Q +++++S 
Sbjct: 589 QSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 648

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKD--------DLLITTGTDSQVKLWK 230
           SKD  +  WD  +   +     H      ++V +        ++  T   D + ++WK
Sbjct: 649 SKDRGVLFWDKTSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 131/294 (44%), Gaps = 34/294 (11%)

Query: 410 SNGSLKIWNVKTHK---CIRTFE-CGYALTC-KFLPGGLLVILGTRNGELQLFDL----A 460
           S  ++K+ N++T     C+ TF      +TC +F     LV  G ++  ++L+ L     
Sbjct: 462 SRDAIKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPL 521

Query: 461 SSSLLDTIEDA--------HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGT 512
            S L    +DA        H   ++S+  + D + LV+ S DKTV+ W       LV   
Sbjct: 522 ESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV--- 578

Query: 513 KDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGH 572
                        +    N  +  ++ SP   Y A    D T +++  D +       GH
Sbjct: 579 -------------SYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGH 625

Query: 573 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFS 632
              V  +    +   ++T S+DK  ++W +  GD  +    H  S++SV   P+     +
Sbjct: 626 LNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTT 685

Query: 633 CSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            S+D V+  WD    + I+++  H +S V++L+ + +G+ +VS   D S+R+W+
Sbjct: 686 GSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWD 739

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 85/175 (48%), Gaps = 14/175 (8%)

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKF-------------YLSLYGHKLPVL 577
           N ++  LR S D R +A    D+ +K++ LD                  ++L GH  PV 
Sbjct: 487 NREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVY 546

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S+  S D++ ++++S DK +++W LD   C  S   H   +  VKF P  H F + S D 
Sbjct: 547 SVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQ 606

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE-ETEDQV 691
             + W  +    ++    H ++V  +    +G++V++ S D + R+W+ +T D V
Sbjct: 607 TARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSV 661

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 117/240 (48%), Gaps = 24/240 (10%)

Query: 368 PYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIR 426
           P E + P S A   ++T+ L G    + S+  S DNR L +AS + ++++W++ T+ C+ 
Sbjct: 520 PLESQLP-SKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLV 578

Query: 427 TFECGYALTC---KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTS 483
           +++ G+       KF P G     G+ +   +L+       L  I   H   +  +    
Sbjct: 579 SYK-GHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPL-RIFAGHLNDVDCVTFHP 636

Query: 484 DGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD 543
           +G  ++TGS+DKT + WD Q  +++           L L H  +      ++S+ +SPD 
Sbjct: 637 NGTYVLTGSSDKTCRMWDIQTGDSVR----------LFLGHTAS------VVSVAVSPDG 680

Query: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           R+L     D  + V+ + + K    + GH K  V S+  + +  ++++  AD+++++W L
Sbjct: 681 RWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 64/142 (45%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A G  D   ++W       L  F GH   +  + F   GT +++GS D    +WD+   
Sbjct: 599 FATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTG 658

Query: 154 VGLYKLRSHKDSITGFWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWGLS 211
             +     H  S+       +  WL + S+DG+I +WD+ T + I+    H     + LS
Sbjct: 659 DSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLS 718

Query: 212 V--KDDLLITTGTDSQVKLWKL 231
              + ++L++ G D  V++W L
Sbjct: 719 FNKEGNILVSGGADQSVRVWDL 740

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 54/108 (50%), Gaps = 4/108 (3%)

Query: 88  HQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A++  +     G  L +GS+D  IIV
Sbjct: 635 HPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIV 694

Query: 148 WDLVGEVGLYKLRSHKDSIT---GFWCQGEDWLISTSKDGMIKLWDLK 192
           WD+     + ++R H  S      F  +G + L+S   D  +++WDLK
Sbjct: 695 WDIGTGKRIKQMRGHGKSAVYSLSFNKEG-NILVSGGADQSVRVWDLK 741

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 50/111 (45%), Gaps = 13/111 (11%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYAD 100
           L  S+ +   +WDI+TGD +                   A    + V  D   L  G  D
Sbjct: 642 LTGSSDKTCRMWDIQTGDSVRLFL------------GHTASVVSVAVSPDGRWLTTGSED 689

Query: 101 GVIKVWDLMSKTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
           GVI VWD+ +   +    GH K+A+  L F+  G  L+SG  D ++ VWDL
Sbjct: 690 GVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRNGELQLFDLASS 462
           +L  +S+ + ++W+++T   +R F       ++    P G  +  G+ +G + ++D+ + 
Sbjct: 641 VLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTG 700

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD---FQVENTLVP 510
             +  +     +A++SL    +G  LV+G AD++V+ WD   F  E +L P
Sbjct: 701 KRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPSLEP 751

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 64/148 (43%), Gaps = 9/148 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L     D  +++W L + T L+++ GH   +  ++F   G    +GS D    +W 
Sbjct: 553 DNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWS 612

Query: 150 LVGEVGLYKLRSHKDSITGFWC----QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
                 +Y LR     +    C        ++++ S D   ++WD++T   +   + HT 
Sbjct: 613 C---DHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTA 669

Query: 206 ECWGLSVKDD-LLITTGT-DSQVKLWKL 231
               ++V  D   +TTG+ D  + +W +
Sbjct: 670 SVVSVAVSPDGRWLTTGSEDGVIIVWDI 697

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 61/170 (35%), Gaps = 22/170 (12%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDL---------------MSKTVLLNFNGHKAAIT 125
           E T L    D+ L+A G+ D  IK+W L                S TV L   GH   + 
Sbjct: 489 EMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI--GHSGPVY 546

Query: 126 LLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKD 183
            + F      L+S S+D  + +W L     L   + H   +    F   G  +  + S D
Sbjct: 547 SVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGH-YFATGSHD 605

Query: 184 GMIKLWDLKTQQCIETHIAHTG--ECWGLSVKDDLLITTGTDSQVKLWKL 231
              +LW       +     H    +C         ++T  +D   ++W +
Sbjct: 606 QTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDI 655

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 54/132 (40%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVG---EVGL-YKLRSHKDSITGF 169
           +  F+     +T L+F      + +G +DS I +W L G   E  L  K +   +++T  
Sbjct: 480 MYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI 539

Query: 170 WCQGE----------DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGL--SVKDDLL 217
              G            +L+S S+D  ++LW L T  C+ ++  H    W +  S      
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 218 ITTGTDSQVKLW 229
            T   D   +LW
Sbjct: 600 ATGSHDQTARLW 611

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 131/298 (43%), Gaps = 37/298 (12%)

Query: 393 DMRSIDISDDNRLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGG--LLVILGT 449
           DM S++ SDD RL +T    S +KIW++           G +L  KF         I  T
Sbjct: 457 DMTSLEFSDDCRLASTGFQDSYIKIWSLD----------GTSLNTKFTQANKDRNRITIT 506

Query: 450 RNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLV 509
                 + +  S++L+      H   ++S   + D + L++GS DKTV+ W       LV
Sbjct: 507 DRSLTHMDNELSATLI-----GHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALV 561

Query: 510 PGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL 569
                           +    N  I  ++ SP   Y A +  D T +++  D + F L +
Sbjct: 562 ----------------SYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSCDHI-FPLRI 604

Query: 570 Y-GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESH 628
           + GH   V  +    +   + T S+DK  ++W +  GD  +    H  +++S    P+  
Sbjct: 605 FAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGR 664

Query: 629 NFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
              + S D  +  WD    + ++ L  H ++ V++L  S +G+ +VSS  D S+R+W+
Sbjct: 665 WLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWD 722

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 77/183 (42%), Gaps = 28/183 (15%)

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLD----SMKFY-------------------- 566
           N D+ SL  S D R  +    D+ +K++ LD    + KF                     
Sbjct: 455 NQDMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITITDRSLTHMD 514

Query: 567 ----LSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVK 622
                +L GH   V S   S D++ +I+ S DK +++W LD      S   H   I  V+
Sbjct: 515 NELSATLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQ 574

Query: 623 FLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIR 682
           F P  H F + S D   + W  +    ++    H ++V  ++   +G +V + S D + R
Sbjct: 575 FSPLGHYFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCR 634

Query: 683 IWE 685
           +W+
Sbjct: 635 MWD 637

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 103/221 (46%), Gaps = 23/221 (10%)

Query: 387 LQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYALT---CKFLPGG 442
           L G    + S   S DNR L + S + ++++W++ TH  + +++ G+       +F P G
Sbjct: 521 LIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYK-GHNHPIWDVQFSPLG 579

Query: 443 LLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
                 + +   +L+       L  I   H   +  +    +G  + TGS+DKT + WD 
Sbjct: 580 HYFATASHDQTARLWSCDHIFPL-RIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDI 638

Query: 503 QVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS 562
              +++           L L H +       ++S  +SPD R+L     D T+ V+ + S
Sbjct: 639 STGDSVR----------LFLGHTSA------VVSTAVSPDGRWLTTGSDDGTINVWDIGS 682

Query: 563 MKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
            K   SL GH K  V S+  S +  ++++S AD+++++W L
Sbjct: 683 GKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 61/146 (41%), Gaps = 5/146 (3%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W L + T L+++ GH   I  +QF   G    + S D    +W 
Sbjct: 536 DNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLGHYFATASHDQTARLWS 595

Query: 150 LVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
                 L     H + +    F   G  ++ + S D   ++WD+ T   +   + HT   
Sbjct: 596 CDHIFPLRIFAGHLNDVDCVSFHPNGY-YVFTGSSDKTCRMWDISTGDSVRLFLGHTSAV 654

Query: 208 WGLSVKDD-LLITTGT-DSQVKLWKL 231
              +V  D   +TTG+ D  + +W +
Sbjct: 655 VSTAVSPDGRWLTTGSDDGTINVWDI 680

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 59/143 (41%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 582 FATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTG 641

Query: 154 VGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDL---KTQQCIETHIAHTGECW 208
             +     H  ++  T     G  WL + S DG I +WD+   K  + +  H  +     
Sbjct: 642 DSVRLFLGHTSAVVSTAVSPDGR-WLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSL 700

Query: 209 GLSVKDDLLITTGTDSQVKLWKL 231
             S + +LL+++G D  V++W L
Sbjct: 701 TYSKEGNLLVSSGADQSVRVWDL 723

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 2/109 (1%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH +A+        G  L +GS D  
Sbjct: 615 VSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGT 674

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDL 191
           I VWD+     L  LR H K+++    + +  + L+S+  D  +++WDL
Sbjct: 675 INVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 42/101 (41%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +WDI TGD +           S A            V  D   L  G  DG I VWD+ S
Sbjct: 635 MWDISTGDSVRLFLGHTSAVVSTA------------VSPDGRWLTTGSDDGTINVWDIGS 682

Query: 111 KTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
              L +  GH K A+  L +   G  L+S   D ++ VWDL
Sbjct: 683 GKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 60/154 (38%), Gaps = 21/154 (13%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNF---NGHKAAITLLQFDGTGTRLI 137
           + T LE   D  L + G+ D  IK+W L   ++   F   N  +  IT+   D + T + 
Sbjct: 457 DMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITIT--DRSLTHM- 513

Query: 138 SGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCI 197
                 N +   L+G  G     S        +     +LIS S+D  ++LW L T   +
Sbjct: 514 -----DNELSATLIGHSGTVYSTS--------FSPDNRYLISGSEDKTVRLWSLDTHTAL 560

Query: 198 ETHIAHTGECWGL--SVKDDLLITTGTDSQVKLW 229
            ++  H    W +  S       T   D   +LW
Sbjct: 561 VSYKGHNHPIWDVQFSPLGHYFATASHDQTARLW 594

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 124/282 (43%), Gaps = 48/282 (17%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++D+    ++  I   H+  I+SLD    G +LV+G
Sbjct: 441 YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +SP D +Y+A   
Sbjct: 500 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 542

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 543 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWN 600

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD +    
Sbjct: 601 LQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 660

Query: 650 IQKLYAHQSEVWALAISTDGSF------VVSSSHDHSIRIWE 685
           +  L  H++ V ++A++             + S D   RIW+
Sbjct: 661 LLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 702

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 82/172 (47%), Gaps = 14/172 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+  + +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 450 DGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 509

Query: 150 L-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQQCI-------ET 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +       E+
Sbjct: 510 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 567

Query: 200 HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKLNIENDKLGGKLTEMGTFE 249
              H    + +   +D   + +G+ D  VKLW L   N+K   K    GT E
Sbjct: 568 GTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCE 619

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 440 LYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPSGDKLVSG 499

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L + +  V  +A+S  DG ++ + S D ++R+W+
Sbjct: 500 SGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 551

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 97/238 (40%), Gaps = 56/238 (23%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD++TG    TLS  DG+   A       P + 
Sbjct: 489 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGVTTVA-----VSPGDG 535

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLL---------NFNGHKAAITLLQFDGTG 133
            Y+         A G  D  ++VWD  S+T  L         +  GHK ++  + F   G
Sbjct: 536 KYI---------AAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDG 584

Query: 134 TRLISGSKDSNIIVWDL----------VGEVGLYKLR--SHKDSITGFWC-QGEDWLIST 180
             ++SGS D ++ +W+L              G  ++    HKD +      Q +++++S 
Sbjct: 585 HSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 644

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKD--------DLLITTGTDSQVKLWK 230
           SKD  +  WD K+   +     H      ++V +        ++  T   D + ++WK
Sbjct: 645 SKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 702

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 93.2 bits (230), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 132/287 (45%), Gaps = 45/287 (15%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++DL++  ++ T++  H+  I+SLD    G +LV+G
Sbjct: 380 YIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 438

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISP-DDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +SP + +++A   
Sbjct: 439 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGEGKFIAAGS 481

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD T++V      F ++ +     L  GHK  V S+  + D + +++ S D+++K+W L 
Sbjct: 482 LDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLH 541

Query: 604 -------------FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
                           C  +   H+D ++SV          S SKD  V +WD +    +
Sbjct: 542 NTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPL 601

Query: 651 QKLYAHQSEVWALAIST------DGSFVVSSSHDHSIRIWEETEDQV 691
             L  H++ V ++A++       D     + S D   RIW+ ++++ 
Sbjct: 602 LMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIWKYSKNKA 648

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 76/155 (49%), Gaps = 14/155 (9%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WDL +K +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 389 DGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 448

Query: 150 L-VGEVGLYKLRSHKDSITGFWCQ-GEDWLIST-SKDGMIKLWDLKTQQCIET------- 199
           L  G+  L    S +D +T      GE   I+  S D  +++WD +T   +E        
Sbjct: 449 LRTGQCSL--TLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENEL 506

Query: 200 HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKLN 232
              H    + +   +D   + +G+ D  VKLW L+
Sbjct: 507 GTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLH 541

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 94/237 (39%), Gaps = 53/237 (22%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD++TG    TLS  DG+           P E 
Sbjct: 428 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV-----TTVAVSPGEG 474

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
            ++         A G  D  ++VWD  +  ++   +       GHK ++  + F   G  
Sbjct: 475 KFI---------AAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQG 525

Query: 136 LISGSKDSNIIVWDLVGEVGLYKLRS-------------HKDSITGFWC-QGEDWLISTS 181
           ++SGS D ++ +W+L       K  S             HKD +      Q + +++S S
Sbjct: 526 VVSGSLDRSVKLWNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGS 585

Query: 182 KDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDL-------LITTGT-DSQVKLWK 230
           KD  +  WD ++   +     H      ++V +         +  TG+ D + ++WK
Sbjct: 586 KDRGVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIWK 642

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 67/165 (40%), Gaps = 26/165 (15%)

Query: 39  GQLITSALEN--VNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAV 96
           G+ + +  E+  + +WD+ T  ++ TL                 +   L+     D L  
Sbjct: 390 GKFLATGAEDKLIRIWDLSTKRIVMTLQ------------GHEQDIYSLDYFPSGDKLVS 437

Query: 97  GYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGL 156
           G  D  +++WDL +    L  +      T+    G G  + +GS D  + VWD   E G 
Sbjct: 438 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWD--SETGF 495

Query: 157 YKLR---------SHKDSI-TGFWCQGEDWLISTSKDGMIKLWDL 191
              R          HKDS+ +  + +    ++S S D  +KLW+L
Sbjct: 496 LVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNL 540

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 134/297 (45%), Gaps = 28/297 (9%)

Query: 397 IDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYALTCKFL---PGGLLVILGTRNG 452
           + IS D+ ++AT S  G LKI + +T + I+ F+  +      +   P G  ++ G  NG
Sbjct: 188 VAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANG 247

Query: 453 ELQLFDLA--SSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF--QVENTL 508
           E+++++L   S S   T+   H+  +  +     GK + + S D T + WD   Q+E  L
Sbjct: 248 EIRIWNLNNDSESPAGTLT-GHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQL 306

Query: 509 VPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLS 568
             G                     ++  +    D   L  + LD+   V+ L S K  ++
Sbjct: 307 QEGHA------------------KEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMA 348

Query: 569 LYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF-LPES 627
           L GH  P+  +D S +   I T SAD  I++W +       +L AH   +  VKF     
Sbjct: 349 LEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKANG 408

Query: 628 HNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           H   S S D  +  + G+ +  +  +  H  ++ ++ ISTDGS + SS  D S++ W
Sbjct: 409 HYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 68/150 (45%), Gaps = 3/150 (2%)

Query: 539 ISPDDRYLAISLLDNTVKVFFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNI 597
           IS DD  +A       +K+   ++++   +    H   +  +D + D   ++T +A+  I
Sbjct: 190 ISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANGEI 249

Query: 598 KIWGL--DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYA 655
           +IW L  D      +L  H++ +  V+F P      S S D   + WD EK   +Q    
Sbjct: 250 RIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQEG 309

Query: 656 HQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           H  EV+ +A   DGS + S+  D    +W+
Sbjct: 310 HAKEVYCVAFQKDGSLLCSTGLDSVGLVWD 339

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 119/283 (42%), Gaps = 36/283 (12%)

Query: 325 ILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHT 384
           I+  F T     KI    W    ++   LV   +N  I  +++  +   P          
Sbjct: 216 IIKAFDTAHD-SKIGGVDWNPDGTA---LVTGAANGEIRIWNLNNDSESPAGT------- 264

Query: 385 IELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYA--LTCKFLP- 440
             L G    +  +      + +A+AS + + ++W+V+    ++  E G+A  + C     
Sbjct: 265 --LTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQE-GHAKEVYCVAFQK 321

Query: 441 -GGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
            G LL   G  +  L ++DL S   +  +E  H   I+ LD + +G  + TGSAD T++ 
Sbjct: 322 DGSLLCSTGLDSVGL-VWDLRSGKSIMALE-GHIKPIYGLDWSPNGYDIATGSADGTIRL 379

Query: 500 WDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFF 559
           WD +         K   L  L  ++    E+  D        +  YL  S  D T+ ++ 
Sbjct: 380 WDVR---------KVGILGALPAHNSIVSEVKFD------KANGHYLVSSSYDKTLNIYS 424

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602
            D+      + GH   +LS+DIS D   + +S  D+++K W L
Sbjct: 425 GDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQWSL 467

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 67/145 (46%), Gaps = 5/145 (3%)

Query: 90  DTDLLAVGYADGVIKVWDLM--SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIV 147
           D   L  G A+G I++W+L   S++      GH+  +  ++F  +G  + S S D    +
Sbjct: 236 DGTALVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRL 295

Query: 148 WDLVGEVGLYKLRSHKDSITGFWCQGEDWLI-STSKDGMIKLWDLKTQQCIETHIAHTGE 206
           WD+  ++ L     H   +     Q +  L+ ST  D +  +WDL++ + I     H   
Sbjct: 296 WDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKP 355

Query: 207 CWGLS-VKDDLLITTGT-DSQVKLW 229
            +GL    +   I TG+ D  ++LW
Sbjct: 356 IYGLDWSPNGYDIATGSADGTIRLW 380

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 67/161 (41%), Gaps = 6/161 (3%)

Query: 77  AKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRL 136
           AK   C   +  +D  LL     D V  VWDL S   ++   GH   I  L +   G  +
Sbjct: 311 AKEVYCVAFQ--KDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDI 368

Query: 137 ISGSKDSNIIVWDL--VGEVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQ 194
            +GS D  I +WD+  VG +G     +   S   F      +L+S+S D  + ++     
Sbjct: 369 ATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIYSGDNW 428

Query: 195 QCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKLNI 233
             +     HT +   + +  D   L ++G D  +K W L I
Sbjct: 429 TKLSVIQGHTDKILSVDISTDGSHLFSSGWDRSLKQWSLKI 469

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 49/121 (40%), Gaps = 1/121 (0%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H     +A    D   ++WD+  +  L    GH   +  + F   G+ L S   DS 
Sbjct: 275 VRFHPSGKYVASASFDMTWRLWDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSV 334

Query: 145 IIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
            +VWDL     +  L  H   I G  W      + + S DG I+LWD++    +    AH
Sbjct: 335 GLVWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAH 394

Query: 204 T 204
            
Sbjct: 395 N 395

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/124 (20%), Positives = 61/124 (49%), Gaps = 5/124 (4%)

Query: 385 IELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYALT--CKF-LP 440
           + L+G    +  +D S +   +AT S +G++++W+V+    +       ++    KF   
Sbjct: 347 MALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKA 406

Query: 441 GGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
            G  ++  + +  L ++   + + L  I+  H   I S+D+++DG  L +   D+++K W
Sbjct: 407 NGHYLVSSSYDKTLNIYSGDNWTKLSVIQ-GHTDKILSVDISTDGSHLFSSGWDRSLKQW 465

Query: 501 DFQV 504
             ++
Sbjct: 466 SLKI 469

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 124/309 (40%), Gaps = 56/309 (18%)

Query: 387 LQGQRTDMRSIDISDDNRLLATASNGS-LKIWNV-----KTHKCIRTFECGYA---LTCK 437
            Q    DM  +D SDD R+ A     S +KIW++          +   E  Y     TCK
Sbjct: 462 FQNTNKDMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTCK 521

Query: 438 FLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTV 497
            L G                              H   ++S   + D K L++GS DKTV
Sbjct: 522 TLVG------------------------------HSGTVYSTSFSPDNKYLLSGSEDKTV 551

Query: 498 KFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKV 557
           + W       LV   K    P+  +N                SP   Y A +  D T ++
Sbjct: 552 RLWSMDTHTALV-SYKGHNHPVWDVN---------------FSPLGHYFATASHDQTARL 595

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDS 617
           +  D +       GH   V  +    +   + T S+DK  ++W +  GD  +    H   
Sbjct: 596 WSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAP 655

Query: 618 IMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSS 676
           ++S+   P+     + S+D ++  WD    + ++++  H ++ +++L+ S +G+ ++S  
Sbjct: 656 VISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGG 715

Query: 677 HDHSIRIWE 685
            DHS+R+W+
Sbjct: 716 ADHSVRVWD 724

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 106/265 (40%), Gaps = 65/265 (24%)

Query: 387 LQGQRTDMRSIDISDDNR-LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLV 445
           L G    + S   S DN+ LL+ + + ++++W++ TH  + +++                
Sbjct: 523 LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK---------------- 566

Query: 446 ILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
                                     H+  +W ++ +  G    T S D+T + W     
Sbjct: 567 -------------------------GHNHPVWDVNFSPLGHYFATASHDQTARLW----- 596

Query: 506 NTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFL---DS 562
                 + D   P+          LN D+  +   P+  YL     D T +++ +   DS
Sbjct: 597 ------SCDHIYPLRIF----AGHLN-DVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDS 645

Query: 563 MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAH-QDSIMSV 621
           ++ +L   GH  PV+SI +S D + + T S D  I +W +  G   K +  H +++I S+
Sbjct: 646 VRLFL---GHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSL 702

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEK 646
            +  E +   S   D  V+ WD +K
Sbjct: 703 SYSKEGNVLISGGADHSVRVWDLKK 727

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +W++ TGD +        P  S            + V  D   L+ G  DG+I VWD+ +
Sbjct: 637 MWNVSTGDSVRLFLGHTAPVIS------------IAVSPDGRWLSTGSEDGIINVWDIGT 684

Query: 111 KTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  L +   G  LISG  D ++ VWDL
Sbjct: 685 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 58/142 (40%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  L +GS D    +W++   
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTG 643

Query: 154 VGLYKLRSHKDSITGFWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---WG 209
             +     H   +       +  WL + S+DG+I +WD+ T + ++    H         
Sbjct: 644 DSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 210 LSVKDDLLITTGTDSQVKLWKL 231
            S + ++LI+ G D  V++W L
Sbjct: 704 YSKEGNVLISGGADHSVRVWDL 725

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   L  G +D   ++W++ +   +  F GH A +  +     G  L +GS+D  
Sbjct: 617 VSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGI 676

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K++I    + +  + LIS   D  +++WDLK
Sbjct: 677 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 63/160 (39%), Gaps = 10/160 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  + F   G    + S D    +W 
Sbjct: 538 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWS 597

Query: 150 LVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
                 L     H + +    F   G  +L + S D   ++W++ T   +   + HT   
Sbjct: 598 CDHIYPLRIFAGHLNDVDCVSFHPNGC-YLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPV 656

Query: 208 WGLSVKDD--LLITTGTDSQVKLWKLNIENDKLGGKLTEM 245
             ++V  D   L T   D  + +W +       G +L +M
Sbjct: 657 ISIAVSPDGRWLSTGSEDGIINVWDIGT-----GKRLKQM 691

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 63/189 (33%), Gaps = 35/189 (18%)

Query: 77  AKPAECTY-----------LEVHQDTDLLAVGYADGVIKVWDL-----MSKTVLLN---- 116
           A P+ C Y           L+   D  + A G+ D  IK+W L      +  ++LN    
Sbjct: 453 ALPSVCMYTFQNTNKDMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETN 512

Query: 117 ----------FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI 166
                       GH   +    F      L+SGS+D  + +W +     L   + H   +
Sbjct: 513 YKDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPV 572

Query: 167 --TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWGLSVKDDLLITTGT 222
               F   G  +  + S D   +LW       +     H    +C         L T  +
Sbjct: 573 WDVNFSPLGH-YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSS 631

Query: 223 DSQVKLWKL 231
           D   ++W +
Sbjct: 632 DKTCRMWNV 640

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 119/257 (46%), Gaps = 42/257 (16%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++D+ +  ++  I   H+  I+SLD    G +LV+G
Sbjct: 449 YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIV-MILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +SP D +Y+A   
Sbjct: 508 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 550

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD  V+V+  DS   +L         S  GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 551 LDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWN 608

Query: 602 L------------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           L            + G C  +   H+D ++SV          S SKD  V +WD +    
Sbjct: 609 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 668

Query: 650 IQKLYAHQSEVWALAIS 666
           +  L  H++ V ++A++
Sbjct: 669 LLMLQGHRNSVISVAVA 685

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 82/159 (51%), Gaps = 9/159 (5%)

Query: 534 ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA 593
           I S+  SPD ++LA    D  ++++ +++ K  + L GH+  + S+D       +++ S 
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 509

Query: 594 DKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYWDGEKFECIQK 652
           D+ ++IW L  G C  +L + +D + +V   P    + +  S D  V+ WD E    +++
Sbjct: 510 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 568

Query: 653 L-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           L         H+  V+++  + DG  VVS S D S+++W
Sbjct: 569 LDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLW 607

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 48/172 (27%), Positives = 83/172 (48%), Gaps = 14/172 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+ ++ +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 458 DGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 517

Query: 150 L-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQQCI-------ET 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +       E+
Sbjct: 518 LRTGQCSL--TLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENES 575

Query: 200 HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKLNIENDKLGGKLTEMGTFE 249
              H    + +   +D   + +G+ D  VKLW L   N+K   K    GT E
Sbjct: 576 GTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCE 627

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 103/210 (49%), Gaps = 13/210 (6%)

Query: 387 LQGQRTDMRSID-ISDDNRLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL-PG-GL 443
           LQG   D+ S+D     ++L++ + + +++IW+++T +C  T      +T   + PG G 
Sbjct: 485 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK 544

Query: 444 LVILGTRNGELQLFDLASSSLLDTIED------AHDAAIWSLDLTSDGKRLVTGSADKTV 497
            +  G+ +  ++++D  +  L++ ++        H  +++S+  T DG+ +V+GS D++V
Sbjct: 545 YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSV 604

Query: 498 KFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKV 557
           K W+ Q  N       D   P       T +   D +LS+  + +D Y+     D  V  
Sbjct: 605 KLWNLQNAN----NKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLF 660

Query: 558 FFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           +   S    L L GH+  V+S+ ++  S +
Sbjct: 661 WDKKSGNPLLMLQGHRNSVISVAVANGSPL 690

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 2/113 (1%)

Query: 574 LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC 633
           L + S+  S D K + T + D+ I+IW ++       L  H+  I S+ + P      S 
Sbjct: 448 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAIST-DGSFVVSSSHDHSIRIWE 685
           S D  V+ WD    +C   L + +  V  +A+S  DG ++ + S D ++R+W+
Sbjct: 508 SGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 559

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 81/193 (41%), Gaps = 48/193 (24%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD++TG    TLS  DG+   A       P + 
Sbjct: 497 YFPSGDKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGVTTVA-----VSPGDG 543

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLL---------NFNGHKAAITLLQFDGTG 133
            Y+         A G  D  ++VWD  S+T  L         +  GHK ++  + F   G
Sbjct: 544 KYI---------AAGSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDG 592

Query: 134 TRLISGSKDSNIIVWDLVGEVGLYKLRS------------HKDSITGFWC-QGEDWLIST 180
             ++SGS D ++ +W+L         ++            HKD +      Q +++++S 
Sbjct: 593 ESVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 652

Query: 181 SKDGMIKLWDLKT 193
           SKD  +  WD K+
Sbjct: 653 SKDRGVLFWDKKS 665

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 64/163 (39%), Gaps = 28/163 (17%)

Query: 92  DLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLV 151
           D L  G  D  +++WDL +    L  +      T+    G G  + +GS D  + VWD  
Sbjct: 502 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD-- 559

Query: 152 GEVGLYKLR---------SHKDSITG--FWCQGEDWLISTSKDGMIKLWDLKTQQ----- 195
            E G    R          HKDS+    F   GE  ++S S D  +KLW+L+        
Sbjct: 560 SETGFLVERLDSENESGTGHKDSVYSVVFTRDGES-VVSGSLDRSVKLWNLQNANNKSDS 618

Query: 196 -------CIETHIAHTGECWGLSV--KDDLLITTGTDSQVKLW 229
                  C  T+I H      ++    D+ +++   D  V  W
Sbjct: 619 KTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFW 661

 Score = 38.5 bits (88), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 56/131 (42%), Gaps = 19/131 (14%)

Query: 49  VNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVH-QDTDLLAVGYADGVIKVWD 107
           V VWD +TG L+  L       + +  G    +  Y  V  +D + +  G  D  +K+W+
Sbjct: 555 VRVWDSETGFLVERLD------SENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWN 608

Query: 108 LM------------SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVG 155
           L             S T  + + GHK  +  +        ++SGSKD  ++ WD      
Sbjct: 609 LQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNP 668

Query: 156 LYKLRSHKDSI 166
           L  L+ H++S+
Sbjct: 669 LLMLQGHRNSV 679

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 91/203 (44%), Gaps = 18/203 (8%)

Query: 506 NTLVPGTKDKFLPILKLNHDTTLELNDDILSLR----------ISPDDRYLAISLLDNTV 555
           N L+ G++DK L   KL  D   +    + S R          ++PD  Y   +  D TV
Sbjct: 31  NLLLSGSRDKSLITWKLTGDDQ-QYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTV 89

Query: 556 KVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQ 615
           +++ L S K      GHK  VLS+ I   +  I+++S DK +K+W    G+C  +L  H 
Sbjct: 90  RLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNT-LGECMVTLLGHN 148

Query: 616 DSIMSVKFLP------ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDG 669
           D +  V+  P      E+    S   D VVK W+   F+       H + V  +  S DG
Sbjct: 149 DWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDG 208

Query: 670 SFVVSSSHDHSIRIWEETEDQVF 692
           + V S+  D  I +W  TE +  
Sbjct: 209 TLVASAGKDGQIMLWNLTEKEAL 231

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 134/304 (44%), Gaps = 41/304 (13%)

Query: 403 NRLLATASNGSLKIWNV-----KTHKCIRTFECGYALT--CKFLPGGLLVILGTRNGELQ 455
           N LL+ + + SL  W +     +    +R+F     +   C   P G   +  + +  ++
Sbjct: 31  NLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVR 90

Query: 456 LFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDK 515
           L++LAS   +      H + + S+ +     ++V+ S DKTVK W+   E  +       
Sbjct: 91  LWELASGKCIQRFV-GHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGECMV------- 142

Query: 516 FLPILKLNHDTTLELNDDILSLRISP-----DDRYLAISL-LDNTVKVFFLDSMKFYLSL 569
                     T L  ND +  +R++P     D+    IS  +D  VKV+ L S +     
Sbjct: 143 ----------TLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADF 192

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
            GH   V ++  S D  ++ ++  D  I +W L   +   +L A QD + +V F P  + 
Sbjct: 193 IGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTLNA-QDEVFAVAFSPNRY- 250

Query: 630 FFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--LAISTDGSFVVSSSHDHSI 681
           + + +  + +K ++ E+ + + +L      Y   +E  A  LA S DG  + +   D+ I
Sbjct: 251 WLTAATSSGIKIFNLEERKVVDELKPEFAGYTKAAEPHAISLAWSADGQTLFAGYTDNVI 310

Query: 682 RIWE 685
           R+W+
Sbjct: 311 RVWQ 314

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D  +++W+L S   +  F GHK+ +  +  D   ++++S S+D  + VW+ +GE  +  L
Sbjct: 86  DKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGEC-MVTL 144

Query: 160 RSHKDSITGFWCQGED-------WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV 212
             H D ++       +        +IS   D ++K+W+L + Q     I H      ++ 
Sbjct: 145 LGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTA 204

Query: 213 KDD--LLITTGTDSQVKLWKL 231
             D  L+ + G D Q+ LW L
Sbjct: 205 SPDGTLVASAGKDGQIMLWNL 225

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDIS-FDSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     ++++ S DK++  W L      +G   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSI 681
              P+     S S D  V+ W+    +CIQ+   H+S+V ++ I    S +VS+S D ++
Sbjct: 72  TVTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTV 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 51/99 (51%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D V+KVW+L S  +  +F GH   +  +     GT + S  KD  I++W+L  +  LY L
Sbjct: 175 DKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTL 234

Query: 160 RSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
            +  +     +     WL + +  G IK+++L+ ++ ++
Sbjct: 235 NAQDEVFAVAFSPNRYWLTAATSSG-IKIFNLEERKVVD 272

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 99/227 (43%), Gaps = 25/227 (11%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLEL 530
            H   +    +T DG+  ++ S DKTV+ W+      +      +F+      H +    
Sbjct: 63  GHSHIVQDCTVTPDGEYALSASWDKTVRLWELASGKCI-----QRFV-----GHKS---- 108

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISF------D 584
             D+LS+ I      +  +  D TVKV+     +  ++L GH   V  + ++       +
Sbjct: 109 --DVLSVTIDRRASQIVSASRDKTVKVWNTLG-ECMVTLLGHNDWVSQVRVAPNETPEDE 165

Query: 585 SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDG 644
           +  +I++  DK +K+W L           H + + +V   P+     S  KD  +  W+ 
Sbjct: 166 TVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNL 225

Query: 645 EKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQV 691
            + E +  L A Q EV+A+A S +  + ++++    I+I+   E +V
Sbjct: 226 TEKEALYTLNA-QDEVFAVAFSPN-RYWLTAATSSGIKIFNLEERKV 270

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 9/122 (7%)

Query: 117 FNGHKAAIT-LLQFDGTGTRLISGSKDSNIIVWDLVGE-----VGLYKLRSHKDSITGFW 170
             GH   +T L         L+SGS+D ++I W L G+     V +   R H   +    
Sbjct: 13  LEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCT 72

Query: 171 CQGE-DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQVK 227
              + ++ +S S D  ++LW+L + +CI+  + H  +   +++  +   +++   D  VK
Sbjct: 73  VTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVK 132

Query: 228 LW 229
           +W
Sbjct: 133 VW 134

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 55/128 (42%), Gaps = 12/128 (9%)

Query: 389 GQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G    + ++  S D  L+A+A  +G + +WN+   + + T           F P    + 
Sbjct: 194 GHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTLNAQDEVFAVAFSPNRYWLT 253

Query: 447 LGTRNGELQLFDLASSSLLDTIED--------AHDAAIWSLDLTSDGKRLVTGSADKTVK 498
             T +G +++F+L    ++D ++         A   AI SL  ++DG+ L  G  D  ++
Sbjct: 254 AATSSG-IKIFNLEERKVVDELKPEFAGYTKAAEPHAI-SLAWSADGQTLFAGYTDNVIR 311

Query: 499 FWDFQVEN 506
            W     N
Sbjct: 312 VWQVMTAN 319

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 66/165 (40%), Gaps = 18/165 (10%)

Query: 92  DLLAVGYADGVIKVWDLMSK-----TVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNII 146
           +LL  G  D  +  W L          + +F GH   +        G   +S S D  + 
Sbjct: 31  NLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVR 90

Query: 147 VWDLVGEVGLYKLRSHKDSITGFWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
           +W+L     + +   HK  +      +    ++S S+D  +K+W+    +C+ T + H  
Sbjct: 91  LWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWN-TLGECMVTLLGHND 149

Query: 206 ECWGLSVKDD--------LLITTGTDSQVKLWKLN---IENDKLG 239
               + V  +         +I+ G D  VK+W L+   IE D +G
Sbjct: 150 WVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIG 194

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 127/284 (44%), Gaps = 46/284 (16%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++DL +  ++ T++  H+  I+SLD    G +LV+G
Sbjct: 450 YIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQ-GHEQDIYSLDYFPSGDKLVSG 508

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISP-DDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +SP D + +A   
Sbjct: 509 SGDRTVRIWDLRAGQCSL-----------------TLSIEDGVTTVAVSPGDGKLIAAGS 551

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD TV++      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 552 LDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLR 611

Query: 603 -----------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
                      +      +   H+D ++SV          S SKD  V +WD      + 
Sbjct: 612 SANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLL 671

Query: 652 KLYAHQSEVWALAISTD-------GSFVVSSSHDHSIRIWEETE 688
            L  H++ V ++A++ D       G F   S  D   RIW+ T+
Sbjct: 672 MLQGHRNSVISVAVANDHPLGPEYGVFATGSG-DCKARIWKYTK 714

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 104/226 (46%), Gaps = 33/226 (14%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSD---GLPPGASD--ARGAKPAECT-----------Y 84
           L T   +   V+ + TG+L++ LS+     P G S   A GA+ AE T           Y
Sbjct: 391 LATGCNKTTQVYKVSTGELVARLSEDAASAPSGNSGDGASGAENAEQTPAVSTSASSDLY 450

Query: 85  LE---VHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSK 141
           +       D   LA G  D +I++WDL ++ +++   GH+  I  L +  +G +L+SGS 
Sbjct: 451 IRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSG 510

Query: 142 DSNIIVWDL-VGEVGLYKLRSHKDSITGFWCQ-GEDWLIST-SKDGMIKLWDLKTQQCIE 198
           D  + +WDL  G+  L    S +D +T      G+  LI+  S D  +++WD +T   +E
Sbjct: 511 DRTVRIWDLRAGQCSL--TLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVE 568

Query: 199 T-------HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKLNIEN 235
                      H    + +   +D   + +G+ D  VKLW L   N
Sbjct: 569 RLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSAN 614

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 91/236 (38%), Gaps = 52/236 (22%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD++ G    TLS  DG+               
Sbjct: 498 YFPSGDKLVSGSGD--------RTVRIWDLRAGQCSLTLSIEDGV--------------T 535

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
           T      D  L+A G  D  +++WD  +  ++   +       GHK ++  + F   G  
Sbjct: 536 TVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHG 595

Query: 136 LISGSKDSNIIVWDLVGEVG------------LYKLRSHKDSITGFW-CQGEDWLISTSK 182
           ++SGS D ++ +W+L    G                  HKD +      Q +++++S SK
Sbjct: 596 VVSGSLDRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSK 655

Query: 183 DGMIKLWDLKTQQCIETHIAHTGECWGLSVKDD--------LLITTGTDSQVKLWK 230
           D  +  WD  +   +     H      ++V +D        +  T   D + ++WK
Sbjct: 656 DRGVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWK 711

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 128/301 (42%), Gaps = 39/301 (12%)

Query: 387 LQGQRTDMRSIDISDDNRLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGLLV 445
            Q    DM  ++ SDD R+ A     S +KIW++           G +L          +
Sbjct: 463 FQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLD----------GSSLNNPN------I 506

Query: 446 ILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
           +L + N   +  D    +L+      H   ++S   + D K L++GS DKTV+ W     
Sbjct: 507 MLNSANNNYRDDDPTCKTLV-----GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTH 561

Query: 506 NTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKF 565
             LV   K    P+  +N                SP   Y A +  D T +++  D +  
Sbjct: 562 TALV-SYKGHNHPVWDVN---------------FSPLGHYFATASHDQTARLWSCDHIYP 605

Query: 566 YLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP 625
                GH   V  +    +   + T S+DK  ++W +  GD  +    H   ++ +   P
Sbjct: 606 LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSP 665

Query: 626 ESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIW 684
           +     + S+D ++  WD    + ++++  H ++ +++L+ S +G+ ++S   DHS+R+W
Sbjct: 666 DGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVW 725

Query: 685 E 685
           +
Sbjct: 726 D 726

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +WD+ TGD +                  P  C  + V  D   L+ G  DG+I +WD+ +
Sbjct: 639 MWDVSTGDSVRLF----------LGHTAPVIC--IAVSPDGRWLSTGSEDGIINIWDIGT 686

Query: 111 KTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  L +   G  LISG  D ++ VWDL
Sbjct: 687 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 727

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 58/142 (40%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 586 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 645

Query: 154 VGLYKLRSHKDSITGFWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---WG 209
             +     H   +       +  WL + S+DG+I +WD+ T + ++    H         
Sbjct: 646 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 705

Query: 210 LSVKDDLLITTGTDSQVKLWKL 231
            S + ++LI+ G D  V++W L
Sbjct: 706 YSKEGNVLISGGADHSVRVWDL 727

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +  +     G  L +GS+D  
Sbjct: 619 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGI 678

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDLK 192
           I +WD+     L ++R H K++I    + +  + LIS   D  +++WDLK
Sbjct: 679 INIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 728

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 62/160 (38%), Gaps = 10/160 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  + F   G    + S D    +W 
Sbjct: 540 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWS 599

Query: 150 LVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGE- 206
                 L     H + +    F   G  ++ + S D   ++WD+ T   +   + HT   
Sbjct: 600 CDHIYPLRIFAGHLNDVDCVSFHPNG-CYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 658

Query: 207 -CWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGGKLTEM 245
            C  +S     L T   D  + +W +       G +L +M
Sbjct: 659 ICIAVSPDGRWLSTGSEDGIINIWDIGT-----GKRLKQM 693

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/190 (19%), Positives = 62/190 (32%), Gaps = 36/190 (18%)

Query: 77  AKPAECTY-----------LEVHQDTDLLAVGYADGVIKVWDL-----MSKTVLLN---- 116
           A P+ C Y           L    D  + A G+ D  IK+W L      +  ++LN    
Sbjct: 454 ALPSVCMYTFQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANN 513

Query: 117 -----------FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDS 165
                        GH   +    F      L+SGS+D  + +W +     L   + H   
Sbjct: 514 NYRDDDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHP 573

Query: 166 I--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWGLSVKDDLLITTG 221
           +    F   G  +  + S D   +LW       +     H    +C         + T  
Sbjct: 574 VWDVNFSPLGH-YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGS 632

Query: 222 TDSQVKLWKL 231
           +D   ++W +
Sbjct: 633 SDKTCRMWDV 642

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/340 (22%), Positives = 141/340 (41%), Gaps = 69/340 (20%)

Query: 397 IDISDDNRLLATASNGSLKIWNVKTHKCIRTFECGYALTCK------------------- 437
           +  S+D   LAT  N + +I+ V   + +  F    A T K                   
Sbjct: 497 VKFSNDGEFLATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDL 556

Query: 438 ------FLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
                 F P G  +  G  +  ++++D+    ++  ++  H+  I+SLD    G +LV+G
Sbjct: 557 YIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLK-GHEQDIYSLDYFPSGDKLVSG 615

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD-RYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +SP D +++A   
Sbjct: 616 SGDRTVRIWDLKTGQCTL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 658

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL- 602
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 659 LDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 718

Query: 603 -----------DFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQ 651
                        G C  +   H+D ++SV    +     S SKD  V +WD      + 
Sbjct: 719 NVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLL 778

Query: 652 KLYAHQSEVWALAIS------TDGSFVVSSSHDHSIRIWE 685
            L  H++ V ++A++       +     + S D   RIW+
Sbjct: 779 MLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWK 818

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 108/229 (47%), Gaps = 19/229 (8%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELN 531
           H + +  +  ++DG+ L TG  +KT + +    +  LV    D+     K + +   E  
Sbjct: 490 HTSVVCCVKFSNDGEFLATG-CNKTTQIYRVS-DGELVARFSDENAHTDKADGNDNAEAE 547

Query: 532 DD--------ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISF 583
                     I S+  SPD ++LA    D  ++++ ++  K  + L GH+  + S+D   
Sbjct: 548 TSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFP 607

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYW 642
               +++ S D+ ++IW L  G C  +L + +D + +V   P    F +  S D  V+ W
Sbjct: 608 SGDKLVSGSGDRTVRIWDLKTGQCTLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW 666

Query: 643 DGEKFECIQKL-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           D +    +++L         H+  V+++  + DG+ VVS S D S+++W
Sbjct: 667 DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLW 715

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 83/173 (47%), Gaps = 16/173 (9%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 566 DGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 625

Query: 150 L-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQQCIET------- 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD  T   +E        
Sbjct: 626 LKTGQCTL--TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENEL 683

Query: 200 HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKL-NIENDKLGGKLTEMGTFE 249
              H    + +   +D   + +G+ D  VKLW L N+ ++   GK T  GT E
Sbjct: 684 GTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTS-GTCE 735

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 73/188 (38%), Gaps = 44/188 (23%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P+  +  SGSG           V +WD+KTG    TLS  DG+               
Sbjct: 605 YFPSGDKLVSGSGD--------RTVRIWDLKTGQCTLTLSIEDGV--------------T 642

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
           T      D   +A G  D  ++VWD  +  ++   +       GHK ++  + F   G  
Sbjct: 643 TVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNG 702

Query: 136 LISGSKDSNIIVWDL------------VGEVGLYKLRSHKDSITGFWCQGED-WLISTSK 182
           ++SGS D ++ +W+L                       HKD +       +D +++S SK
Sbjct: 703 VVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSK 762

Query: 183 DGMIKLWD 190
           D  +  WD
Sbjct: 763 DRGVLFWD 770

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 56/131 (42%), Gaps = 19/131 (14%)

Query: 49  VNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVH-QDTDLLAVGYADGVIKVWD 107
           V VWD  TG L+  L       + +  G    +  Y  V  +D + +  G  D  +K+W+
Sbjct: 663 VRVWDSDTGFLVERLD------SENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWN 716

Query: 108 L------------MSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVG 155
           L             S T  + + GHK  +  +        ++SGSKD  ++ WD V    
Sbjct: 717 LRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNP 776

Query: 156 LYKLRSHKDSI 166
           L  L+ H++S+
Sbjct: 777 LLMLQGHRNSV 787

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 127/297 (42%), Gaps = 45/297 (15%)

Query: 393 DMRSIDISDDNRLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRN 451
           DM S++ SDD RL A     S +KIW+                    L G  L+     +
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWS--------------------LDGSSLINPKYSS 514

Query: 452 GELQLF--DLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLV 509
            +   F  D   S+L+      H   ++S   + D   LV+GS DKTVK W       LV
Sbjct: 515 SQFDRFSQDNTCSTLV-----GHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALV 569

Query: 510 PGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL 569
                        N+      N  +  ++ SP   Y A +  D T +++  D +      
Sbjct: 570 -------------NYKGH---NHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIF 613

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
            GH   V ++    +   + T S+DK  ++W +  GD  +    H   ++S +  P+   
Sbjct: 614 AGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRW 673

Query: 630 FFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
             + S+D V+  WD    + I+++  H ++ V +L+ + +G+ ++S   DHS+R+W+
Sbjct: 674 LATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWD 730

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 74/173 (42%), Gaps = 18/173 (10%)

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKF----YLS--------------LYGH 572
           N D+ SL  S D R  A    D+ +K++ LD        Y S              L GH
Sbjct: 473 NRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGH 532

Query: 573 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFS 632
              V S   S D+  +++ S DK +K+W +D      +   H   +  VKF P  H F S
Sbjct: 533 SGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFAS 592

Query: 633 CSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            S D   + W  +    ++    H ++V  ++   +G +V + S D + R+W+
Sbjct: 593 ASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWD 645

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 100/224 (44%), Gaps = 23/224 (10%)

Query: 387 LQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYALT---CKFLPGG 442
           L G    + S   S DN  L + S + ++K+W++ TH  +  ++ G+       KF P G
Sbjct: 529 LVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYK-GHNHPVWDVKFSPLG 587

Query: 443 LLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
                 + +   +L+       L  I   H   + ++    +G  + TGS+DKT + WD 
Sbjct: 588 HYFASASHDQTARLWACDHIYPL-RIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDV 646

Query: 503 QVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS 562
              +++           L L H         +LS ++SPD R+LA    D  + ++ + +
Sbjct: 647 STGDSVR----------LFLGHTAP------VLSTQVSPDGRWLATGSEDGVICLWDIGT 690

Query: 563 MKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
            K    + GH K  V S+  + +  ++I+  AD ++++W +  G
Sbjct: 691 GKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHG 734

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 60/146 (41%), Gaps = 5/146 (3%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVW- 148
           D   L  G  D  +K+W + + T L+N+ GH   +  ++F   G    S S D    +W 
Sbjct: 544 DNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWA 603

Query: 149 -DLVGEVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
            D +  + ++   ++      F   G  ++ + S D   ++WD+ T   +   + HT   
Sbjct: 604 CDHIYPLRIFAGHTNDVDTVSFHPNGC-YVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 662

Query: 208 WGLSVKDD--LLITTGTDSQVKLWKL 231
               V  D   L T   D  + LW +
Sbjct: 663 LSTQVSPDGRWLATGSEDGVICLWDI 688

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 13/108 (12%)

Query: 44  SALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVI 103
           S+ +   +WD+ TGD +        P  S             +V  D   LA G  DGVI
Sbjct: 636 SSDKTCRMWDVSTGDSVRLFLGHTAPVLS------------TQVSPDGRWLATGSEDGVI 683

Query: 104 KVWDLMSKTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
            +WD+ +   +    GH K A+  L F+  G  LISG  D ++ VWD+
Sbjct: 684 CLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDV 731

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 60/132 (45%), Gaps = 4/132 (3%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRNGELQLFDLASS 462
           +   +S+ + ++W+V T   +R F       L+ +  P G  +  G+ +G + L+D+ + 
Sbjct: 632 VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTG 691

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKL 522
             +  +      A+ SL    +G  L++G AD +V+ WD  V++       +   P    
Sbjct: 692 KRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWD--VKHGTTEQGPEPEQPFNAH 749

Query: 523 NHDTTLELNDDI 534
             D T  +N DI
Sbjct: 750 VGDITASINQDI 761

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 62/130 (47%), Gaps = 8/130 (6%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +   Q    G  L +GS+D  
Sbjct: 623 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGV 682

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGFWCQGE-DWLISTSKDGMIKLWDLK---TQQCIET 199
           I +WD+     + ++R H K+++       E + LIS   D  +++WD+K   T+Q  E 
Sbjct: 683 ICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEP 742

Query: 200 HI---AHTGE 206
                AH G+
Sbjct: 743 EQPFNAHVGD 752

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 58/142 (40%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 590 FASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTG 649

Query: 154 VGLYKLRSHKDSITGFWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---WG 209
             +     H   +       +  WL + S+DG+I LWD+ T + I+    H         
Sbjct: 650 DSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLS 709

Query: 210 LSVKDDLLITTGTDSQVKLWKL 231
            + + ++LI+ G D  V++W +
Sbjct: 710 FNKEGNVLISGGADHSVRVWDV 731

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 63/174 (36%), Gaps = 23/174 (13%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDL---------MSKTVLLNFN---------GHKA 122
           + T LE   D  L A G+ D  IK+W L          S +    F+         GH  
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSG 534

Query: 123 AITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI--TGFWCQGEDWLIST 180
            +    F      L+SGS+D  + +W +     L   + H   +    F   G  +  S 
Sbjct: 535 TVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGH-YFASA 593

Query: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKLN 232
           S D   +LW       +     HT +   +S   +   + T  +D   ++W ++
Sbjct: 594 SHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVS 647

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 128/276 (46%), Gaps = 42/276 (15%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++++    ++  ++  H+  I+SLD   DG++LV+G
Sbjct: 343 YIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLK-GHEQDIYSLDYFPDGQKLVSG 401

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD-RYLAISL 550
           S D++++ WD +     +                 TL + D + ++ +SP++ + +A   
Sbjct: 402 SGDRSIRIWDLKTGQCSL-----------------TLSIEDGVTTVAVSPNEGKLIAAGS 444

Query: 551 LDNTVKVFFLDSMKFYL---------SLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG 601
           LD +V+++  DS   +L         S  GH+  V S+  + D + +++ S D+ +K+W 
Sbjct: 445 LDRSVRIW--DSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWN 502

Query: 602 LD-----FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
           L       G C  +   H+D ++SV    +    FS SKD  V  WD +    I  L  H
Sbjct: 503 LGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGH 562

Query: 657 QSEVWALAIST----DG---SFVVSSSHDHSIRIWE 685
           ++ V ++A       DG       + S D   RIW+
Sbjct: 563 RNSVISVATVNSNVDDGKNYKLFATGSGDCKARIWK 598

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 108/235 (45%), Gaps = 31/235 (13%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLEL 530
            HD+ +  +  + DGK L TG  ++T + +D          T + ++ +L    +T +  
Sbjct: 277 PHDSVVCCVKFSQDGKYLATG-CNRTTQIFDV--------ATGELYVKLLDDTVNTAIVT 327

Query: 531 NDD-------------ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL 577
                           I S+  SPD  +LA    D  ++++ +   K  + L GH+  + 
Sbjct: 328 TTTENNETVTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIY 387

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKD 636
           S+D   D + +++ S D++I+IW L  G C  +L + +D + +V   P      +  S D
Sbjct: 388 SLDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLD 446

Query: 637 AVVKYWDGEKFECIQKL-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
             V+ WD      +++L         HQ  V+++A + DG  VVS S D ++++W
Sbjct: 447 RSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLW 501

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 118/244 (48%), Gaps = 34/244 (13%)

Query: 394 MRSIDISDDNRLLATASNGSL-KIWNVKTHKCIRTFECG----YALTCKFLPGGLLVILG 448
           +RSI  S D   LAT +   L +IWN+K  K +   +      Y+L   + P G  ++ G
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSL--DYFPDGQKLVSG 401

Query: 449 TRNGELQLFDLASS--SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD----F 502
           + +  ++++DL +   SL  +IED       S    ++GK +  GS D++V+ WD    F
Sbjct: 402 SGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVS---PNEGKLIAAGSLDRSVRIWDSSTGF 458

Query: 503 QVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLD- 561
            VE              L  ++++     D + S+  + D +++    LD TVK++ L  
Sbjct: 459 LVER-------------LDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGD 505

Query: 562 ----SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDS 617
               + K  ++  GHK  VLS+  S D K I + S D+ + IW  D G+    L  H++S
Sbjct: 506 TQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNS 565

Query: 618 IMSV 621
           ++SV
Sbjct: 566 VISV 569

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 76/154 (49%), Gaps = 14/154 (9%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D + LA G  D +I++W++  + +++   GH+  I  L +   G +L+SGS D +I +WD
Sbjct: 352 DGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWD 411

Query: 150 L-VGEVGLYKLRSHKDSITGFWCQ-GEDWLIST-SKDGMIKLWDLKTQQCI-------ET 199
           L  G+  L    S +D +T       E  LI+  S D  +++WD  T   +       E+
Sbjct: 412 LKTGQCSL--TLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNES 469

Query: 200 HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKL 231
              H    + ++  KD   + +G+ D  VKLW L
Sbjct: 470 GNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNL 503

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 81/188 (43%), Gaps = 30/188 (15%)

Query: 522 LNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-------- 573
           L HD+       +  ++ S D +YLA    + T ++F + + + Y+ L            
Sbjct: 276 LPHDSV------VCCVKFSQDGKYLATGC-NRTTQIFDVATGELYVKLLDDTVNTAIVTT 328

Query: 574 -------------LPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMS 620
                        L + SI  S D + + T + DK I+IW +        L  H+  I S
Sbjct: 329 TTENNETVTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYS 388

Query: 621 VKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS-TDGSFVVSSSHDH 679
           + + P+     S S D  ++ WD +  +C   L + +  V  +A+S  +G  + + S D 
Sbjct: 389 LDYFPDGQKLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDR 447

Query: 680 SIRIWEET 687
           S+RIW+ +
Sbjct: 448 SVRIWDSS 455

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 59/136 (43%), Gaps = 14/136 (10%)

Query: 39  GQLITSAL--ENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTY-LEVHQDTDLLA 95
           G+LI +     +V +WD  TG L+  L       + +  G    +  Y +   +D   + 
Sbjct: 437 GKLIAAGSLDRSVRIWDSSTGFLVERLD------SDNESGNGHQDSVYSVAFTKDGQHVV 490

Query: 96  VGYADGVIKVWDLM-----SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
            G  D  +K+W+L      +    + + GHK  +  +        + SGSKD  +I+WD 
Sbjct: 491 SGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDK 550

Query: 151 VGEVGLYKLRSHKDSI 166
                +  L+ H++S+
Sbjct: 551 DSGNPILMLQGHRNSV 566

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 75/314 (23%), Positives = 135/314 (42%), Gaps = 25/314 (7%)

Query: 380 LKTHTIELQGQRT----DMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRT---FECG 431
           +KT  IEL G +      +  + +S +  L+A AS  G L I N +T + ++       G
Sbjct: 165 MKTKNIELMGSQVVSTRPVSQVSLSPNGSLVAAASWAGDLTILNSQTLEILQNKPQIHMG 224

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIE-DAHDAAIWSLDLTSDGKRLVT 490
                 + P G L+  G   G ++LF   S++L +    + H+  +        G+ + +
Sbjct: 225 KIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIAS 284

Query: 491 GSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISL 550
            S D T + WD + +  L          +L+  H        ++ SL    D   +    
Sbjct: 285 ASFDMTWRLWDVETQEEL----------LLQEGH------GKELYSLGFQCDGSLVCSGG 328

Query: 551 LDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKS 610
           +D    V+ + S K  +SL GH  P+ S+D S +   + T S D  I+IW L   + +++
Sbjct: 329 IDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQT 388

Query: 611 LFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGS 670
           + AH+  +  V F    +   S   D  +  +    +  +  L  H  ++  + IS + S
Sbjct: 389 ILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENAS 448

Query: 671 FVVSSSHDHSIRIW 684
            VVS   D S+++W
Sbjct: 449 SVVSCGWDRSVKLW 462

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 64/145 (44%), Gaps = 3/145 (2%)

Query: 88  HQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIV 147
           H     +A    D   ++WD+ ++  LL   GH   +  L F   G+ + SG  D   +V
Sbjct: 276 HPSGRFIASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKGLV 335

Query: 148 WDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGE 206
           WD+        L  H   I    W      + + S DG I++WDL+  +  +T +AH   
Sbjct: 336 WDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHKSI 395

Query: 207 CWGLSVKD--DLLITTGTDSQVKLW 229
              ++ +   + L+++G D  + L+
Sbjct: 396 VTKVAFEKNGNCLVSSGYDKSINLY 420

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 64/146 (43%), Gaps = 5/146 (3%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D  L+  G  D    VWD+ S    ++ +GH   I  L +   G ++ +GS D  I +WD
Sbjct: 320 DGSLVCSGGIDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWD 379

Query: 150 LVGEVGLYKLRSHKDSIT--GFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGE- 206
           L        + +HK  +T   F   G + L+S+  D  I L+       + T   H  + 
Sbjct: 380 LRKPEEYQTILAHKSIVTKVAFEKNG-NCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKI 438

Query: 207 -CWGLSVKDDLLITTGTDSQVKLWKL 231
            C  +S     +++ G D  VKLW +
Sbjct: 439 LCVDISENASSVVSCGWDRSVKLWTM 464

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 61/146 (41%), Gaps = 19/146 (13%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           VWDI++G    +LS    P  S            L+   +   +A G  DG I++WDL  
Sbjct: 335 VWDIRSGKRAMSLSGHTKPIYS------------LDWSPNGYQVATGSGDGTIRIWDLRK 382

Query: 111 KTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFW 170
                    HK+ +T + F+  G  L+S   D +I ++       L  L+ H D I    
Sbjct: 383 PEEYQTILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKIL--- 439

Query: 171 C----QGEDWLISTSKDGMIKLWDLK 192
           C    +    ++S   D  +KLW ++
Sbjct: 440 CVDISENASSVVSCGWDRSVKLWTMQ 465

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 7/146 (4%)

Query: 92  DLLAVGYADGVIKVWDLMSKTV--LLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           DL+  G  +G +K++   S T+  +   NGH+  +T  +F  +G  + S S D    +WD
Sbjct: 236 DLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIASASFDMTWRLWD 295

Query: 150 LVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
           +  +  L     H   +   GF C G   + S   D    +WD+++ +   +   HT   
Sbjct: 296 VETQEELLLQEGHGKELYSLGFQCDG-SLVCSGGIDCKGLVWDIRSGKRAMSLSGHTKPI 354

Query: 208 WGLS-VKDDLLITTGT-DSQVKLWKL 231
           + L    +   + TG+ D  +++W L
Sbjct: 355 YSLDWSPNGYQVATGSGDGTIRIWDL 380

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 47/116 (40%), Gaps = 2/116 (1%)

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHN 629
           H   +  I  S    +I     + ++K++G       +  +L  H++ +   KF P    
Sbjct: 222 HMGKIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRF 281

Query: 630 FFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
             S S D   + WD E  E +     H  E+++L    DGS V S   D    +W+
Sbjct: 282 IASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKGLVWD 337

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 61/219 (27%), Positives = 102/219 (46%), Gaps = 19/219 (8%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLEL 530
            H  AI+S   + D K LV+ S DKT++ W      TLV                T    
Sbjct: 551 GHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLV----------------TYKGH 594

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY-GHKLPVLSIDISFDSKMII 589
           N  +  ++ SP   Y A +  D T +++  D + F L ++ GH   V  +    +   I 
Sbjct: 595 NHPVWDVQFSPVGHYFATASHDQTARLWSCDHI-FPLRIFSGHISDVDCVTFHPNGCYIF 653

Query: 590 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           T S+DK  ++W +  G+  +    H   I+SV   P+     + S+D V+  WD    + 
Sbjct: 654 TGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKS 713

Query: 650 IQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWEET 687
           ++KL  H +S V +L+ + + + +VS   D+S+RIW+ T
Sbjct: 714 LKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 80/198 (40%), Gaps = 36/198 (18%)

Query: 526 TTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKF-------------------- 565
           T L  N+++LSL  S D R  A    D+ +KV+ LD                        
Sbjct: 470 TFLNTNNEMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTLESKATKIQPSKSQAALRAGL 529

Query: 566 ----------------YLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK 609
                            + L GH   + S   S D+K+++++S DK I++W +D      
Sbjct: 530 DNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLV 589

Query: 610 SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDG 669
           +   H   +  V+F P  H F + S D   + W  +    ++    H S+V  +    +G
Sbjct: 590 TYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNG 649

Query: 670 SFVVSSSHDHSIRIWEET 687
            ++ + S D + R+W+ T
Sbjct: 650 CYIFTGSSDKTCRMWDIT 667

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 64/148 (43%), Gaps = 9/148 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D  LL     D  I++W + ++T L+ + GH   +  +QF   G    + S D    +W 
Sbjct: 564 DNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWS 623

Query: 150 LVGEVGLYKLRSHKDSITGFWC----QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
                 ++ LR     I+   C        ++ + S D   ++WD+ T + +   I HT 
Sbjct: 624 C---DHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTA 680

Query: 206 ECWGLSVKDD-LLITTGT-DSQVKLWKL 231
               ++V  D L + TG+ D  + +W +
Sbjct: 681 PILSVAVAPDGLRLATGSEDGVIHIWDI 708

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 64/144 (44%), Gaps = 4/144 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F+GH + +  + F   G  + +GS D    +WD+   
Sbjct: 610 FATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTG 669

Query: 154 VGLYKLRSHKDSITGFWCQGEDWLIST-SKDGMIKLWDLKTQQCIETHIAHTGEC---WG 209
             +     H   I       +   ++T S+DG+I +WD+ T + ++  I H         
Sbjct: 670 ESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLS 729

Query: 210 LSVKDDLLITTGTDSQVKLWKLNI 233
            + + ++L++ G+D+ V++W L +
Sbjct: 730 YNKESNILVSGGSDNSVRIWDLTV 753

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 88  HQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A I  +     G RL +GS+D  I +
Sbjct: 646 HPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHI 705

Query: 148 WDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDL 191
           WD+     L KL  H K ++    + +  + L+S   D  +++WDL
Sbjct: 706 WDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 51/102 (50%), Gaps = 2/102 (1%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRNGELQLFDLASS 462
           +   +S+ + ++W++ T + +R F       L+    P GL +  G+ +G + ++D+ + 
Sbjct: 652 IFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTG 711

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQV 504
             L  +     +A+ SL    +   LV+G +D +V+ WD  V
Sbjct: 712 KSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLTV 753

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 68/181 (37%), Gaps = 40/181 (22%)

Query: 73  DARGAKPAECTY-----------LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHK 121
           D + A P+ C +           L    D  L A G+ D  IKVW L   T+       +
Sbjct: 458 DLKTALPSVCMFTFLNTNNEMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTL-------E 510

Query: 122 AAITLLQFDGTGTRLISG----------SKDSNIIVWDLVGEVG-LYKLRSHKDSITGFW 170
           +  T +Q   +   L +G          S+++ I    LVG  G +Y      D+     
Sbjct: 511 SKATKIQPSKSQAALRAGLDNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPDN----- 565

Query: 171 CQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGL--SVKDDLLITTGTDSQVKL 228
                 L+S S+D  I+LW + T+  + T+  H    W +  S       T   D   +L
Sbjct: 566 ----KLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARL 621

Query: 229 W 229
           W
Sbjct: 622 W 622

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 140/323 (43%), Gaps = 40/323 (12%)

Query: 377 PAPLKTH-TIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVKTHKCIRTFECGYALT 435
           P P KT   I+L+ QR       I  DN  LA  S       N  T++ + + E  ++  
Sbjct: 452 PLPPKTTLDIKLEVQRVKESRDAIKLDNLQLALPSVCMYTFHN--TNRDMTSLE--FSDD 507

Query: 436 CKFLPGGLLVILGTRNGELQLFDLASSSL-----LDTIEDA-------HDAAIWSLDLTS 483
           C+      L   G ++ +++LF L  S L      D  EDA       H   ++S   + 
Sbjct: 508 CR------LAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYSTSFSP 561

Query: 484 DGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD 543
           D + LV+ S DKTV+ W     + LV                +    N  +  ++ SP  
Sbjct: 562 DNRYLVSSSEDKTVRLWSLDTHSALV----------------SYKGHNHPVWDVKFSPLG 605

Query: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
            Y A +  D+T +++  D +       GH   V  +    +   + T S+DK  ++W + 
Sbjct: 606 HYFATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIA 665

Query: 604 FGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWA 662
            GDC +        ++S    P+     + S+D ++  WD    + ++++  H ++ +++
Sbjct: 666 TGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYS 725

Query: 663 LAISTDGSFVVSSSHDHSIRIWE 685
           LA   +G+ ++S   DHS+R+W+
Sbjct: 726 LAYCKEGNALISGGADHSVRVWD 748

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   L  G +D   ++WD+ +   +  F G  A +        G  L +GS+D  
Sbjct: 641 VSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGI 700

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K++I    +C+  + LIS   D  +++WDLK
Sbjct: 701 INVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLK 750

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 60/142 (42%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLV-G 152
            A    D   ++W       L  F GH   +  + F   G  L +GS D    +WD+  G
Sbjct: 608 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATG 667

Query: 153 EVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWGLS 211
           +     L      I+        WL + S+DG+I +WD+ T + ++    H     + L+
Sbjct: 668 DCVRLFLGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLA 727

Query: 212 V--KDDLLITTGTDSQVKLWKL 231
              + + LI+ G D  V++W L
Sbjct: 728 YCKEGNALISGGADHSVRVWDL 749

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 61/160 (38%), Gaps = 10/160 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L     D  +++W L + + L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 562 DNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTARLWS 621

Query: 150 LVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
                 L     H + +    F   G  +L + S D   ++WD+ T  C+   +  T   
Sbjct: 622 CDHIYPLRIFAGHLNDVDCVSFHPNG-CYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPV 680

Query: 208 WGLSVKDD--LLITTGTDSQVKLWKLNIENDKLGGKLTEM 245
               V  D   L T   D  + +W +       G +L +M
Sbjct: 681 ISTCVSPDGRWLSTGSEDGIINVWDIGT-----GKRLKQM 715

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 59/172 (34%), Gaps = 26/172 (15%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVW-----------------DLMSKTVLLNFNGHKAA 123
           + T LE   D  L A G+ D  IK++                 D  SKT++    GH   
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLV----GHSGT 553

Query: 124 ITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTS 181
           +    F      L+S S+D  + +W L     L   + H   +    F   G  +  + S
Sbjct: 554 VYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGH-YFATAS 612

Query: 182 KDGMIKLWDLKTQQCIETHIAHTG--ECWGLSVKDDLLITTGTDSQVKLWKL 231
            D   +LW       +     H    +C         L T  +D   ++W +
Sbjct: 613 HDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 664

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 86/175 (49%), Gaps = 14/175 (8%)

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKF-------------YLSLYGHKLPVL 577
           N D+ SL+ S D R +A    D+ +K++ LD                   +L GH  PV 
Sbjct: 472 NRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLIGHSGPVY 531

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S+  S D++ ++++S DK +++W LD   C  S   H   +  VKF P  H F + S D 
Sbjct: 532 SVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQ 591

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE-ETEDQV 691
             + W  +    ++    H ++V  +A   +G++V++ S D + R+W+ +T D V
Sbjct: 592 TARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSV 646

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 129/295 (43%), Gaps = 46/295 (15%)

Query: 393 DMRSIDISDDNRLLATA-SNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRN 451
           DM S+  S+D+RL+A    +  +KIW++           G  L  K         L +++
Sbjct: 474 DMTSLQFSEDSRLVAAGFQDSHIKIWSLD----------GTPLESK---------LPSKS 514

Query: 452 GELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPG 511
            E       +++L+      H   ++S+  + D + LV+ S DKTV+ W       LV  
Sbjct: 515 KEAS----NTTTLI-----GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLV-- 563

Query: 512 TKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                         +    N  +  ++ SP   Y A    D T +++  D +       G
Sbjct: 564 --------------SYKGHNHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPLRIFAG 609

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V  +    +   ++T S+DK  ++W +  GD  +    H  S++SV   P+     
Sbjct: 610 HLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLT 669

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           + S+D V+  WD    + I+++  H +S V +L+ + +G+ +VS   D S+R+W+
Sbjct: 670 TGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWD 724

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 112/239 (46%), Gaps = 22/239 (9%)

Query: 368 PYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIR 426
           P E + P S +   ++T  L G    + S+  S DNR L +AS + ++++W++ T  C+ 
Sbjct: 505 PLESKLP-SKSKEASNTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLV 563

Query: 427 TFECGYALT--CKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSD 484
           +++         KF P G      + +   +L+       L  I   H   +  +    +
Sbjct: 564 SYKGHNHPVWDVKFSPLGHYFATVSHDQTARLWSCDHIYPL-RIFAGHLNDVDCVAFHPN 622

Query: 485 GKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDR 544
           G  ++TGS+DKT + WD Q  +++           L L H  +      ++S+ +SPD R
Sbjct: 623 GTYVLTGSSDKTCRMWDIQTGDSVR----------LFLGHTAS------VVSVAVSPDGR 666

Query: 545 YLAISLLDNTVKVFFLDSMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           +L     D  + V+ + + K    + GH K  V S+  + +  ++++  AD+++++W L
Sbjct: 667 WLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 50/111 (45%), Gaps = 13/111 (11%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYAD 100
           L  S+ +   +WDI+TGD +                   A    + V  D   L  G  D
Sbjct: 627 LTGSSDKTCRMWDIQTGDSVRLFL------------GHTASVVSVAVSPDGRWLTTGSED 674

Query: 101 GVIKVWDLMSKTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
           GVI VWD+ +   +    GH K+A+  L F+  G  L+SG  D ++ VWDL
Sbjct: 675 GVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDL 725

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 60/123 (48%), Gaps = 5/123 (4%)

Query: 88  HQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A++  +     G  L +GS+D  IIV
Sbjct: 620 HPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIV 679

Query: 148 WDLVGEVGLYKLRSH-KDSITGFWCQGE-DWLISTSKDGMIKLWDLK---TQQCIETHIA 202
           WD+     + ++R H K ++       E + L+S   D  +++WDLK    +  +E    
Sbjct: 680 WDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPALEPEQP 739

Query: 203 HTG 205
           ++G
Sbjct: 740 YSG 742

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 4/136 (2%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D   ++W       L  F GH   +  + F   GT +++GS D    +WD+     +   
Sbjct: 590 DQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 649

Query: 160 RSHKDSITGFWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---WGLSVKDD 215
             H  S+       +  WL + S+DG+I +WD+ T + I+    H          + + +
Sbjct: 650 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGN 709

Query: 216 LLITTGTDSQVKLWKL 231
           +L++ G D  V++W L
Sbjct: 710 ILVSGGADQSVRVWDL 725

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 56/111 (50%), Gaps = 5/111 (4%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRNGELQLFDLASS 462
           +L  +S+ + ++W+++T   +R F       ++    P G  +  G+ +G + ++D+ + 
Sbjct: 626 VLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTG 685

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD---FQVENTLVP 510
             +  +     +A+ SL    +G  LV+G AD++V+ WD   F  E  L P
Sbjct: 686 KRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKKFTNEPALEP 736

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 63/146 (43%), Gaps = 5/146 (3%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L     D  +++W L + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 538 DNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQTARLWS 597

Query: 150 LVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
                 L     H + +    F   G  ++++ S D   ++WD++T   +   + HT   
Sbjct: 598 CDHIYPLRIFAGHLNDVDCVAFHPNGT-YVLTGSSDKTCRMWDIQTGDSVRLFLGHTASV 656

Query: 208 WGLSVKDD-LLITTGT-DSQVKLWKL 231
             ++V  D   +TTG+ D  + +W +
Sbjct: 657 VSVAVSPDGRWLTTGSEDGVIIVWDI 682

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 65/154 (42%), Gaps = 36/154 (23%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTG--TRLIS 138
           + T L+  +D+ L+A G+ D  IK+W L                     DGT   ++L S
Sbjct: 474 DMTSLQFSEDSRLVAAGFQDSHIKIWSL---------------------DGTPLESKLPS 512

Query: 139 GSKDSNIIVWDLVGEVG-LYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCI 197
            SK+++     L+G  G +Y +    D+          +L+S S+D  ++LW L T  C+
Sbjct: 513 KSKEASNTT-TLIGHSGPVYSVSFSPDN---------RYLVSASEDKTVRLWSLDTFTCL 562

Query: 198 ETHIAHTGECWGL--SVKDDLLITTGTDSQVKLW 229
            ++  H    W +  S       T   D   +LW
Sbjct: 563 VSYKGHNHPVWDVKFSPLGHYFATVSHDQTARLW 596

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/338 (22%), Positives = 144/338 (42%), Gaps = 67/338 (19%)

Query: 397 IDISDDNRLLATASNGSLKIWNVKTHKCIRTFE-------------CG-------YALTC 436
           +  S+D + LAT  N + +I+ V   + I                  G       Y  + 
Sbjct: 334 VKFSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSV 393

Query: 437 KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKT 496
            F P G  +  G  +  ++++D+    ++  ++  H+  ++SLD   +G++LV+GS D+T
Sbjct: 394 CFSPDGEFLATGAEDKLIRIWDIQERKIVMVLK-GHEQDVYSLDYFPNGEKLVSGSGDRT 452

Query: 497 VKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD-RYLAISLLDNTV 555
           V+ WD +     +                 TL +   + ++ +SP+D +++A   LD  V
Sbjct: 453 VRIWDLRTGQCSL-----------------TLSIEYGVTTVAVSPNDGKFIAAGSLDRAV 495

Query: 556 KV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGL------ 602
           +V      F ++ +     L  GH+  V S+  + D   +++ S DK +K+W +      
Sbjct: 496 RVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNS 555

Query: 603 -----DFGD----CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL 653
                D G     C  +   H+D ++SV    +     S SKD  + +WD E    +  L
Sbjct: 556 NNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLML 615

Query: 654 YAHQSEVWALAISTDGSF------VVSSSHDHSIRIWE 685
             H++ V ++A++   +         + S D   RIW+
Sbjct: 616 QGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIWK 653

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 105/224 (46%), Gaps = 14/224 (6%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELN 531
           H + +  +  ++DG+ L TG  +KT + +    +  L+    D  +     +  T+    
Sbjct: 327 HSSVVCCVKFSNDGQFLATG-CNKTTQIYRVS-DGELIAKLSDDSVTSPDTSSATSGSTP 384

Query: 532 DDILSLR---ISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMI 588
              L +R    SPD  +LA    D  ++++ +   K  + L GH+  V S+D   + + +
Sbjct: 385 STDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKL 444

Query: 589 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYWDGEKF 647
           ++ S D+ ++IW L  G C  +L + +  + +V   P    F +  S D  V+ WD    
Sbjct: 445 VSGSGDRTVRIWDLRTGQCSLTL-SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTG 503

Query: 648 ECIQKL-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
             +++L         H+  V+++  + DG+ VVS S D ++++W
Sbjct: 504 FLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLW 547

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 96/220 (43%), Gaps = 23/220 (10%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGL---PPGASDARGAKPAECTYLE---VHQDTDLL 94
           L T   +   ++ +  G+L++ LSD     P  +S   G+ P+   Y+       D + L
Sbjct: 343 LATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSPDGEFL 402

Query: 95  AVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL-VGE 153
           A G  D +I++WD+  + +++   GH+  +  L +   G +L+SGS D  + +WDL  G+
Sbjct: 403 ATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQ 462

Query: 154 VGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIET-------HIAHTGE 206
             L     +  +          ++ + S D  +++WD  T   +E           H   
Sbjct: 463 CSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDS 522

Query: 207 CWGLS-VKDDLLITTGT-DSQVKLWKL-------NIENDK 237
            + +   +D   + +G+ D  VKLW +       N  NDK
Sbjct: 523 VYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDK 562

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 55/113 (48%), Gaps = 2/113 (1%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSK 635
           + S+  S D + + T + DK I+IW +        L  H+  + S+ + P      S S 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSG 449

Query: 636 DAVVKYWDGEKFECIQKLYAHQSEVWALAIS-TDGSFVVSSSHDHSIRIWEET 687
           D  V+ WD    +C   L + +  V  +A+S  DG F+ + S D ++R+W+ T
Sbjct: 450 DRTVRIWDLRTGQCSLTL-SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDST 501

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 55/134 (41%), Gaps = 22/134 (16%)

Query: 49  VNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVH-QDTDLLAVGYADGVIKVWD 107
           V VWD  TG L+  L       + +  G    +  Y  V  +D + +  G  D  +K+W+
Sbjct: 495 VRVWDSTTGFLVERLD------SENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWN 548

Query: 108 L---------------MSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVG 152
           +                S T  + + GHK  +  +        ++SGSKD  I+ WD   
Sbjct: 549 MRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKES 608

Query: 153 EVGLYKLRSHKDSI 166
              L  L+ H++S+
Sbjct: 609 GNPLLMLQGHRNSV 622

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 124/283 (43%), Gaps = 45/283 (15%)

Query: 432 YALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTG 491
           Y  +  F P G  +  G  +  ++++D+A   ++  ++  H+  I+SLD    G +LV+G
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQ-GHEQDIYSLDYFPSGDKLVSG 496

Query: 492 SADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS-PDDRYLAISL 550
           S D+TV+ WD +     +                 TL + D + ++ +S  D +Y+A   
Sbjct: 497 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSLGDGKYIAAGS 539

Query: 551 LDNTVKV------FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 540 LDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLS 599

Query: 604 FGD-------------CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            G              C  +   H+D ++SV          S SKD  V +WD +    +
Sbjct: 600 SGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPL 659

Query: 651 QKLYAHQSEVWALAISTDGSF------VVSSSHDHSIRIWEET 687
             L  H++ V ++A++             + S D   RIW+ T
Sbjct: 660 LMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIWKYT 702

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 82/165 (49%), Gaps = 9/165 (5%)

Query: 534 ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA 593
           I S+  SPD ++LA    D  ++++ +   K  + L GH+  + S+D       +++ S 
Sbjct: 439 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 498

Query: 594 DKNIKIWGLDFGDCHKSLFAHQDSIMSVKF-LPESHNFFSCSKDAVVKYWDGEKFECIQK 652
           D+ ++IW L  G C  +L + +D + +V   L +     + S D  V+ WD E    +++
Sbjct: 499 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVER 557

Query: 653 L-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQ 690
           L         H+  V+++  + DG  VVS S D S+++W  +  Q
Sbjct: 558 LDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQ 602

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 75/155 (48%), Gaps = 14/155 (9%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   LA G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + +WD
Sbjct: 447 DGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWD 506

Query: 150 L-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQQCIET------- 199
           L  G+  L    S +D +T       D  ++ + S D  +++WD +T   +E        
Sbjct: 507 LRTGQCSL--TLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSENEL 564

Query: 200 HIAHTGECWGLS-VKDDLLITTGT-DSQVKLWKLN 232
              H    + +   +D   + +G+ D  VKLW L+
Sbjct: 565 GTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLS 599

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 12/114 (10%)

Query: 92  DLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLV 151
           D L  G  D  +++WDL +    L  +      T+    G G  + +GS D  + VWD  
Sbjct: 491 DKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWD-- 548

Query: 152 GEVGLYKLR---------SHKDSI-TGFWCQGEDWLISTSKDGMIKLWDLKTQQ 195
            E G    R          HKDS+ +  + +    ++S S D  +KLW+L + Q
Sbjct: 549 AETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLSSGQ 602

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 55/132 (41%), Gaps = 20/132 (15%)

Query: 49  VNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVH-QDTDLLAVGYADGVIKVWD 107
           V VWD +TG L+  L       + +  G    +  Y  V  +D   +  G  D  +K+W+
Sbjct: 544 VRVWDAETGFLVERLD------SENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 597

Query: 108 LMSK-------------TVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEV 154
           L S              T  + + GHK  +  +        ++SGSKD  ++ WD     
Sbjct: 598 LSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGN 657

Query: 155 GLYKLRSHKDSI 166
            L  L+ H++S+
Sbjct: 658 PLLMLQGHRNSV 669

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/285 (23%), Positives = 131/285 (45%), Gaps = 29/285 (10%)

Query: 345 TITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNR 404
           TIT+ K +L+    +  ++ Y I       T+P P+ +     +G R ++ S+   +DNR
Sbjct: 39  TITNDK-KLLAAAGHQNVKLYDI-----NTTNPNPVAS----FEGHRGNVTSLSFQNDNR 88

Query: 405 LLATAS-NGSLKIWNVKTHKCIRTFECGYALT-CKFLPGGLLVILGTRNGELQLFDLASS 462
            + T+S +G++K+W+V++    RT++    +      P    +I   R+G ++++DL  +
Sbjct: 89  WMVTSSEDGTIKVWDVRSPSVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGEN 148

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KFLPIL 520
                +    D  + SL L +DG  LV  ++      W+       +P   D     P+ 
Sbjct: 149 QCTHQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVWE-------MPNRTDASNLKPVT 201

Query: 521 KLN-HDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLD-SMKFYLSLYGHKLPVLS 578
           K   HD        I  + +S D ++LA    D+T +++ +D +   + +L GH+  V  
Sbjct: 202 KFRAHDAY------ITRILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQRWVWD 255

Query: 579 IDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
              S DS  +IT+S+D  +++W L   +  +    H    + V  
Sbjct: 256 CAFSADSAYLITASSDHYVRLWDLSTREIVRQYSGHHKGAVCVAL 300

 Score = 72.0 bits (175), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 122/292 (41%), Gaps = 29/292 (9%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGG---LLVILGTRNGELQLFDLAS 461
           L++   + +++ W   T  C RT +   +   +        LL   G +N +L   +  +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLTITNDKKLLAAAGHQNVKLYDINTTN 64

Query: 462 SSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILK 521
            + + + E  H   + SL   +D + +VT S D T+K WD  V +  VP T     P+ +
Sbjct: 65  PNPVASFE-GHRGNVTSLSFQNDNRWMVTSSEDGTIKVWD--VRSPSVPRTYKHNAPVNE 121

Query: 522 LNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-LPVLSID 580
           +                I P+   L     D  ++++ L   +    L      PV S+ 
Sbjct: 122 V---------------AIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLS 166

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSL-----FAHQDSIMSVKFLPESHNFFS-CS 634
           ++ D  M++ +++  N  +W +       +L     F   D+ ++   L     F + CS
Sbjct: 167 LATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCS 226

Query: 635 KDAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            D   + W   + F     L  HQ  VW  A S D ++++++S DH +R+W+
Sbjct: 227 ADHTARIWSIDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLWD 278

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 58/121 (47%), Gaps = 7/121 (5%)

Query: 80  AECTYLEVHQDTDLLAVGYADGVIKVWDL--MSKTVLLNFNGHKAAITLLQFDGTGTRLI 137
           ++   L +  D  LLA      V K++D+   +   + +F GH+  +T L F      ++
Sbjct: 33  SQVNRLTITNDKKLLAAAGHQNV-KLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMV 91

Query: 138 SGSKDSNIIVWDLVGE--VGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQ 195
           + S+D  I VWD+        YK  +  + +     QGE  LIS  +DG I++WDL   Q
Sbjct: 92  TSSEDGTIKVWDVRSPSVPRTYKHNAPVNEVAIHPNQGE--LISCDRDGNIRIWDLGENQ 149

Query: 196 C 196
           C
Sbjct: 150 C 150

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 62/156 (39%), Gaps = 13/156 (8%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYAD 100
           L  +  +NV ++DI T +         P   +   G +    T L    D   +     D
Sbjct: 47  LAAAGHQNVKLYDINTTN---------PNPVASFEGHR-GNVTSLSFQNDNRWMVTSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLR 160
           G IKVWD+ S +V   +  H A +  +        LIS  +D NI +WDL      ++L 
Sbjct: 97  GTIKVWDVRSPSVPRTYK-HNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLT 155

Query: 161 SHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQ 194
              D+         D   L++ +  G   +W++  +
Sbjct: 156 PEDDTPVQSLSLATDGSMLVAANSKGNCYVWEMPNR 191

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 58/109 (53%), Gaps = 3/109 (2%)

Query: 584 DSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKY 641
           + K ++ ++  +N+K++ ++  + +   S   H+ ++ S+ F  ++    + S+D  +K 
Sbjct: 42  NDKKLLAAAGHQNVKLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKV 101

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQ 690
           WD  +   + + Y H + V  +AI  +   ++S   D +IRIW+  E+Q
Sbjct: 102 WD-VRSPSVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQ 149

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 36/91 (39%), Gaps = 9/91 (9%)

Query: 69  PGASDARGAKP--------AECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVL-LNFNG 119
           P  +DA   KP        A  T + +  D   LA   AD   ++W +     L    +G
Sbjct: 189 PNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDG 248

Query: 120 HKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
           H+  +    F      LI+ S D  + +WDL
Sbjct: 249 HQRWVWDCAFSADSAYLITASSDHYVRLWDL 279

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/295 (23%), Positives = 130/295 (44%), Gaps = 39/295 (13%)

Query: 393 DMRSIDISDDNRLLATA-SNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRN 451
           DM S++ SDD RL A    +  +KI+++           G +L  K      L     + 
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLD----------GSSLNSK------LTESNKKT 541

Query: 452 GELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPG 511
            +L   D ++S+L+      H   ++S   + D + LV+GS DKTV+ W      +LV  
Sbjct: 542 NKLLNNDESTSTLI-----GHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLV-- 594

Query: 512 TKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG 571
                         +    N  +  +  SP   Y A +  D+T +++  D +       G
Sbjct: 595 --------------SYKGHNHPVWDVEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAG 640

Query: 572 HKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF 631
           H   V  +    +   + T S+DK  ++W +  GD  +        +MS    P+     
Sbjct: 641 HLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLS 700

Query: 632 SCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           + S+D V+  WD    + ++++  H ++ +++L+ + +G+ ++S   DHS+R+W+
Sbjct: 701 TGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWD 755

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 77/175 (44%), Gaps = 20/175 (11%)

Query: 533 DILSLRISPDDRYLAISLLDNTVKVFFLD--SMKFYLS------------------LYGH 572
           D+ SL  S D R  A    D+ +K+F LD  S+   L+                  L GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 573 KLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFS 632
              V S   S D++ +++ S DK +++W +D      S   H   +  V+F P  H F +
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFAT 617

Query: 633 CSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEET 687
            S D   + W  +    ++    H ++V  ++   +G ++ + S D + R+W+ T
Sbjct: 618 ASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIT 672

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 99/224 (44%), Gaps = 23/224 (10%)

Query: 384 TIELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYALT---CKFL 439
           T  L G    + S   S DNR L + S + ++++W++ TH  + +++ G+       +F 
Sbjct: 551 TSTLIGHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYK-GHNHPVWDVEFS 609

Query: 440 PGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P G      + +   +L+       L  I   H   +  +    +G  L TGS+DKT + 
Sbjct: 610 PLGHYFATASHDHTARLWSCDHIYPL-RIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRM 668

Query: 500 WDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFF 559
           WD    +++                   L L   ++S  +SPD R+L+    D  + V+ 
Sbjct: 669 WDITTGDSV----------------RLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINVWD 712

Query: 560 LDSMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           + + K    + GH K  + S+  + +  ++I+  AD ++++W L
Sbjct: 713 IGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDL 756

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 47/101 (46%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +WDI TGD +  L  GL            A      V  D   L+ G  DGVI VWD+ +
Sbjct: 668 MWDITTGDSVR-LFLGLT-----------APVMSTSVSPDGRWLSTGSEDGVINVWDIGT 715

Query: 111 KTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  L ++  G  LISG  D ++ VWDL
Sbjct: 716 GKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDL 756

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 66/156 (42%), Gaps = 6/156 (3%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLV-- 151
            A    D   ++W       L  F GH   +  + F   G  L +GS D    +WD+   
Sbjct: 615 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTG 674

Query: 152 GEVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWGL 210
             V L+   +     T     G  WL + S+DG+I +WD+ T + ++    H     + L
Sbjct: 675 DSVRLFLGLTAPVMSTSVSPDGR-WLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSL 733

Query: 211 SV--KDDLLITTGTDSQVKLWKLNIENDKLGGKLTE 244
           S   + ++LI+ G D  V++W L     + G +  E
Sbjct: 734 SYNKEGNVLISGGADHSVRVWDLKKATTESGAEPEE 769

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 88  HQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIV 147
           H +   L  G +D   ++WD+ +   +  F G  A +        G  L +GS+D  I V
Sbjct: 651 HPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGSEDGVINV 710

Query: 148 WDLVGEVGLYKLRSH-KDSITGFWCQGE-DWLISTSKDGMIKLWDLK 192
           WD+     L ++R H K++I       E + LIS   D  +++WDLK
Sbjct: 711 WDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLK 757

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 62/160 (38%), Gaps = 10/160 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  ++F   G    + S D    +W 
Sbjct: 569 DNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTARLWS 628

Query: 150 LVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
                 L     H + +    F   G  +L + S D   ++WD+ T   +   +  T   
Sbjct: 629 CDHIYPLRIFAGHLNDVDCVSFHPNG-CYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPV 687

Query: 208 WGLSVKDD--LLITTGTDSQVKLWKLNIENDKLGGKLTEM 245
              SV  D   L T   D  + +W +       G +L +M
Sbjct: 688 MSTSVSPDGRWLSTGSEDGVINVWDIGT-----GKRLKQM 722

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 61/175 (34%), Gaps = 25/175 (14%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTV-------------LLNFN-------GH 120
           + T LE   D  L A G+ D  IK++ L   ++             LLN +       GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI--TGFWCQGEDWLI 178
              +    F      L+SGS+D  + +W +     L   + H   +    F   G  +  
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGH-YFA 616

Query: 179 STSKDGMIKLWDLKTQQCIETHIAHTG--ECWGLSVKDDLLITTGTDSQVKLWKL 231
           + S D   +LW       +     H    +C         L T  +D   ++W +
Sbjct: 617 TASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 671

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/346 (21%), Positives = 139/346 (40%), Gaps = 75/346 (21%)

Query: 397 IDISDDNRLLATASNGSLKIWNVKTHKCIRTFECG-------------YALTCKFLPGGL 443
           +  S D   LAT  N + +++ V T + I                   Y  +  F P G 
Sbjct: 449 VKFSYDGEFLATGCNKTTQVYRVSTGELIAKLSDDNVKLDSNSTSTDLYIRSVCFSPDGK 508

Query: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ 503
            +  G  +  ++++D+    ++  ++  H+  ++SLD   DG++LV+GS D+TV+ WD +
Sbjct: 509 FLATGAEDKLIRIWDIQEGKIVMVLK-GHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLR 567

Query: 504 VENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDD-RYLAISLLDNTVKV----- 557
                +                 TL + D + ++ +SP D R++A   LD  V+V     
Sbjct: 568 TGQCSL-----------------TLSIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTT 610

Query: 558 -FFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDF----------- 604
            F ++ +     L  GH+  V S+  + D   +++ S DK++K+W L             
Sbjct: 611 GFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWNLGNDVNSNNNGNDS 670

Query: 605 -------------------GDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGE 645
                                C  +   H+D ++SV          S SKD  V +WD +
Sbjct: 671 SSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYILSGSKDRGVLFWDKK 730

Query: 646 KFECIQKLYAHQSEVWALAISTDGSF------VVSSSHDHSIRIWE 685
               +  L  H++ V ++A++             + S D   RIW+
Sbjct: 731 SGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGSGDCKARIWK 776

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 109/221 (49%), Gaps = 15/221 (6%)

Query: 472 HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELN 531
           H + +  +  + DG+ L TG  +KT + +       +   + D     +KL+ ++T   +
Sbjct: 442 HSSVVCCVKFSYDGEFLATG-CNKTTQVYRVSTGELIAKLSDDN----VKLDSNST-STD 495

Query: 532 DDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITS 591
             I S+  SPD ++LA    D  ++++ +   K  + L GH+  V S+D   D + +++ 
Sbjct: 496 LYIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSG 555

Query: 592 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSC-SKDAVVKYWDGEKFECI 650
           S D+ ++IW L  G C  +L + +D + +V   P    F +  S D  V+ WD      +
Sbjct: 556 SGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLV 614

Query: 651 QKL-------YAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           ++L         HQ  V+++  + DG+ VVS S D S+++W
Sbjct: 615 ERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLW 655

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 68/143 (47%), Gaps = 10/143 (6%)

Query: 546 LAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG 605
           L   L D+ VK   LDS      LY     + S+  S D K + T + DK I+IW +  G
Sbjct: 476 LIAKLSDDNVK---LDSNSTSTDLY-----IRSVCFSPDGKFLATGAEDKLIRIWDIQEG 527

Query: 606 DCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI 665
                L  H+  + S+ + P+     S S D  V+ WD    +C   L + +  V  +A+
Sbjct: 528 KIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAV 586

Query: 666 ST-DGSFVVSSSHDHSIRIWEET 687
           S  DG F+ + S D ++R+W+ T
Sbjct: 587 SPHDGRFIAAGSLDRAVRVWDST 609

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 92/208 (44%), Gaps = 25/208 (12%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQ-----DTDLLA 95
           L T   +   V+ + TG+L++ LSD       + +    +  T L +       D   LA
Sbjct: 458 LATGCNKTTQVYRVSTGELIAKLSD------DNVKLDSNSTSTDLYIRSVCFSPDGKFLA 511

Query: 96  VGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL-VGEV 154
            G  D +I++WD+    +++   GH+  +  L +   G +L+SGS D  + +WDL  G+ 
Sbjct: 512 TGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQC 571

Query: 155 GLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQQCIET-------HIAHTG 205
            L    S +D +T       D  ++ + S D  +++WD  T   +E           H  
Sbjct: 572 SL--TLSIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQD 629

Query: 206 ECWGLS-VKDDLLITTGT-DSQVKLWKL 231
             + +   +D   + +G+ D  VKLW L
Sbjct: 630 SVYSVVFTRDGNEVVSGSLDKSVKLWNL 657

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/254 (20%), Positives = 92/254 (36%), Gaps = 70/254 (27%)

Query: 25  WLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLMSTLS--DGLPPGASDARGAKPAEC 82
           + P   +  SGSG           V +WD++TG    TLS  DG+               
Sbjct: 545 YFPDGQKLVSGSGD--------RTVRIWDLRTGQCSLTLSIEDGV--------------T 582

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------GHKAAITLLQFDGTGTR 135
           T      D   +A G  D  ++VWD  +  ++   +       GH+ ++  + F   G  
Sbjct: 583 TVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNE 642

Query: 136 LISGSKDSNIIVWDLV----------------------------GEVGLYKLR--SHKDS 165
           ++SGS D ++ +W+L                             G     ++    HKD 
Sbjct: 643 VVSGSLDKSVKLWNLGNDVNSNNNGNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDF 702

Query: 166 ITGFWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAH--------TGECWGLSVKDDL 216
           +      Q +++++S SKD  +  WD K+   +     H            + L  K ++
Sbjct: 703 VLSVTTSQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNV 762

Query: 217 LITTGTDSQVKLWK 230
             T   D + ++WK
Sbjct: 763 FATGSGDCKARIWK 776

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/307 (21%), Positives = 120/307 (39%), Gaps = 54/307 (17%)

Query: 387 LQGQRTDMRSIDISDDNRLLATASNGS-LKIWNVKTHKCIRTFECGYAL------TCKFL 439
            Q    DM  +D SDD R+ A     S +KIW++                     TCK L
Sbjct: 462 FQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTL 521

Query: 440 PGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
            G                              H   ++S   + D K L++GS DKTV+ 
Sbjct: 522 VG------------------------------HSGTVYSTSFSPDNKYLLSGSEDKTVRL 551

Query: 500 WDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFF 559
           W       LV                +    N  +  +  SP   Y A +  D T +++ 
Sbjct: 552 WSMDTHTALV----------------SYKGHNHPVWDVSFSPLGHYFATASHDQTARLWS 595

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
            D +       GH   V  +    +   + T S+DK  ++W +  GD  +    H   ++
Sbjct: 596 CDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVI 655

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHD 678
           S+   P+     + S+D ++  WD    + ++++  H ++ +++L+ S +G+ ++S   D
Sbjct: 656 SIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGAD 715

Query: 679 HSIRIWE 685
           H++R+W+
Sbjct: 716 HTVRVWD 722

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 62/132 (46%), Gaps = 4/132 (3%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRNGELQLFDLASS 462
           +   +S+ + ++W+V T   +R F       ++    P G  +  G+ +G + ++D+ + 
Sbjct: 624 VFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTG 683

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKL 522
             L  +      AI+SL  + +G  L++G AD TV+ WD +   T      D+  P +  
Sbjct: 684 KRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPSAEPDE--PFIGY 741

Query: 523 NHDTTLELNDDI 534
             D T  +N DI
Sbjct: 742 LGDVTASINQDI 753

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 104/265 (39%), Gaps = 65/265 (24%)

Query: 387 LQGQRTDMRSIDISDDNR-LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLV 445
           L G    + S   S DN+ LL+ + + ++++W++ TH  + +++                
Sbjct: 521 LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK---------------- 564

Query: 446 ILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
                                     H+  +W +  +  G    T S D+T + W     
Sbjct: 565 -------------------------GHNHPVWDVSFSPLGHYFATASHDQTARLW----- 594

Query: 506 NTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFL---DS 562
                 + D   P+          LN D+  +   P+  Y+     D T +++ +   DS
Sbjct: 595 ------SCDHIYPLRIF----AGHLN-DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 643

Query: 563 MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAH-QDSIMSV 621
           ++ +L   GH  PV+SI +  D + + T S D  I +W +  G   K +  H +++I S+
Sbjct: 644 VRLFL---GHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSL 700

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEK 646
            +  E +   S   D  V+ WD +K
Sbjct: 701 SYSKEGNVLISGGADHTVRVWDLKK 725

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 58/142 (40%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 582 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 641

Query: 154 VGLYKLRSHKDSITGFW-CQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---WG 209
             +     H   +     C    WL + S+DG+I +WD+ T + ++    H         
Sbjct: 642 DSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLS 701

Query: 210 LSVKDDLLITTGTDSQVKLWKL 231
            S + ++LI+ G D  V++W L
Sbjct: 702 YSKEGNVLISGGADHTVRVWDL 723

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 44/101 (43%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +WD+ TGD +        P  S            + V  D   L+ G  DG+I VWD+ +
Sbjct: 635 MWDVSTGDSVRLFLGHTAPVIS------------IAVCPDGRWLSTGSEDGIINVWDIGT 682

Query: 111 KTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  L +   G  LISG  D  + VWDL
Sbjct: 683 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +  +     G  L +GS+D  
Sbjct: 615 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGI 674

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K++I    + +  + LIS   D  +++WDLK
Sbjct: 675 INVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 35/185 (18%), Positives = 59/185 (31%), Gaps = 33/185 (17%)

Query: 77  AKPAECTY-----------LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN------- 118
           A P+ C Y           L+   D  + A G+ D  IK+W L   ++            
Sbjct: 453 ALPSVCMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDK 512

Query: 119 ----------GHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI-- 166
                     GH   +    F      L+SGS+D  + +W +     L   + H   +  
Sbjct: 513 DEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWD 572

Query: 167 TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWGLSVKDDLLITTGTDS 224
             F   G  +  + S D   +LW       +     H    +C         + T  +D 
Sbjct: 573 VSFSPLGH-YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDK 631

Query: 225 QVKLW 229
             ++W
Sbjct: 632 TCRMW 636

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 86.7 bits (213), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 114/269 (42%), Gaps = 26/269 (9%)

Query: 442 GLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWD 501
           G  +  G   G +++    +  +  +I+ AH+  I  LD   DG  L++G  D  VK WD
Sbjct: 184 GQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWD 243

Query: 502 F------QVENTLVPGTKDKFLPILKLNHDTTLEL-------------------NDDILS 536
                  ++       ++ K  P  +L    + +L                   +  + +
Sbjct: 244 MTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYT 303

Query: 537 LRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKN 596
           +    D   LA + LD    ++ L S +  + L GH   +  +D S +   + T+ AD  
Sbjct: 304 IAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGT 363

Query: 597 IKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF-SCSKDAVVKYWDGEKFECIQKLYA 655
           +++W +       +L AHQ + + VKF   +  F  SC  D +V  ++ + ++ +  L  
Sbjct: 364 VRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEG 423

Query: 656 HQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           H   V+ + I+ DGS + S   D S++ W
Sbjct: 424 HTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 70/151 (46%), Gaps = 4/151 (2%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           L+ H D + L  G  D ++K+WD+ S +      GH   ++ ++   +G    S S D  
Sbjct: 221 LDWHPDGNHLLSGGGDNLVKLWDMTSNS-FEELRGHAGRVSRVKVHPSGRLAASASFDLT 279

Query: 145 IIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLISTSK-DGMIKLWDLKTQQCIETHIAH 203
            I+WDL  +V L     H  ++     Q +  L++++  D +  +WDL++ + I     H
Sbjct: 280 WILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGH 339

Query: 204 TGECWGL--SVKDDLLITTGTDSQVKLWKLN 232
            G   G+  S     L T G D  V++W + 
Sbjct: 340 AGAISGVDWSPNGYQLATAGADGTVRVWDIR 370

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 103/273 (37%), Gaps = 34/273 (12%)

Query: 425 IRTFECGYALTCKFLPG---------GLLVILGTRNGE---LQLFDLASSSLLDTIEDAH 472
           +R F  GY+L C              G+   L  R  E   L  F+L  S L   + D H
Sbjct: 118 VRKFLVGYSLDCAARRLAAQRARQGLGVKAYLQQRRAEGKRLATFELVGSQL---VADKH 174

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELND 532
              +  + +  DG++L TG    ++K    +                L +          
Sbjct: 175 ---VSQVAVHRDGQQLATGCWGGSIKVVSCET---------------LGIAKSIDAAHEG 216

Query: 533 DILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
            I  L   PD  +L     DN VK++ + S  F   L GH   V  + +    ++  ++S
Sbjct: 217 KIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNSFE-ELRGHAGRVSRVKVHPSGRLAASAS 275

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQK 652
            D    +W L+     +    H  ++ ++ F  +     S   DAV   WD    E I K
Sbjct: 276 FDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMK 335

Query: 653 LYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           L  H   +  +  S +G  + ++  D ++R+W+
Sbjct: 336 LEGHAGAISGVDWSPNGYQLATAGADGTVRVWD 368

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 71/177 (40%), Gaps = 5/177 (2%)

Query: 57  GDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLN 116
           GD +  L D       + RG      + ++VH    L A    D    +WDL  K  L  
Sbjct: 235 GDNLVKLWDMTSNSFEELRG-HAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQL 293

Query: 117 FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGED 175
             GH  A+  + F   G  L S   D+   +WDL     + KL  H  +I+G  W     
Sbjct: 294 QEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGY 353

Query: 176 WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDD---LLITTGTDSQVKLW 229
            L +   DG +++WD++        +AH      +  K +    L++ G D  V ++
Sbjct: 354 QLATAGADGTVRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIF 410

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 68/154 (44%), Gaps = 5/154 (3%)

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNG-HKAAITLLQFDGTGTRLISGSK 141
           + + VH+D   LA G   G IKV    +  +  + +  H+  I  L +   G  L+SG  
Sbjct: 176 SQVAVHRDGQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGG 235

Query: 142 DSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWL-ISTSKDGMIKLWDLKTQQCIETH 200
           D+ + +WD+       +LR H   ++         L  S S D    LWDL+ +  ++  
Sbjct: 236 DNLVKLWDMTSN-SFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQ 294

Query: 201 IAHTGECWGLSVKDD--LLITTGTDSQVKLWKLN 232
             H+   + ++ + D  LL + G D+   +W L 
Sbjct: 295 EGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLR 328

>Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR178W
           (PRP4) - associated with the U4/U6 snRNP [contig 8] FULL
          Length = 474

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/245 (24%), Positives = 111/245 (45%), Gaps = 13/245 (5%)

Query: 440 PGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P G  +  G+ NG++++    S  ++ +++ AHD  I  +  +SD + L TG AD  VK 
Sbjct: 192 PDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKI 251

Query: 500 WDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFF 559
           W+ Q +      +  +   ++   H+        +  ++  P DR++A +  D T +++ 
Sbjct: 252 WNPQAQ------SHSEASRVVLRGHEAR------VSKVKFHPSDRFVASASFDMTWRLWD 299

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           ++         GH   V  +D   D  ++ ++  D    +W +  G     L  H   I 
Sbjct: 300 VERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIY 359

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTD-GSFVVSSSHD 678
            V + P  H+  + S D  V+ WD  K      + AH S V  +    + G+F+VSSS+D
Sbjct: 360 GVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYD 419

Query: 679 HSIRI 683
            +I +
Sbjct: 420 RTIGV 424

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 133/290 (45%), Gaps = 40/290 (13%)

Query: 325 ILHP--FQTVRSLY-----KIKSASWTTITSSKLELVLTTSNNTIEYYSIPYEKREPTSP 377
           ILHP   + VRSL      KI   +W++   S+L L    ++N ++ ++       P + 
Sbjct: 208 ILHPQSLEVVRSLDGAHDDKIGGVAWSS--DSQL-LATGGADNLVKIWN-------PQAQ 257

Query: 378 APLKTHTIELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYA--L 434
           +  +   + L+G    +  +     +R +A+AS + + ++W+V+    ++  E G+A  +
Sbjct: 258 SHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQE-GHAKEV 316

Query: 435 TC-KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSA 493
            C  F   G L+     +    ++D+ +   L  +E  H   I+ +  + +G  + TGS 
Sbjct: 317 YCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLE-GHAKPIYGVSWSPNGHHVATGSG 375

Query: 494 DKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTL-ELNDDILSLRISPDDRYLAISLLD 552
           D TV+ WD +  N           P   L H++ + E+N +        +  +L  S  D
Sbjct: 376 DGTVQVWDIRKANK----------PSSILAHNSIVSEVNFE------KENGNFLVSSSYD 419

Query: 553 NTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL 602
            T+ VF   S     SL GH   +LS+DIS     + +S  D+++KIW L
Sbjct: 420 RTIGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWAL 469

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 72/167 (43%), Gaps = 5/167 (2%)

Query: 524 HDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG-HKLPVLSIDIS 582
           H + +  +  +  +  SPD   LA    +  VK+    S++   SL G H   +  +  S
Sbjct: 175 HGSQVVFSRPVSQVARSPDGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWS 234

Query: 583 FDSKMIITSSADKNIKIWGLDFGDCHKS----LFAHQDSIMSVKFLPESHNFFSCSKDAV 638
            DS+++ T  AD  +KIW        ++    L  H+  +  VKF P      S S D  
Sbjct: 235 SDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMT 294

Query: 639 VKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            + WD E+   +Q    H  EV+ L    DGS + S+  D    +W+
Sbjct: 295 WRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSVGHVWD 341

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 71/154 (46%), Gaps = 9/154 (5%)

Query: 90  DTDLLAVGYADGVIKVWDLM----SKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNI 145
           D+ LLA G AD ++K+W+      S+   +   GH+A ++ ++F  +   + S S D   
Sbjct: 236 DSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTW 295

Query: 146 IVWDLVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
            +WD+  E  L     H   +    F C G   L S   D +  +WD++T + +     H
Sbjct: 296 RLWDVERETELQLQEGHAKEVYCLDFQCDGS-LLCSAGLDSVGHVWDMRTGRSLMVLEGH 354

Query: 204 TGECWGLS-VKDDLLITTGT-DSQVKLWKLNIEN 235
               +G+S   +   + TG+ D  V++W +   N
Sbjct: 355 AKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKAN 388

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 53/126 (42%), Gaps = 1/126 (0%)

Query: 80  AECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISG 139
           A  + ++ H     +A    D   ++WD+  +T L    GH   +  L F   G+ L S 
Sbjct: 272 ARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSA 331

Query: 140 SKDSNIIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
             DS   VWD+     L  L  H   I G  W      + + S DG +++WD++      
Sbjct: 332 GLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIRKANKPS 391

Query: 199 THIAHT 204
           + +AH 
Sbjct: 392 SILAHN 397

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 71/163 (43%), Gaps = 6/163 (3%)

Query: 77  AKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRL 136
           AK   C  L+   D  LL     D V  VWD+ +   L+   GH   I  + +   G  +
Sbjct: 313 AKEVYC--LDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNGHHV 370

Query: 137 ISGSKDSNIIVWDLVGEVGLYKLRSHKDSIT--GFWCQGEDWLISTSKDGMIKLWDLKTQ 194
            +GS D  + VWD+        + +H   ++   F  +  ++L+S+S D  I ++   + 
Sbjct: 371 ATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFATGSW 430

Query: 195 QCIETHIAHTGECWGLSVKDDL--LITTGTDSQVKLWKLNIEN 235
             + +   HT +   + +      L ++G D  VK+W L + +
Sbjct: 431 IKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWALGVRS 473

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 103/231 (44%), Gaps = 22/231 (9%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVENTLVPGTKDKF-LPILKLNHDT 526
           + H+  + SL  TS G+   L++GS DKT+  W          G   KF +P+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+ I   + 
Sbjct: 66  HI-----VQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN-----FFSCSKDAVVKY 641
           MII+ S DK IK+W +  G C  +L  H D +  V+  P   N       S   D +VK 
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKA 179

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVF 692
           W+  +F+       H   V A+  S DG+ + S+  D  I +W   E +  
Sbjct: 180 WNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAM 230

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 64/140 (45%), Gaps = 9/140 (6%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGS+D  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDSITGFWCQGEDW------LISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVK 213
             H D ++       D       +IS   D M+K W+L   Q     + H G    ++  
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 214 DD--LLITTGTDSQVKLWKL 231
            D  L+ + G D ++ LW L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 100/243 (41%), Gaps = 40/243 (16%)

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENT----------------------LVPGTKDKFLP 518
           LT DG   ++ S DKT++ WD     T                      ++ G++DK + 
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 519 ILKLNHD---TTLELNDDILSLRISP----DDRYLAISLL-DNTVKVFFLDSMKFYLSLY 570
           +  +      T L  ND +  +RI+P    DD    IS   D  VK + L+  +      
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V ++  S D  +I ++  D  I +W L       +L A QD + S+ F P  + +
Sbjct: 193 GHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSA-QDEVFSLAFSPNRY-W 250

Query: 631 FSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--LAISTDGSFVVSSSHDHSIR 682
            + +  + +K +  +    I  L      Y   +E  A  LA S DG  + +   D  IR
Sbjct: 251 LAAATASGIKIFCLDPQSLIDDLRPEFAGYNKSAEPHAVSLAWSADGQTLFAGYTDSVIR 310

Query: 683 IWE 685
           +W+
Sbjct: 311 VWQ 313

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     ++++ S DK +  W L      FG   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSI 681
               +     S S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D +I
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH   +  +     GT + S  KD  I++W+L  +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL 233

Query: 160 RSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
            +  +  +  +     WL + +  G IK++ L  Q  I+
Sbjct: 234 SAQDEVFSLAFSPNRYWLAAATASG-IKIFCLDPQSLID 271

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 67/166 (40%), Gaps = 21/166 (12%)

Query: 92  DLLAVGYADGVIKVWDLMSK-----TVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNII 146
           +LL  G  D  +  W L          + +F GH   +        G   +S S D  + 
Sbjct: 31  NLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLR 90

Query: 147 VWDLVGEVGLYKLRSHKDSITGFWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
           +WD+       +   HK  +      +    +IS S+D  IK+W +K  QC+ T + H  
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 206 ECWGLSVK-------DDL--LITTGTDSQVKLWKLN---IENDKLG 239
             W   V+       DD   +I+ G D  VK W LN   IE D +G
Sbjct: 150 --WVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFVG 193

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 117 FNGHKAAITLLQFD-GTGTRLISGSKDSNIIVWDLVGE-----VGLYKLRSHKDSITGFW 170
             GH   +T L    G    L+SGS+D  +I W L G+     V +   + H   +    
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQD-- 70

Query: 171 C---QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQ 225
           C   Q   + +S S D  ++LWD+ T +  +  + H  +   +++  K  ++I+   D  
Sbjct: 71  CTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKT 130

Query: 226 VKLWKL 231
           +K+W +
Sbjct: 131 IKVWTI 136

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 12/128 (9%)

Query: 389 GQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G   ++ ++  S D  L+A+A  +G + +WN+   K + T        +  F P    + 
Sbjct: 193 GHNGNVNAVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFSLAFSPNRYWLA 252

Query: 447 LGTRNGELQLFDLASSSLLDTI--------EDAHDAAIWSLDLTSDGKRLVTGSADKTVK 498
             T +G +++F L   SL+D +        + A   A+ SL  ++DG+ L  G  D  ++
Sbjct: 253 AATASG-IKIFCLDPQSLIDDLRPEFAGYNKSAEPHAV-SLAWSADGQTLFAGYTDSVIR 310

Query: 499 FWDFQVEN 506
            W     N
Sbjct: 311 VWQVMTAN 318

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 109/245 (44%), Gaps = 16/245 (6%)

Query: 440 PGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P    V  G+ +G++++ D  +  +L + +  HD  I  LD +SD   LVTG AD+ VK 
Sbjct: 192 PNQKSVACGSWHGDVKIIDSETLEILASFDAIHDDKIGGLDWSSDSTLLVTGGADRIVKV 251

Query: 500 WDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFF 559
           W         P + +    +LK  H+        ++ ++  P DRY+A +  D T +++ 
Sbjct: 252 WK--------PSSPNDSTAVLK-GHEGR------VVKVKFHPSDRYVASASFDMTWRLWD 296

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           ++         GH   V  +D   D  ++ ++  D   +IW +  G     L  H   I 
Sbjct: 297 VERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIY 356

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAI-STDGSFVVSSSHD 678
            V + P  H+  + S D  VK WD  K      + AH + V  +      G  +VSSS+D
Sbjct: 357 GVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYD 416

Query: 679 HSIRI 683
            ++ +
Sbjct: 417 KTVSV 421

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 115/241 (47%), Gaps = 28/241 (11%)

Query: 373 EPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECG 431
           +P+SP      T  L+G    +  +     +R +A+AS + + ++W+V+    ++  E G
Sbjct: 253 KPSSP---NDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQLQE-G 308

Query: 432 YA--LTC-KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRL 488
           +A  + C  F   G L+     +   +++D+ S   L  +E  H   I+ +  + +G  +
Sbjct: 309 HAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILE-GHAKPIYGVSWSPNGHHV 367

Query: 489 VTGSADKTVKFWDFQ-VENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLA 547
            TGSAD TVK WD + V N           P   L H+  +    D+   ++S   R L 
Sbjct: 368 ATGSADGTVKVWDIRKVGN-----------PFSILAHNNIVS---DVKFDKVS--GRTLV 411

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDC 607
            S  D TV VF  DS     SL GH   V+SIDIS D   + +S  D+++K+W L  G C
Sbjct: 412 SSSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWKL--GVC 469

Query: 608 H 608
           +
Sbjct: 470 N 470

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 70/154 (45%), Gaps = 2/154 (1%)

Query: 539 ISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYG-HKLPVLSIDISFDSKMIITSSADKNI 597
           +SP+ + +A       VK+   ++++   S    H   +  +D S DS +++T  AD+ +
Sbjct: 190 LSPNQKSVACGSWHGDVKIIDSETLEILASFDAIHDDKIGGLDWSSDSTLLVTGGADRIV 249

Query: 598 KIWGLDF-GDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH 656
           K+W      D    L  H+  ++ VKF P      S S D   + WD E+   +Q    H
Sbjct: 250 KVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASASFDMTWRLWDVERQVELQLQEGH 309

Query: 657 QSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQ 690
             EV+ L    DGS + S+  D   RIW+    Q
Sbjct: 310 AKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQ 343

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 106/253 (41%), Gaps = 26/253 (10%)

Query: 397 IDISDDNRLLATA-SNGSLKIWNVKTHK---CIRTFECGYALTCKFLPGGLLVILGTRNG 452
           +D S D+ LL T  ++  +K+W   +      +     G  +  KF P    V   + + 
Sbjct: 231 LDWSSDSTLLVTGGADRIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDRYVASASFDM 290

Query: 453 ELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGT 512
             +L+D+     L  +++ H   ++ LD   DG  L +   D   + WD +   +L+   
Sbjct: 291 TWRLWDVERQVEL-QLQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMRSGQSLM--- 346

Query: 513 KDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGH 572
                 IL+ +          I  +  SP+  ++A    D TVKV+ +  +    S+  H
Sbjct: 347 ------ILEGHAKP-------IYGVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSILAH 393

Query: 573 KLPVLSIDISFD---SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
              V   D+ FD    + +++SS DK + ++  D      SL  H D +MS+    +  +
Sbjct: 394 NNIV--SDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHDFSH 451

Query: 630 FFSCSKDAVVKYW 642
            +S   D  VK W
Sbjct: 452 LYSSGWDRSVKLW 464

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 73/163 (44%), Gaps = 6/163 (3%)

Query: 77  AKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRL 136
           AK   C  L+   D  LL     D + ++WD+ S   L+   GH   I  + +   G  +
Sbjct: 310 AKEVYC--LDFQCDGSLLCSAGLDSIGRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHV 367

Query: 137 ISGSKDSNIIVWDLVGEVGLYKLRSHKDSITG--FWCQGEDWLISTSKDGMIKLWDLKTQ 194
            +GS D  + VWD+      + + +H + ++   F       L+S+S D  + ++   + 
Sbjct: 368 ATGSADGTVKVWDIRKVGNPFSILAHNNIVSDVKFDKVSGRTLVSSSYDKTVSVFASDSW 427

Query: 195 QCIETHIAHTGECWGLSVKDDL--LITTGTDSQVKLWKLNIEN 235
             + +   HT +   + +  D   L ++G D  VKLWKL + N
Sbjct: 428 LRLASLKGHTDKVMSIDISHDFSHLYSSGWDRSVKLWKLGVCN 470

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 69/154 (44%), Gaps = 10/154 (6%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMS---KTVLLNFNGHKAAITLLQFDGTGTRLISGSK 141
           L+   D+ LL  G AD ++KVW   S    T +L   GH+  +  ++F  +   + S S 
Sbjct: 231 LDWSSDSTLLVTGGADRIVKVWKPSSPNDSTAVL--KGHEGRVVKVKFHPSDRYVASASF 288

Query: 142 DSNIIVWDLVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIET 199
           D    +WD+  +V L     H   +    F C G   L S   D + ++WD+++ Q +  
Sbjct: 289 DMTWRLWDVERQVELQLQEGHAKEVYCLDFQCDGS-LLCSAGLDSIGRIWDMRSGQSLMI 347

Query: 200 HIAHTGECWGLSVKDD--LLITTGTDSQVKLWKL 231
              H    +G+S   +   + T   D  VK+W +
Sbjct: 348 LEGHAKPIYGVSWSPNGHHVATGSADGTVKVWDI 381

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 46/109 (42%), Gaps = 1/109 (0%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           ++ H     +A    D   ++WD+  +  L    GH   +  L F   G+ L S   DS 
Sbjct: 274 VKFHPSDRYVASASFDMTWRLWDVERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSI 333

Query: 145 IIVWDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLK 192
             +WD+     L  L  H   I G  W      + + S DG +K+WD++
Sbjct: 334 GRIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGSADGTVKVWDIR 382

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 117/277 (42%), Gaps = 31/277 (11%)

Query: 424 CIRTFE-CGYALTC-KFLPGGLLVILGTRNGELQLFDLASSSLLDTIED----------- 470
           C+ TF      +TC +F     L   G ++  ++L+ L  + L   +             
Sbjct: 413 CMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTL 472

Query: 471 -AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLE 529
             H   ++S   + D K L++ S DKTV+ W     ++LV                +   
Sbjct: 473 IGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLV----------------SYKG 516

Query: 530 LNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMII 589
            N  +  +  SP   Y A +  D T +++  D +       GH   V  +    +   + 
Sbjct: 517 HNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVF 576

Query: 590 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFEC 649
           T S DK  ++W +  GD  +    H   ++S    P+     + S+D ++  WD    + 
Sbjct: 577 TGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKR 636

Query: 650 IQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           ++++  H ++ V++L+ S +G+ +VS   DHS+R+W+
Sbjct: 637 LKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWD 673

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 46/101 (45%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +WDI TGD +        P  S A            V  D   L+ G  DG+I VWD+ +
Sbjct: 586 MWDIGTGDSVRLFLGHTAPVISTA------------VSPDGRWLSTGSEDGIINVWDIGT 633

Query: 111 KTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
              L    GH K A+  L +   GT L+SG  D ++ VWDL
Sbjct: 634 GKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDL 674

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 64/128 (50%), Gaps = 4/128 (3%)

Query: 409 ASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLD 466
           +++ + ++W++ T   +R F       ++    P G  +  G+ +G + ++D+ +   L 
Sbjct: 579 STDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLK 638

Query: 467 TIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDT 526
            +      A++SL  + +G  LV+G AD +V+ WD +  +T  P T+ +  P      D 
Sbjct: 639 QMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK-RSTAEPNTEPE-QPFTSYFGDA 696

Query: 527 TLELNDDI 534
           T  +N+DI
Sbjct: 697 TTSVNNDI 704

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 61/143 (42%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   GT + +GS D    +WD+   
Sbjct: 533 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTG 592

Query: 154 VGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWGL 210
             +     H   +  T     G  WL + S+DG+I +WD+ T + ++    H     + L
Sbjct: 593 DSVRLFLGHTAPVISTAVSPDGR-WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSL 651

Query: 211 SVKDD--LLITTGTDSQVKLWKL 231
           S   +  +L++ G D  V++W L
Sbjct: 652 SYSKEGTVLVSGGADHSVRVWDL 674

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   +  G  D   ++WD+ +   +  F GH A +        G  L +GS+D  
Sbjct: 566 VSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGI 625

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K+++    + +    L+S   D  +++WDLK
Sbjct: 626 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 61/160 (38%), Gaps = 10/160 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L     D  +++W + + + L+++ GH   +  + F   G    + S D    +W 
Sbjct: 487 DNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWS 546

Query: 150 LVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
                 L     H + +    F   G  ++ + S D   ++WD+ T   +   + HT   
Sbjct: 547 CDHIYPLRIFAGHLNDVDCVSFHPNGT-YVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPV 605

Query: 208 WGLSVKDD--LLITTGTDSQVKLWKLNIENDKLGGKLTEM 245
              +V  D   L T   D  + +W +       G +L +M
Sbjct: 606 ISTAVSPDGRWLSTGSEDGIINVWDIGT-----GKRLKQM 640

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 60/170 (35%), Gaps = 45/170 (26%)

Query: 75  RGAKPAECTY-----------LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAA 123
           + A P+ C Y           LE   D  L A G+ D  IK+W L               
Sbjct: 406 QSAAPSVCMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSL--------------- 450

Query: 124 ITLLQFDGTG--TRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLISTS 181
                 DGT   ++L S  ++  I    L+G  G     S        +     +L+S S
Sbjct: 451 ------DGTPLDSKLPSKQRE-KINNTTLIGHSGTVYSTS--------FSPDNKYLLSAS 495

Query: 182 KDGMIKLWDLKTQQCIETHIAHTGECWGLSVKD--DLLITTGTDSQVKLW 229
           +D  ++LW + T   + ++  H    W +S         T   D   +LW
Sbjct: 496 EDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLW 545

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 127/283 (44%), Gaps = 27/283 (9%)

Query: 346 ITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRL 405
           IT+ K +L+ T  +  +  Y I       T+P P+ +     +G R ++ S+    DNR 
Sbjct: 40  ITNDK-KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRW 89

Query: 406 LATAS-NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRNGELQLFDLASSS 463
           + T+S +G++K+W+V++    R ++    +    + P    +I   R+G ++++DL  + 
Sbjct: 90  MVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

Query: 464 LLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KFLPILK 521
               +    D ++ SL + SDG  L   ++      W+        P   D     P+ K
Sbjct: 150 CTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEM-------PNRTDASHLKPVTK 202

Query: 522 LNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSID 580
               +T      I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V    
Sbjct: 203 FRAHSTY-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA 257

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            S DS  ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/291 (20%), Positives = 126/291 (43%), Gaps = 28/291 (9%)

Query: 387 LQGQRTDMRSIDISDDNRLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442
           +Q   + +  ++I++D +LLATA + ++++++++T     + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  + +G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS 562
             EN              +  H  T E +  + SL ++ D   LA +       V+ + +
Sbjct: 146 G-EN--------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615
                 +K       H   +  I +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 RTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
             +    F  +S    + S D  V+ WD    E +++   H      +A++
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/293 (20%), Positives = 121/293 (41%), Gaps = 31/293 (10%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGG---LLVILGTRNGELQLFDLAS 461
           L++   + +++ W   T  C RT +   +   +        LL   G +N  ++L+D+ +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDIRT 62

Query: 462 SSLLDTIE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPIL 520
           ++       + H   + S+    D + +VT S D T+K WD +              P +
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-------------PSI 109

Query: 521 KLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL-SI 579
             N+     +N+ +    I P+   L     D  ++++ L   +    L       L S+
Sbjct: 110 PRNYKHNAPVNEVV----IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSL 165

Query: 580 DISFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFLPESHNFFSC 633
            ++ D  M+  +++  N  +W + +  D           AH   I  +    +  +  +C
Sbjct: 166 SMASDGSMLAAANSKGNCYVWEMPNRTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225

Query: 634 SKDAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           S D   + W   + F+    L  HQ  VW  A S D +++V++S DH +R+W+
Sbjct: 226 SADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 95/224 (42%), Gaps = 23/224 (10%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELND 532
           D+ +  L++T+D K+L+  +  + V+ +D +  N   P       P+             
Sbjct: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDIRTTN---PN------PVASFE-----GHRG 76

Query: 533 DILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           ++ S+    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNRTDAS 195

Query: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETED 689
             + + K  AH + +  + +S+D   + + S DH+ R+W   +D
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 80  AECTYLEVHQDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDGTGTRLI 137
           ++   LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91

Query: 138 SGSKDSNIIVWDLVGE--VGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQ 195
           + S+D  I VWD+        YK  +  + +     QGE  LIS  +DG I++WDL   Q
Sbjct: 92  TSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQ 149

Query: 196 C 196
           C
Sbjct: 150 C 150

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 11/110 (10%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYAD 100
           L T+  +NV ++DI+T +         P   +   G +    T +   QD   +     D
Sbjct: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
           G IKVWD+ S ++  N+  H A +  +        LIS  +D NI +WDL
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 61/117 (52%), Gaps = 4/117 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQ 690
           S+D  +K WD  +   I + Y H + V  + I  +   ++S   D +IRIW+  E+Q
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 37/91 (40%), Gaps = 9/91 (9%)

Query: 69  PGASDARGAKP-----AECTYLE---VHQDTDLLAVGYADGVIKVWDLMSKTVL-LNFNG 119
           P  +DA   KP     A  TY+    +  D   LA   AD   +VW +     L    +G
Sbjct: 189 PNRTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248

Query: 120 HKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
           H+  +    F      L++ S D  + +WDL
Sbjct: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 127/283 (44%), Gaps = 27/283 (9%)

Query: 346 ITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRL 405
           IT+ K +L+ T  +  +  Y I       T+P P+ +     +G R ++ S+    DNR 
Sbjct: 40  ITNDK-KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRW 89

Query: 406 LATAS-NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRNGELQLFDLASSS 463
           + T+S +G++K+W+V++    R ++    +    + P    +I   R+G ++++DL  + 
Sbjct: 90  MVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

Query: 464 LLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KFLPILK 521
               +    D ++ SL + SDG  L   ++      W+        P   D     P+ K
Sbjct: 150 CTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEM-------PNHTDASHLKPVTK 202

Query: 522 LNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFL-DSMKFYLSLYGHKLPVLSID 580
               +T      I  + +S D ++LA    D+T +V+ + D  K   +L GH+  V    
Sbjct: 203 FRAHSTY-----ITRILLSSDVKHLATCSADHTARVWSIEDDFKLETTLDGHQRWVWDCA 257

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            S DS  ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/293 (21%), Positives = 121/293 (41%), Gaps = 31/293 (10%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGG---LLVILGTRNGELQLFDLAS 461
           L++   + +++ W   T  C RT +   +   +        LL   G +N  ++L+D+ +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDIRT 62

Query: 462 SSLLDTIE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPIL 520
           ++       + H   + S+    D + +VT S D T+K WD +              P +
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-------------PSI 109

Query: 521 KLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL-SI 579
             N+     +N+ +    I P+   L     D  ++++ L   +    L       L S+
Sbjct: 110 PRNYKHNAPVNEVV----IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSL 165

Query: 580 DISFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFLPESHNFFSC 633
            ++ D  M+  +++  N  +W + +  D           AH   I  +    +  +  +C
Sbjct: 166 SMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225

Query: 634 SKDAVVKYWDGEK-FECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           S D   + W  E  F+    L  HQ  VW  A S D +++V++S DH +R+W+
Sbjct: 226 SADHTARVWSIEDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 127/292 (43%), Gaps = 30/292 (10%)

Query: 387 LQGQRTDMRSIDISDDNRLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442
           +Q   + +  ++I++D +LLATA + ++++++++T     + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  + +G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS 562
             EN              +  H  T E +  + SL ++ D   LA +       V+ + +
Sbjct: 146 G-EN--------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGL--DFGDCHKSLFAH 614
                 +K       H   +  I +S D K + T SAD   ++W +  DF     +L  H
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDDF-KLETTLDGH 249

Query: 615 QDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
           Q  +    F  +S    + S D  V+ WD    E +++   H      +A++
Sbjct: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 95/224 (42%), Gaps = 23/224 (10%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELND 532
           D+ +  L++T+D K+L+  +  + V+ +D +  N   P       P+             
Sbjct: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDIRTTN---PN------PVASFE-----GHRG 76

Query: 533 DILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           ++ S+    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDAS 195

Query: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETED 689
             + + K  AH + +  + +S+D   + + S DH+ R+W   +D
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDD 239

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 80  AECTYLEVHQDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDGTGTRLI 137
           ++   LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91

Query: 138 SGSKDSNIIVWDLVGE--VGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQ 195
           + S+D  I VWD+        YK  +  + +     QGE  LIS  +DG I++WDL   Q
Sbjct: 92  TSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQ 149

Query: 196 C 196
           C
Sbjct: 150 C 150

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 11/110 (10%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYAD 100
           L T+  +NV ++DI+T +         P   +   G +    T +   QD   +     D
Sbjct: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
           G IKVWD+ S ++  N+  H A +  +        LIS  +D NI +WDL
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 61/117 (52%), Gaps = 4/117 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQ 690
           S+D  +K WD  +   I + Y H + V  + I  +   ++S   D +IRIW+  E+Q
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 37/91 (40%), Gaps = 9/91 (9%)

Query: 69  PGASDARGAKP-----AECTYLE---VHQDTDLLAVGYADGVIKVWDLMSKTVL-LNFNG 119
           P  +DA   KP     A  TY+    +  D   LA   AD   +VW +     L    +G
Sbjct: 189 PNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDDFKLETTLDG 248

Query: 120 HKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
           H+  +    F      L++ S D  + +WDL
Sbjct: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 121/274 (44%), Gaps = 30/274 (10%)

Query: 440 PGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
           P G     G+  G++ +F+  + + + T  + H   I  +D +SD + LV+G  D  VK 
Sbjct: 191 PEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKL 250

Query: 500 WDF-----QVENTLVPG----TKDKFLP----ILKLNHDTTLELND-------------- 532
           ++F     QV  + +      T  KF P    I   + DTT  L D              
Sbjct: 251 YNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHS 310

Query: 533 -DILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITS 591
            +I SL    D   +A +  D    ++ L S K  LSL GH  P+   D S +       
Sbjct: 311 KEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQ-XXX 369

Query: 592 SADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFF-SCSKDAVVKYWDGEKFECI 650
           S D  IKIW L   D  +++ AH++ +  +KF  E+  F  S S D  +  +  + +  I
Sbjct: 370 SGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKI 429

Query: 651 QKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
             L  H  ++ ++ IS+D   +VS   D S+++W
Sbjct: 430 HTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLW 463

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/261 (23%), Positives = 117/261 (44%), Gaps = 43/261 (16%)

Query: 378 APL----KTHTIELQGQRTDMRSIDISDDNR-LLATASNGSLKIWNVKTHKC-IRTFECG 431
           AP+    +TH+ ++ G       ID S D+R L++   +G +K++N  ++   + T   G
Sbjct: 214 APVITSRETHSGKISG-------IDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIG 266

Query: 432 Y---ALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRL 488
           +       KF P    +   + +   +L+D+ ++S L  +++ H   I+SL   +DG  +
Sbjct: 267 HDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSEL-LLQEGHSKEIYSLSFQTDGSLI 325

Query: 489 VTGSADKTVKFWDFQVENTLVP---------------------GTKDKFLPILKLNH--- 524
            T  ADK    WD +    ++                       + D  + I  L     
Sbjct: 326 ATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDD 385

Query: 525 -DTTLELNDDILSLRISPDD-RYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDIS 582
            +T L   + +  L+   ++ ++L  S  D  + VF  DS     +L GH   +LSIDIS
Sbjct: 386 VETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKILSIDIS 445

Query: 583 FDSKMIITSSADKNIKIWGLD 603
            D + I++   D+++K+W ++
Sbjct: 446 SDYQTIVSGGWDRSVKLWSME 466

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 14/172 (8%)

Query: 80  AECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISG 139
           A  T ++ H     +     D   ++WD+++ + LL   GH   I  L F   G+ + + 
Sbjct: 269 ARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATA 328

Query: 140 SKDSNIIVWDLVGEVGLYKLRSHKDSI-TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
             D   I+WDL     +  L  H   I    W Q   +    S DG IK+WDL+    +E
Sbjct: 329 GADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQN-GYQXXXSGDGTIKIWDLRKVDDVE 387

Query: 199 THIAHTGECWGLSVKDD---LLITT---------GTDSQVKLWKLNIENDKL 238
           T +AH      L  + +    LI++          +DS VK+  L   NDK+
Sbjct: 388 TILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKI 439

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 72/170 (42%), Gaps = 10/170 (5%)

Query: 526 TTLELN-DDILSLR------ISPDDRYLAISLLDNTVKVFFLDSMKFYL-SLYGHKLPVL 577
           TT++LN   ++S R      ISP+    A       + +F   ++   + S   H   + 
Sbjct: 169 TTVQLNGSQVISSRPISKICISPEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKIS 228

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCH--KSLFAHQDSIMSVKFLPESHNFFSCSK 635
            ID S DS+ +++   D  +K++  D        S   H   + +VKF P      S S 
Sbjct: 229 GIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASF 288

Query: 636 DAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           D   + WD      +     H  E+++L+  TDGS + ++  D    IW+
Sbjct: 289 DTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWD 338

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 85/186 (45%), Gaps = 7/186 (3%)

Query: 56  TGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLL 115
            GD+    +  L P  + +R     + + ++   D+  L  G  DG++K+++  S ++ +
Sbjct: 202 AGDISIFNTKTLAPVIT-SRETHSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQV 260

Query: 116 --NFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQG 173
             +F GH A +T ++F  +   + S S D+   +WD+V    L     H   I     Q 
Sbjct: 261 ATSFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQT 320

Query: 174 EDWLISTS-KDGMIKLWDLKTQQCIETHIAHTGE--CWGLSVKDDLLITTGTDSQVKLWK 230
           +  LI+T+  D +  +WDL++ + I + + H     C   S        +G D  +K+W 
Sbjct: 321 DGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSG-DGTIKIWD 379

Query: 231 LNIEND 236
           L   +D
Sbjct: 380 LRKVDD 385

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 123/301 (40%), Gaps = 38/301 (12%)

Query: 387 LQGQRTDMRSIDISDDNRLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGLLV 445
            Q    DM  +D SDD R+ A     S +KIW               +L    L    ++
Sbjct: 460 FQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIW---------------SLDGSSLNNPNIM 504

Query: 446 ILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
                +      D    +L+      H   +++   + D K L++GS DKTV+ W     
Sbjct: 505 PNINNSDHKDADDPTCKTLV-----GHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTH 559

Query: 506 NTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKF 565
             LV   K    P+  +N                SP   Y A +  D T +++  D +  
Sbjct: 560 TALV-SYKGHNHPVWDVN---------------FSPLGHYFATASHDQTARLWSCDHIYP 603

Query: 566 YLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP 625
                GH   V  +    +   + T S+DK  ++W +  GD  +    H   ++ +   P
Sbjct: 604 LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSP 663

Query: 626 ESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIW 684
           +     + S+D ++  WD    + ++++  H ++ +++L+ S +G+ ++S   DHS+R+W
Sbjct: 664 DGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVW 723

Query: 685 E 685
           +
Sbjct: 724 D 724

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 55/265 (20%), Positives = 105/265 (39%), Gaps = 65/265 (24%)

Query: 387 LQGQRTDMRSIDISDDNR-LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLLV 445
           L G    + +   S DN+ LL+ + + ++++W++ TH  + +++                
Sbjct: 523 LVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK---------------- 566

Query: 446 ILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE 505
                                     H+  +W ++ +  G    T S D+T + W     
Sbjct: 567 -------------------------GHNHPVWDVNFSPLGHYFATASHDQTARLW----- 596

Query: 506 NTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFL---DS 562
                 + D   P+          LN D+  +   P+  Y+     D T +++ +   DS
Sbjct: 597 ------SCDHIYPLRIF----AGHLN-DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDS 645

Query: 563 MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAH-QDSIMSV 621
           ++ +L   GH  PV+ I +S D + + T S D  I IW +  G   K +  H +++I S+
Sbjct: 646 VRLFL---GHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSL 702

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEK 646
            +  E +   S   D  V+ WD +K
Sbjct: 703 SYSKEGNVLISGGADHSVRVWDLKK 727

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +WD+ TGD +                  P  C  + V  D   L+ G  DG+I +WD+ +
Sbjct: 637 MWDVSTGDSVRLF----------LGHTAPVIC--IAVSPDGRWLSTGSEDGIINIWDIGT 684

Query: 111 KTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  L +   G  LISG  D ++ VWDL
Sbjct: 685 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 58/142 (40%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   G  + +GS D    +WD+   
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 643

Query: 154 VGLYKLRSHKDSITGFWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---WG 209
             +     H   +       +  WL + S+DG+I +WD+ T + ++    H         
Sbjct: 644 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 210 LSVKDDLLITTGTDSQVKLWKL 231
            S + ++LI+ G D  V++W L
Sbjct: 704 YSKEGNVLISGGADHSVRVWDL 725

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +  +     G  L +GS+D  
Sbjct: 617 VSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGI 676

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDLK 192
           I +WD+     L ++R H K++I    + +  + LIS   D  +++WDLK
Sbjct: 677 INIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 62/160 (38%), Gaps = 10/160 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W + + T L+++ GH   +  + F   G    + S D    +W 
Sbjct: 538 DNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTARLWS 597

Query: 150 LVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGE- 206
                 L     H + +    F   G  ++ + S D   ++WD+ T   +   + HT   
Sbjct: 598 CDHIYPLRIFAGHLNDVDCVSFHPNG-CYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 656

Query: 207 -CWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGGKLTEM 245
            C  +S     L T   D  + +W +       G +L +M
Sbjct: 657 ICIAVSPDGRWLSTGSEDGIINIWDIGT-----GKRLKQM 691

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 35/191 (18%), Positives = 60/191 (31%), Gaps = 37/191 (19%)

Query: 77  AKPAECTY-----------LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN------- 118
           A P+ C Y           L+   D  + A G+ D  IK+W L   ++            
Sbjct: 451 ALPSVCMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNS 510

Query: 119 --------------GHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKD 164
                         GH   +    F      L+SGS+D  + +W +     L   + H  
Sbjct: 511 DHKDADDPTCKTLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNH 570

Query: 165 SI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWGLSVKDDLLITT 220
            +    F   G  +  + S D   +LW       +     H    +C         + T 
Sbjct: 571 PVWDVNFSPLGH-YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTG 629

Query: 221 GTDSQVKLWKL 231
            +D   ++W +
Sbjct: 630 SSDKTCRMWDV 640

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 100/223 (44%), Gaps = 21/223 (9%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTT 527
           + H+  + SL  TS G+   LV+ S DKT+  W    ++  V      F     +  D T
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVT 72

Query: 528 LELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKM 587
           L           +PD  Y   +  D T++++ + + + +    GHK  V+S+ I   + M
Sbjct: 73  L-----------TPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASM 121

Query: 588 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVKY 641
           II+ S DK+IK+W +  G C  +L  H D +  V+  P      E+    S   D +VK 
Sbjct: 122 IISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKA 180

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           W+  +F+       H   V  +  S DGS + S+  D  I +W
Sbjct: 181 WNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLW 223

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 65/141 (46%), Gaps = 10/141 (7%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D  +++W++ +      F GHK+ +  +  D   + +ISGS+D +I VW + G+  L  L
Sbjct: 86  DKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 160 RSHKDSITGFWCQGED-------WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV 212
             H D ++       D        +IS   D M+K W+L   Q     + H G    ++ 
Sbjct: 145 LGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITA 204

Query: 213 KDD--LLITTGTDSQVKLWKL 231
             D  L+ + G D ++ LW L
Sbjct: 205 SPDGSLIASAGKDGEIMLWNL 225

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     +++++S DK +  W L       G   +S   H   +  V
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDV 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSI 681
              P+     S S D  ++ W+    E  Q+   H+S+V ++AI    S ++S S D SI
Sbjct: 72  TLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSI 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/254 (22%), Positives = 106/254 (41%), Gaps = 41/254 (16%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENT----------------------L 508
            H   +  + LT DG   ++ S DKT++ W+     T                      +
Sbjct: 63  GHSHIVQDVTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMI 122

Query: 509 VPGTKDKFLPILKLNHD---TTLELNDDILSLRISPDDR-----YLAISLL-DNTVKVFF 559
           + G++DK + +  +      T L  ND +  +R++P+D+        IS   D  VK + 
Sbjct: 123 ISGSRDKSIKVWTIKGQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWN 182

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           L+  +      GH   V +I  S D  +I ++  D  I +W L       +L A QD + 
Sbjct: 183 LNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNA-QDEVF 241

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWALAI--STDGSF 671
           ++ F P  + + + +  + +K +  +    I  L      Y   +E  A+++  S DG  
Sbjct: 242 ALAFSPNRY-WLAAATASGIKVFSLDPQALIDDLRPEFAGYNKAAEPHAVSLTWSADGQT 300

Query: 672 VVSSSHDHSIRIWE 685
           + +   D+ IR+W+
Sbjct: 301 LFAGYTDNVIRVWQ 314

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH   +  +     G+ + S  KD  I++W+L  +V +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTL 234

Query: 160 RSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
            +  +     +     WL + +  G IK++ L  Q  I+
Sbjct: 235 NAQDEVFALAFSPNRYWLAAATASG-IKVFSLDPQALID 272

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 59/136 (43%), Gaps = 13/136 (9%)

Query: 116 NFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC-QGE 174
           +F GH   +  +     G   +S S D  + +W++       +   HK  +      +  
Sbjct: 60  SFKGHSHIVQDVTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKA 119

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV----KDD----LLITTGTDSQV 226
             +IS S+D  IK+W +K  QC+ T + H      + V    KDD     +I+ G D  V
Sbjct: 120 SMIISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMV 178

Query: 227 KLWKLN---IENDKLG 239
           K W LN   IE D +G
Sbjct: 179 KAWNLNQFQIEADFVG 194

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 57/123 (46%), Gaps = 11/123 (8%)

Query: 119 GHKAAITLLQFD-GTGTRLISGSKDSNIIVWDLVGE---VGL----YKLRSHKDSITGFW 170
           GH   +T L    G    L+S S+D  +I W L G+   VG+    +K  SH        
Sbjct: 15  GHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHSHIVQDVTLT 74

Query: 171 CQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQVKL 228
             G  + +S S D  ++LW++ T +  +  + H  +   +++  K  ++I+   D  +K+
Sbjct: 75  PDGA-YALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKV 133

Query: 229 WKL 231
           W +
Sbjct: 134 WTI 136

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 53/127 (41%), Gaps = 10/127 (7%)

Query: 389 GQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G   ++ +I  S D  L+A+A  +G + +WN+     + T           F P    + 
Sbjct: 194 GHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNAQDEVFALAFSPNRYWLA 253

Query: 447 LGTRNGELQLFDLASSSLLDTIED-------AHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T +G +++F L   +L+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 254 AATASG-IKVFSLDPQALIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRV 312

Query: 500 WDFQVEN 506
           W     N
Sbjct: 313 WQVMTAN 319

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 126/283 (44%), Gaps = 27/283 (9%)

Query: 346 ITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRL 405
           IT+ K +L+ T  +  +  Y I       T+P P+ +     +G R ++ S+    DNR 
Sbjct: 40  ITNDK-KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRW 89

Query: 406 LATAS-NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRNGELQLFDLASSS 463
           + T+S +G++K+W+V++    R ++    +    + P    +I   R+G ++++DL  + 
Sbjct: 90  MVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

Query: 464 LLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KFLPILK 521
               +    D ++ SL + SDG  L   +       W+        P   D     P+ K
Sbjct: 150 CTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEM-------PNHTDASHLKPVTK 202

Query: 522 LNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSID 580
               +T      I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V    
Sbjct: 203 FRAHSTY-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA 257

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            S DS  ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 59/291 (20%), Positives = 126/291 (43%), Gaps = 28/291 (9%)

Query: 387 LQGQRTDMRSIDISDDNRLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442
           +Q   + +  ++I++D +LLATA + ++++++++T     + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  + +G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS 562
             EN              +  H  T E +  + SL ++ D   LA +       V+ + +
Sbjct: 146 G-EN--------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615
                 +K       H   +  I +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
             +    F  +S    + S D  V+ WD    E +++   H      +A++
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/293 (20%), Positives = 120/293 (40%), Gaps = 31/293 (10%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGG---LLVILGTRNGELQLFDLAS 461
           L++   + +++ W   T  C RT +   +   +        LL   G +N  ++L+D+ +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDIRT 62

Query: 462 SSLLDTIE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPIL 520
           ++       + H   + S+    D + +VT S D T+K WD +              P +
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-------------PSI 109

Query: 521 KLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL-SI 579
             N+     +N+ +    I P+   L     D  ++++ L   +    L       L S+
Sbjct: 110 PRNYKHNAPVNEVV----IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSL 165

Query: 580 DISFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFLPESHNFFSC 633
            ++ D  M+  ++   N  +W + +  D           AH   I  +    +  +  +C
Sbjct: 166 SMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225

Query: 634 SKDAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           S D   + W   + F+    L  HQ  VW  A S D +++V++S DH +R+W+
Sbjct: 226 SADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 95/224 (42%), Gaps = 23/224 (10%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELND 532
           D+ +  L++T+D K+L+  +  + V+ +D +  N   P       P+             
Sbjct: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDIRTTN---PN------PVASFE-----GHRG 76

Query: 533 DILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           ++ S+    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195

Query: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETED 689
             + + K  AH + +  + +S+D   + + S DH+ R+W   +D
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 80  AECTYLEVHQDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDGTGTRLI 137
           ++   LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91

Query: 138 SGSKDSNIIVWDLVGE--VGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQ 195
           + S+D  I VWD+        YK  +  + +     QGE  LIS  +DG I++WDL   Q
Sbjct: 92  TSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQ 149

Query: 196 C 196
           C
Sbjct: 150 C 150

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 11/110 (10%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYAD 100
           L T+  +NV ++DI+T +         P   +   G +    T +   QD   +     D
Sbjct: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
           G IKVWD+ S ++  N+  H A +  +        LIS  +D NI +WDL
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 61/117 (52%), Gaps = 4/117 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQ 690
           S+D  +K WD  +   I + Y H + V  + I  +   ++S   D +IRIW+  E+Q
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 37/91 (40%), Gaps = 9/91 (9%)

Query: 69  PGASDARGAKP-----AECTYLE---VHQDTDLLAVGYADGVIKVWDLMSKTVL-LNFNG 119
           P  +DA   KP     A  TY+    +  D   LA   AD   +VW +     L    +G
Sbjct: 189 PNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248

Query: 120 HKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
           H+  +    F      L++ S D  + +WDL
Sbjct: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 126/283 (44%), Gaps = 27/283 (9%)

Query: 346 ITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRL 405
           IT+ K +L+ T  +  +  Y I       T+P P+ +     +G R ++ S+    DNR 
Sbjct: 40  ITNDK-KLLATAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNRW 89

Query: 406 LATAS-NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRNGELQLFDLASSS 463
           + T+S +G++K+W+V++    R ++    +    + P    +I   R+G ++++DL  + 
Sbjct: 90  MVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

Query: 464 LLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KFLPILK 521
               +    D ++ SL + SDG  L   +       W+        P   D     P+ K
Sbjct: 150 CTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEM-------PNHTDASHLKPVTK 202

Query: 522 LNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS-MKFYLSLYGHKLPVLSID 580
               +T      I  + +S D ++LA    D+T +V+ +D   K   +L GH+  V    
Sbjct: 203 FRAHSTY-----ITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCA 257

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            S DS  ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 258 FSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 59/291 (20%), Positives = 126/291 (43%), Gaps = 28/291 (9%)

Query: 387 LQGQRTDMRSIDISDDNRLLATASNGSLKIWNVKT--HKCIRTFEC--GYALTCKFLPGG 442
           +Q   + +  ++I++D +LLATA + ++++++++T     + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 443 LLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
             ++  + +G ++++D+ S S+    +  H+A +  + +  +   L++   D  ++ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 503 QVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDS 562
             EN              +  H  T E +  + SL ++ D   LA +       V+ + +
Sbjct: 146 G-EN--------------QCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPN 190

Query: 563 ------MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFG-DCHKSLFAHQ 615
                 +K       H   +  I +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 616 DSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
             +    F  +S    + S D  V+ WD    E +++   H      +A++
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALN 301

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/293 (20%), Positives = 120/293 (40%), Gaps = 31/293 (10%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGG---LLVILGTRNGELQLFDLAS 461
           L++   + +++ W   T  C RT +   +   +        LL   G +N  ++L+D+ +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQN--VRLYDIRT 62

Query: 462 SSLLDTIE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPIL 520
           ++       + H   + S+    D + +VT S D T+K WD +              P +
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS-------------PSI 109

Query: 521 KLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVL-SI 579
             N+     +N+ +    I P+   L     D  ++++ L   +    L       L S+
Sbjct: 110 PRNYKHNAPVNEVV----IHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSL 165

Query: 580 DISFDSKMIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMSVKFLPESHNFFSC 633
            ++ D  M+  ++   N  +W + +  D           AH   I  +    +  +  +C
Sbjct: 166 SMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225

Query: 634 SKDAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           S D   + W   + F+    L  HQ  VW  A S D +++V++S DH +R+W+
Sbjct: 226 SADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 95/224 (42%), Gaps = 23/224 (10%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELND 532
           D+ +  L++T+D K+L+  +  + V+ +D +  N   P       P+             
Sbjct: 32  DSQVNRLEITND-KKLLATAGHQNVRLYDIRTTN---PN------PVASFE-----GHRG 76

Query: 533 DILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           ++ S+    D+R++  S  D T+KV+ + S     + Y H  PV  + I  +   +I+  
Sbjct: 77  NVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRN-YKHNAPVNEVVIHPNQGELISCD 135

Query: 593 ADKNIKIWGLDFGDCHKSLFAHQD-SIMSVKFLPESHNFFSCSKDAVVKYW------DGE 645
            D NI+IW L    C   L    D S+ S+    +     + +       W      D  
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDAS 195

Query: 646 KFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETED 689
             + + K  AH + +  + +S+D   + + S DH+ R+W   +D
Sbjct: 196 HLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 7/121 (5%)

Query: 80  AECTYLEVHQDTDLLAVGYADGVIKVWDLMS--KTVLLNFNGHKAAITLLQFDGTGTRLI 137
           ++   LE+  D  LLA      V +++D+ +     + +F GH+  +T + F      ++
Sbjct: 33  SQVNRLEITNDKKLLATAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMV 91

Query: 138 SGSKDSNIIVWDLVGE--VGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQ 195
           + S+D  I VWD+        YK  +  + +     QGE  LIS  +DG I++WDL   Q
Sbjct: 92  TSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGE--LISCDRDGNIRIWDLGENQ 149

Query: 196 C 196
           C
Sbjct: 150 C 150

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 11/110 (10%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYAD 100
           L T+  +NV ++DI+T +         P   +   G +    T +   QD   +     D
Sbjct: 47  LATAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNRWMVTSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
           G IKVWD+ S ++  N+  H A +  +        LIS  +D NI +WDL
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 61/117 (52%), Gaps = 4/117 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++ T+   +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLLATA-GHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQ 690
           S+D  +K WD  +   I + Y H + V  + I  +   ++S   D +IRIW+  E+Q
Sbjct: 94  SEDGTIKVWD-VRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 37/91 (40%), Gaps = 9/91 (9%)

Query: 69  PGASDARGAKP-----AECTYLE---VHQDTDLLAVGYADGVIKVWDLMSKTVL-LNFNG 119
           P  +DA   KP     A  TY+    +  D   LA   AD   +VW +     L    +G
Sbjct: 189 PNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDG 248

Query: 120 HKAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
           H+  +    F      L++ S D  + +WDL
Sbjct: 249 HQRWVWDCAFSADSAYLVTASSDHYVRLWDL 279

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 127/296 (42%), Gaps = 46/296 (15%)

Query: 392 TDMRSIDISDDNRLLATASNGSL-KIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTR 450
           ++M S++ SDD RL A     S+ KIW++           G  L  K         L ++
Sbjct: 428 SEMTSLEFSDDVRLAAAGFQDSIIKIWSLD----------GEPLKNK---------LPSK 468

Query: 451 NGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVP 510
            GE       + +L+      H   ++S   + D + L++ S DKTV+ W      +LV 
Sbjct: 469 QGER----TNNETLV-----GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLV- 518

Query: 511 GTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY 570
                       N+      N  I  +  SP   Y A +  D T +++  D +       
Sbjct: 519 ------------NYKGH---NHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFA 563

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V ++    +   + T S+DK  ++W +  GD  +    H   + S    P+    
Sbjct: 564 GHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWL 623

Query: 631 FSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            + S+D V+  WD    + ++++  H ++ V++L+ S +G  ++S   DHS+R+W+
Sbjct: 624 STGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWD 679

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 97/215 (45%), Gaps = 7/215 (3%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE--NTLVPGTKDKFLPILKLNHDTTLEL 530
           ++ + SL+ + D +    G  D  +K W    E     +P  + +     + N++T +  
Sbjct: 427 NSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGE-----RTNNETLVGH 481

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           +  + S   SPD+RYL  +  D TV+++  D+    ++  GH  P+  +  S       T
Sbjct: 482 SGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFAT 541

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
           +S D+  ++W  D     +    H + + +V F P     F+ S D   + WD    + +
Sbjct: 542 ASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSV 601

Query: 651 QKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           +    H + V + A+S DG ++ + S D  I +W+
Sbjct: 602 RLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWD 636

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 78/170 (45%), Gaps = 13/170 (7%)

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLD--SMKFYL-----------SLYGHKLPVL 577
           N ++ SL  S D R  A    D+ +K++ LD   +K  L           +L GH   V 
Sbjct: 427 NSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVY 486

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S   S D++ ++++S DK +++W  D      +   H   I  V F P  H F + S D 
Sbjct: 487 STSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQ 546

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEET 687
             + W  +    ++    H ++V  ++   +G++V + S D + R+W+ T
Sbjct: 547 TARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDIT 596

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 61/142 (42%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   GT + +GS D    +WD+   
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSG 598

Query: 154 VGLYKLRSHKDSITGFWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWGLS 211
             +     H   +T      +  WL + S+DG+I +WD+ T + ++    H     + LS
Sbjct: 599 DSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 212 VKDD--LLITTGTDSQVKLWKL 231
              +  +LI+ G D  V++W +
Sbjct: 659 YSKEGHVLISGGADHSVRVWDV 680

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ S   +  F GH A +T       G  L +GS+D  
Sbjct: 572 VSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGV 631

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K+++    + +    LIS   D  +++WD+K
Sbjct: 632 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +WDI +GD +        P  S A            V  D   L+ G  DGVI VWD+ +
Sbjct: 592 MWDITSGDSVRLFLGHTAPVTSTA------------VSPDGRWLSTGSEDGVINVWDIGT 639

Query: 111 KTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
              L    GH K A+  L +   G  LISG  D ++ VWD+
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDV 680

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 59/169 (34%), Gaps = 18/169 (10%)

Query: 80  AECTYLEVHQDTDLLAVGYADGVIKVWDL-------------MSKTVLLNFNGHKAAITL 126
           +E T LE   D  L A G+ D +IK+W L               +T      GH   +  
Sbjct: 428 SEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYS 487

Query: 127 LQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDG 184
             F      L+S S+D  + +W       L   + H   I    F   G  +  + S D 
Sbjct: 488 TSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGH-YFATASHDQ 546

Query: 185 MIKLWDLKTQQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKL 231
             +LW       +     H  +   +S   +   + T  +D   ++W +
Sbjct: 547 TARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDI 595

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 52/132 (39%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL------RSHKDSIT 167
           +  F+   + +T L+F        +G +DS I +W L GE    KL      R++ +++ 
Sbjct: 420 MYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLV 479

Query: 168 GF--------WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECW--GLSVKDDLL 217
           G         +     +L+S S+D  ++LW   T   +  +  H    W    S      
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYF 539

Query: 218 ITTGTDSQVKLW 229
            T   D   +LW
Sbjct: 540 ATASHDQTARLW 551

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 115/274 (41%), Gaps = 31/274 (11%)

Query: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQ 503
           L   G+  G++++ D  +  ++  IE+ HD  I  L   S    LV+G+ D  VK   F 
Sbjct: 200 LCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFD 259

Query: 504 V------ENTLVPGTKDK-----FLP----ILKLNHDTTLELND---------------D 533
                  E T + G   +     F P    +   + D T  L D               +
Sbjct: 260 PDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKE 319

Query: 534 ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA 593
           + SL    D   L    LDN   V+ + + K  ++L GH  P+ S+D S D   I T   
Sbjct: 320 VYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGG 379

Query: 594 DKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPES-HNFFSCSKDAVVKYWDGEKFECIQK 652
           D  I IW +        L AH + +  V+F   + H   SC  D  ++ +  + +  ++ 
Sbjct: 380 DGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKT 439

Query: 653 LYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEE 686
           L  H  ++  + IS D   +VSS  D S+++W++
Sbjct: 440 LEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQ 473

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 106/220 (48%), Gaps = 25/220 (11%)

Query: 387 LQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYA---LTCKFLPGG 442
           LQG    + ++D     R +A+AS + + ++W++++   ++ F+ G+     +  F   G
Sbjct: 271 LQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQ-FQEGHGKEVYSLSFQNDG 329

Query: 443 LLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDF 502
            L+  G  +    ++D+ +   +  ++  H   I+S+D + DG  + TG  D  +  WD 
Sbjct: 330 ALLCSGGLDNAAIVWDVRTGKSIMNLQ-GHAKPIYSVDWSPDGYHIATGGGDGVINIWD- 387

Query: 503 QVENTLVPGTKDKFLPILKLNHDTTLELNDDILS-LRISPDDRYLAISL-LDNTVKVFFL 560
                           I K    T L  +++I++ +R      +  +S   D  ++++  
Sbjct: 388 ----------------IRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSS 431

Query: 561 DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600
           D+     +L GH   +L +DIS D+++I++S  D+++K+W
Sbjct: 432 DNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 69/154 (44%), Gaps = 4/154 (2%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140
           E   L    D  LL  G  D    VWD+ +   ++N  GH   I  + +   G  + +G 
Sbjct: 319 EVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGG 378

Query: 141 KDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGE--DWLISTSKDGMIKLWDLKTQQCIE 198
            D  I +WD+       +L +H + +TG   Q      L+S   D  I+++       ++
Sbjct: 379 GDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 199 THIAHTGECWGLSVKDD--LLITTGTDSQVKLWK 230
           T   HT +   + + +D  L++++G D  +KLWK
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWK 472

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 66/149 (44%), Gaps = 4/149 (2%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           ++ H     +A    D   ++WD+ S+T L    GH   +  L F   G  L SG  D+ 
Sbjct: 281 VDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNA 340

Query: 145 IIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST-SKDGMIKLWDLKTQQCIETHIAH 203
            IVWD+     +  L+ H   I       + + I+T   DG+I +WD++        +AH
Sbjct: 341 AIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAH 400

Query: 204 TGECWGLSVKDD---LLITTGTDSQVKLW 229
                G+  +      L++ G D Q++++
Sbjct: 401 NNIVTGVRFQKSTGHCLVSCGYDKQIRIY 429

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 82/216 (37%), Gaps = 18/216 (8%)

Query: 431 GYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVT 490
           G  +   F P G  V   + +   +L+D+ S + L   ++ H   ++SL   +DG  L +
Sbjct: 276 GRVVNVDFHPSGRFVASASFDMTWRLWDIESETEL-QFQEGHGKEVYSLSFQNDGALLCS 334

Query: 491 GSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISL 550
           G  D     WD +   +++   +    PI                S+  SPD  ++A   
Sbjct: 335 GGLDNAAIVWDVRTGKSIM-NLQGHAKPIY---------------SVDWSPDGYHIATGG 378

Query: 551 LDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSA-DKNIKIWGLDFGDCHK 609
            D  + ++ +        L  H   V  +     +   + S   DK I+I+  D     K
Sbjct: 379 GDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 610 SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGE 645
           +L  H D I+ V    ++    S   D  +K W  E
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQE 474

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 71/151 (47%), Gaps = 10/151 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNF-NGHKAAITLLQFDGTGTRLISGSKDSNIIVW 148
           D  L A G   G IK+ D  +  V+    NGH   I  L ++ T T L+SG+ D  + + 
Sbjct: 197 DNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIH 256

Query: 149 DLVGEVGLYK----LRSHKDSITG--FWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIA 202
               +V + K    L+ H   +    F   G  ++ S S D   +LWD++++  ++    
Sbjct: 257 SFDPDVKIIKELTALQGHTGRVVNVDFHPSGR-FVASASFDMTWRLWDIESETELQFQEG 315

Query: 203 HTGECWGLSVKDD--LLITTGTDSQVKLWKL 231
           H  E + LS ++D  LL + G D+   +W +
Sbjct: 316 HGKEVYSLSFQNDGALLCSGGLDNAAIVWDV 346

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 103/225 (45%), Gaps = 23/225 (10%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVENTLVPGTKDKF-LPILKLNHDT 526
           + H+  + SL  TS G+   L++ S DKT+  W          G   KF +P+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+DI   + 
Sbjct: 66  HI-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVK 640
           MII+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   D +VK
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 641 YWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            W+  +F+       H S +  L  S DG+ + S+  D  I +W 
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 73/161 (45%), Gaps = 16/161 (9%)

Query: 86  EVHQDTDLLAVG-YA-----DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISG 139
            + QD  L A G YA     D  +++WD+ +      F GHK+ +  +  D   + +ISG
Sbjct: 66  HIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISG 125

Query: 140 SKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC----QGED---WLISTSKDGMIKLWDLK 192
           S+D  I VW + G+  L  L  H D ++        + +D    +IS   D M+K W+L 
Sbjct: 126 SRDKTIKVWTIKGQC-LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLN 184

Query: 193 TQQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKL 231
             Q     I H      L+   D  L+ + G D ++ LW L
Sbjct: 185 QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNL 225

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 127/304 (41%), Gaps = 41/304 (13%)

Query: 403 NRLLATASNGSLKIWNV-----KTHKCIRTFECGYALT--CKFLPGGLLVILGTRNGELQ 455
           N LL+ + + +L  W +     K    +R+F+    +   C     G   +  + +  L+
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 456 LFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDK 515
           L+D+A+          H + + S+D+      +++GS DKT+K W            K +
Sbjct: 91  LWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDKTIKVWTI----------KGQ 139

Query: 516 FLPILKLNHDTTLELNDDILSLRISP-----DDRYLAISLL-DNTVKVFFLDSMKFYLSL 569
            L  L L H      ND +  +R+ P     DD    IS   D  VK + L+  +     
Sbjct: 140 CLATL-LGH------NDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
            GH   + ++  S D  +I ++  D  I +W L       +L A QD + S+ F P  + 
Sbjct: 193 IGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRY- 250

Query: 630 FFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--LAISTDGSFVVSSSHDHSI 681
           + + +    +K +  +    +  L      Y+  +E  A  LA S DG  + +   D+ I
Sbjct: 251 WLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVI 310

Query: 682 RIWE 685
           R+W+
Sbjct: 311 RVWQ 314

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH + I  L     GT + S  KD  I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 160 RSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
            +  +  +  +     WL + +  G IK++ L  Q  ++
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 58/138 (42%), Gaps = 17/138 (12%)

Query: 116 NFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC-QGE 174
           +F GH   +        G   +S S D  + +WD+       +   HK  +      +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVK-------DD---LLITTGTDS 224
             +IS S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+ G D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKLWKLN---IENDKLG 239
            VK W LN   IE D +G
Sbjct: 177 MVKAWNLNQFQIEADFIG 194

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 11/125 (8%)

Query: 117 FNGHKAAITLLQFD-GTGTRLISGSKDSNIIVWDLVGE-------VGLYKLRSHKDSITG 168
             GH   +T L    G    L+S S+D  +I W L G+       V  +K  SH      
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 169 FWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQV 226
               G  + +S S D  ++LWD+ T +  +  + H  +   + +  K  ++I+   D  +
Sbjct: 73  LTADGA-YALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 227 KLWKL 231
           K+W +
Sbjct: 132 KVWTI 136

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 10/127 (7%)

Query: 389 GQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G  +++ ++  S D  L+A+A  +G + +WN+   K + T        +  F P    + 
Sbjct: 194 GHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLA 253

Query: 447 LGTRNGELQLFDLASSSLLDTIE-------DAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T  G +++F L    L+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 254 AATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRV 312

Query: 500 WDFQVEN 506
           W     N
Sbjct: 313 WQVMTAN 319

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 103/225 (45%), Gaps = 23/225 (10%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVENTLVPGTKDKF-LPILKLNHDT 526
           + H+  + SL  TS G+   L++ S DKT+  W          G   KF +P+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+DI   + 
Sbjct: 66  HI-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVK 640
           MII+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   D +VK
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 641 YWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            W+  +F+       H S +  L  S DG+ + S+  D  I +W 
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 73/161 (45%), Gaps = 16/161 (9%)

Query: 86  EVHQDTDLLAVG-YA-----DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISG 139
            + QD  L A G YA     D  +++WD+ +      F GHK+ +  +  D   + +ISG
Sbjct: 66  HIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISG 125

Query: 140 SKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC----QGED---WLISTSKDGMIKLWDLK 192
           S+D  I VW + G+  L  L  H D ++        + +D    +IS   D M+K W+L 
Sbjct: 126 SRDKTIKVWTIKGQC-LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLN 184

Query: 193 TQQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKL 231
             Q     I H      L+   D  L+ + G D ++ LW L
Sbjct: 185 QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNL 225

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 127/304 (41%), Gaps = 41/304 (13%)

Query: 403 NRLLATASNGSLKIWNV-----KTHKCIRTFECGYALT--CKFLPGGLLVILGTRNGELQ 455
           N LL+ + + +L  W +     K    +R+F+    +   C     G   +  + +  L+
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 456 LFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDK 515
           L+D+A+          H + + S+D+      +++GS DKT+K W            K +
Sbjct: 91  LWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDKTIKVWTI----------KGQ 139

Query: 516 FLPILKLNHDTTLELNDDILSLRISP-----DDRYLAISLL-DNTVKVFFLDSMKFYLSL 569
            L  L L H      ND +  +R+ P     DD    IS   D  VK + L+  +     
Sbjct: 140 CLATL-LGH------NDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
            GH   + ++  S D  +I ++  D  I +W L       +L A QD + S+ F P  + 
Sbjct: 193 IGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRY- 250

Query: 630 FFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--LAISTDGSFVVSSSHDHSI 681
           + + +    +K +  +    +  L      Y+  +E  A  LA S DG  + +   D+ I
Sbjct: 251 WLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVI 310

Query: 682 RIWE 685
           R+W+
Sbjct: 311 RVWQ 314

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH + I  L     GT + S  KD  I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 160 RSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
            +  +  +  +     WL + +  G IK++ L  Q  ++
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 58/138 (42%), Gaps = 17/138 (12%)

Query: 116 NFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC-QGE 174
           +F GH   +        G   +S S D  + +WD+       +   HK  +      +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVK-------DD---LLITTGTDS 224
             +IS S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+ G D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKLWKLN---IENDKLG 239
            VK W LN   IE D +G
Sbjct: 177 MVKAWNLNQFQIEADFIG 194

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 11/125 (8%)

Query: 117 FNGHKAAITLLQFD-GTGTRLISGSKDSNIIVWDLVGE-------VGLYKLRSHKDSITG 168
             GH   +T L    G    L+S S+D  +I W L G+       V  +K  SH      
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 169 FWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQV 226
               G  + +S S D  ++LWD+ T +  +  + H  +   + +  K  ++I+   D  +
Sbjct: 73  LTADGA-YALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 227 KLWKL 231
           K+W +
Sbjct: 132 KVWTI 136

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 10/127 (7%)

Query: 389 GQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G  +++ ++  S D  L+A+A  +G + +WN+   K + T        +  F P    + 
Sbjct: 194 GHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLA 253

Query: 447 LGTRNGELQLFDLASSSLLDTIE-------DAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T  G +++F L    L+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 254 AATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRV 312

Query: 500 WDFQVEN 506
           W     N
Sbjct: 313 WQVMTAN 319

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 103/225 (45%), Gaps = 23/225 (10%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVENTLVPGTKDKF-LPILKLNHDT 526
           + H+  + SL  TS G+   L++ S DKT+  W          G   KF +P+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+DI   + 
Sbjct: 66  HI-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVK 640
           MII+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   D +VK
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 641 YWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            W+  +F+       H S +  L  S DG+ + S+  D  I +W 
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 73/161 (45%), Gaps = 16/161 (9%)

Query: 86  EVHQDTDLLAVG-YA-----DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISG 139
            + QD  L A G YA     D  +++WD+ +      F GHK+ +  +  D   + +ISG
Sbjct: 66  HIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISG 125

Query: 140 SKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC----QGED---WLISTSKDGMIKLWDLK 192
           S+D  I VW + G+  L  L  H D ++        + +D    +IS   D M+K W+L 
Sbjct: 126 SRDKTIKVWTIKGQC-LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLN 184

Query: 193 TQQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKL 231
             Q     I H      L+   D  L+ + G D ++ LW L
Sbjct: 185 QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNL 225

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 127/304 (41%), Gaps = 41/304 (13%)

Query: 403 NRLLATASNGSLKIWNV-----KTHKCIRTFECGYALT--CKFLPGGLLVILGTRNGELQ 455
           N LL+ + + +L  W +     K    +R+F+    +   C     G   +  + +  L+
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 456 LFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDK 515
           L+D+A+          H + + S+D+      +++GS DKT+K W            K +
Sbjct: 91  LWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDKTIKVWTI----------KGQ 139

Query: 516 FLPILKLNHDTTLELNDDILSLRISP-----DDRYLAISLL-DNTVKVFFLDSMKFYLSL 569
            L  L L H      ND +  +R+ P     DD    IS   D  VK + L+  +     
Sbjct: 140 CLATL-LGH------NDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
            GH   + ++  S D  +I ++  D  I +W L       +L A QD + S+ F P  + 
Sbjct: 193 IGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRY- 250

Query: 630 FFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--LAISTDGSFVVSSSHDHSI 681
           + + +    +K +  +    +  L      Y+  +E  A  LA S DG  + +   D+ I
Sbjct: 251 WLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVI 310

Query: 682 RIWE 685
           R+W+
Sbjct: 311 RVWQ 314

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH + I  L     GT + S  KD  I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 160 RSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
            +  +  +  +     WL + +  G IK++ L  Q  ++
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 58/138 (42%), Gaps = 17/138 (12%)

Query: 116 NFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC-QGE 174
           +F GH   +        G   +S S D  + +WD+       +   HK  +      +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVK-------DD---LLITTGTDS 224
             +IS S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+ G D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKLWKLN---IENDKLG 239
            VK W LN   IE D +G
Sbjct: 177 MVKAWNLNQFQIEADFIG 194

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 11/125 (8%)

Query: 117 FNGHKAAITLLQFD-GTGTRLISGSKDSNIIVWDLVGE-------VGLYKLRSHKDSITG 168
             GH   +T L    G    L+S S+D  +I W L G+       V  +K  SH      
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 169 FWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQV 226
               G  + +S S D  ++LWD+ T +  +  + H  +   + +  K  ++I+   D  +
Sbjct: 73  LTADGA-YALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 227 KLWKL 231
           K+W +
Sbjct: 132 KVWTI 136

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 10/127 (7%)

Query: 389 GQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G  +++ ++  S D  L+A+A  +G + +WN+   K + T        +  F P    + 
Sbjct: 194 GHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLA 253

Query: 447 LGTRNGELQLFDLASSSLLDTIE-------DAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T  G +++F L    L+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 254 AATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRV 312

Query: 500 WDFQVEN 506
           W     N
Sbjct: 313 WQVMTAN 319

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 103/225 (45%), Gaps = 23/225 (10%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVENTLVPGTKDKF-LPILKLNHDT 526
           + H+  + SL  TS G+   L++ S DKT+  W          G   KF +P+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+DI   + 
Sbjct: 66  HI-----VQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLP------ESHNFFSCSKDAVVK 640
           MII+ S DK IK+W +  G C  +L  H D +  V+ +P      +S    S   D +VK
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVK 179

Query: 641 YWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            W+  +F+       H S +  L  S DG+ + S+  D  I +W 
Sbjct: 180 AWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 73/161 (45%), Gaps = 16/161 (9%)

Query: 86  EVHQDTDLLAVG-YA-----DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISG 139
            + QD  L A G YA     D  +++WD+ +      F GHK+ +  +  D   + +ISG
Sbjct: 66  HIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISG 125

Query: 140 SKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC----QGED---WLISTSKDGMIKLWDLK 192
           S+D  I VW + G+  L  L  H D ++        + +D    +IS   D M+K W+L 
Sbjct: 126 SRDKTIKVWTIKGQC-LATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLN 184

Query: 193 TQQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKL 231
             Q     I H      L+   D  L+ + G D ++ LW L
Sbjct: 185 QFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNL 225

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 127/304 (41%), Gaps = 41/304 (13%)

Query: 403 NRLLATASNGSLKIWNV-----KTHKCIRTFECGYALT--CKFLPGGLLVILGTRNGELQ 455
           N LL+ + + +L  W +     K    +R+F+    +   C     G   +  + +  L+
Sbjct: 31  NLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLR 90

Query: 456 LFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDK 515
           L+D+A+          H + + S+D+      +++GS DKT+K W            K +
Sbjct: 91  LWDVATGETYQRFV-GHKSDVMSVDIDKKASMIISGSRDKTIKVWTI----------KGQ 139

Query: 516 FLPILKLNHDTTLELNDDILSLRISP-----DDRYLAISLL-DNTVKVFFLDSMKFYLSL 569
            L  L L H      ND +  +R+ P     DD    IS   D  VK + L+  +     
Sbjct: 140 CLATL-LGH------NDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 570 YGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN 629
            GH   + ++  S D  +I ++  D  I +W L       +L A QD + S+ F P  + 
Sbjct: 193 IGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSA-QDEVFSLAFSPNRY- 250

Query: 630 FFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--LAISTDGSFVVSSSHDHSI 681
           + + +    +K +  +    +  L      Y+  +E  A  LA S DG  + +   D+ I
Sbjct: 251 WLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVI 310

Query: 682 RIWE 685
           R+W+
Sbjct: 311 RVWQ 314

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH + I  L     GT + S  KD  I++W+L  +  +Y L
Sbjct: 175 DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTL 234

Query: 160 RSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
            +  +  +  +     WL + +  G IK++ L  Q  ++
Sbjct: 235 SAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 58/138 (42%), Gaps = 17/138 (12%)

Query: 116 NFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC-QGE 174
           +F GH   +        G   +S S D  + +WD+       +   HK  +      +  
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVK-------DD---LLITTGTDS 224
             +IS S+D  IK+W +K  QC+ T + H    W   V+       DD    +I+ G D 
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRVVPNEKADDDSVTIISAGNDK 176

Query: 225 QVKLWKLN---IENDKLG 239
            VK W LN   IE D +G
Sbjct: 177 MVKAWNLNQFQIEADFIG 194

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 11/125 (8%)

Query: 117 FNGHKAAITLLQFD-GTGTRLISGSKDSNIIVWDLVGE-------VGLYKLRSHKDSITG 168
             GH   +T L    G    L+S S+D  +I W L G+       V  +K  SH      
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 169 FWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQV 226
               G  + +S S D  ++LWD+ T +  +  + H  +   + +  K  ++I+   D  +
Sbjct: 73  LTADGA-YALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTI 131

Query: 227 KLWKL 231
           K+W +
Sbjct: 132 KVWTI 136

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 10/127 (7%)

Query: 389 GQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G  +++ ++  S D  L+A+A  +G + +WN+   K + T        +  F P    + 
Sbjct: 194 GHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLA 253

Query: 447 LGTRNGELQLFDLASSSLLDTIE-------DAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T  G +++F L    L+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 254 AATATG-IKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQTLFAGYTDNVIRV 312

Query: 500 WDFQVEN 506
           W     N
Sbjct: 313 WQVMTAN 319

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/306 (22%), Positives = 128/306 (41%), Gaps = 48/306 (15%)

Query: 393 DMRSIDISDDNRLLATASNGS-LKIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTRN 451
           +M S+D SDD RL A     S +KIW++                       L  +  T N
Sbjct: 490 EMLSLDFSDDCRLAAAGFQDSYIKIWSLDG-------------------SSLDTLTSTNN 530

Query: 452 GELQLFDLASSSL-----------LDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFW 500
                 + A ++L            +T    H  A++S   + D K L++GS DKTV+ W
Sbjct: 531 THFTKKNTADNNLHSKKKHQEHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLW 590

Query: 501 DFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFL 560
               ++TLV                +    N  +  +  SP   Y A +  D T +++  
Sbjct: 591 AMDTQSTLV----------------SYKGHNHPVWDVAFSPMGHYFATASHDQTARLWSC 634

Query: 561 DSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMS 620
           D +       GH   V  +    +   + T S+DK  ++W +  G+  +    H   ++S
Sbjct: 635 DHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVS 694

Query: 621 VKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDH 679
           +   P+     S S+D ++  WD    + ++++  H ++ V ++  S +G+ ++S   D+
Sbjct: 695 LGVSPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDN 754

Query: 680 SIRIWE 685
           S+R+W+
Sbjct: 755 SVRVWD 760

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 74/188 (39%), Gaps = 33/188 (17%)

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDS---------------------------- 562
           N ++LSL  S D R  A    D+ +K++ LD                             
Sbjct: 488 NREMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFTKKNTADNNLHSKK 547

Query: 563 -----MKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDS 617
                +     L GH   V S   S D+K++I+ S DK +++W +D      S   H   
Sbjct: 548 KHQEHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHP 607

Query: 618 IMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSH 677
           +  V F P  H F + S D   + W  +    ++    H S+V  +    +G +V + S 
Sbjct: 608 VWDVAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSS 667

Query: 678 DHSIRIWE 685
           D + R+W+
Sbjct: 668 DKTCRMWD 675

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 47/101 (46%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +WD+ TG+ +        P  S            L V  D   LA G  DG+I VWD+ S
Sbjct: 673 MWDVSTGETVRLFLGHTAPVVS------------LGVSPDGRWLASGSEDGLINVWDIGS 720

Query: 111 KTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
              L    GH + A+  + F   GT +ISG  D+++ VWD+
Sbjct: 721 GKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 63/148 (42%), Gaps = 4/148 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+   
Sbjct: 620 FATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTG 679

Query: 154 VGLYKLRSHKDSITGFWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWG--- 209
             +     H   +       +  WL S S+DG+I +WD+ + + ++    H         
Sbjct: 680 ETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSIV 739

Query: 210 LSVKDDLLITTGTDSQVKLWKLNIENDK 237
            S +  ++I+ GTD+ V++W +   N++
Sbjct: 740 FSQEGTVIISGGTDNSVRVWDMYKSNNE 767

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 2/106 (1%)

Query: 88  HQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH A +  L     G  L SGS+D  I V
Sbjct: 656 HPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINV 715

Query: 148 WDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDL 191
           WD+     L ++R H ++++    + Q    +IS   D  +++WD+
Sbjct: 716 WDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 64/150 (42%), Gaps = 13/150 (8%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D  LL  G  D  +++W + +++ L+++ GH   +  + F   G    + S D    +W 
Sbjct: 574 DNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTARLWS 633

Query: 150 LVGEVGLYKLR------SHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAH 203
                 +Y LR      S  D +T F   G  ++ + S D   ++WD+ T + +   + H
Sbjct: 634 C---DHIYSLRIFAGHLSDVDCVT-FHPNG-CYVFTGSSDKTCRMWDVSTGETVRLFLGH 688

Query: 204 TGECWGLSVKDD--LLITTGTDSQVKLWKL 231
           T     L V  D   L +   D  + +W +
Sbjct: 689 TAPVVSLGVSPDGRWLASGSEDGLINVWDI 718

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 41/206 (19%), Positives = 66/206 (32%), Gaps = 49/206 (23%)

Query: 72  SDARGAKPAECTY-----------LEVHQDTDLLAVGYADGVIKVW-------DLMSKTV 113
           S+ R   P+ C Y           L+   D  L A G+ D  IK+W       D ++ T 
Sbjct: 470 SNLRSELPSVCMYTFHNTNREMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTN 529

Query: 114 LLNFN--------------------------GHKAAITLLQFDGTGTRLISGSKDSNIIV 147
             +F                           GH  A+    F      LISGS+D  + +
Sbjct: 530 NTHFTKKNTADNNLHSKKKHQEHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRL 589

Query: 148 WDLVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
           W +  +  L   + H   +    F   G  +  + S D   +LW       +     H  
Sbjct: 590 WAMDTQSTLVSYKGHNHPVWDVAFSPMGH-YFATASHDQTARLWSCDHIYSLRIFAGHLS 648

Query: 206 --ECWGLSVKDDLLITTGTDSQVKLW 229
             +C         + T  +D   ++W
Sbjct: 649 DVDCVTFHPNGCYVFTGSSDKTCRMW 674

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 102/231 (44%), Gaps = 22/231 (9%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVENTLVPGTKDKF-LPILKLNHDT 526
           + H+  + SL  TS G+   L++GS DKT+  W          G   KF +P+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSGSRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+ I   + 
Sbjct: 66  HI-----VQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN-----FFSCSKDAVVKY 641
           MII+ S DK IK+W +  G C  +L  H D +  V+  P   N       S   D +VK 
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKA 179

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQVF 692
           W+  +F+       H   V  +  S DG+ + S+  D  I +W   E +  
Sbjct: 180 WNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAM 230

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 64/140 (45%), Gaps = 9/140 (6%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGS+D  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDSITGFWCQGEDW------LISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVK 213
             H D ++       D       +IS   D M+K W+L   Q     + H G    ++  
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTAS 204

Query: 214 DD--LLITTGTDSQVKLWKL 231
            D  L+ + G D ++ LW L
Sbjct: 205 PDGTLIASAGKDGEIMLWNL 224

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 100/243 (41%), Gaps = 40/243 (16%)

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENT----------------------LVPGTKDKFLP 518
           LT DG   ++ S DKT++ WD     T                      ++ G++DK + 
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 519 ILKLNHD---TTLELNDDILSLRISP----DDRYLAISLL-DNTVKVFFLDSMKFYLSLY 570
           +  +      T L  ND +  +RI+P    DD    IS   D  VK + L+  +      
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V ++  S D  +I ++  D  I +W L       +L A QD + ++ F P  + +
Sbjct: 193 GHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSA-QDEVFALAFSPNRY-W 250

Query: 631 FSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWA--LAISTDGSFVVSSSHDHSIR 682
            + +  + +K +  +    +  L      Y   +E  A  LA S DG  + +   D  IR
Sbjct: 251 LAAATASGIKIFCLDPQSLVDDLRPEFAGYNKSAEPHAVSLAWSADGQTLFAGYTDSVIR 310

Query: 683 IWE 685
           +W+
Sbjct: 311 VWQ 313

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 55/123 (44%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     ++++ S DK +  W L      FG   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSI 681
               +     S S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D +I
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 67/166 (40%), Gaps = 21/166 (12%)

Query: 92  DLLAVGYADGVIKVWDLMSK-----TVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNII 146
           +LL  G  D  +  W L          + +F GH   +        G   +S S D  + 
Sbjct: 31  NLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLR 90

Query: 147 VWDLVGEVGLYKLRSHKDSITGFWC-QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
           +WD+       +   HK  +      +    +IS S+D  IK+W +K  QC+ T + H  
Sbjct: 91  LWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIK-GQCLATLLGHND 149

Query: 206 ECWGLSVK-------DD--LLITTGTDSQVKLWKLN---IENDKLG 239
             W   V+       DD   +I+ G D  VK W LN   IE D +G
Sbjct: 150 --WVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFVG 193

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 117 FNGHKAAITLLQFD-GTGTRLISGSKDSNIIVWDLVGE-----VGLYKLRSHKDSITGFW 170
             GH   +T L    G    L+SGS+D  +I W L G+     V +   + H   +    
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQD-- 70

Query: 171 C---QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDDLLITTGTDSQ 225
           C   Q   + +S S D  ++LWD+ T +  +  + H  +   +++  K  ++I+   D  
Sbjct: 71  CTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKT 130

Query: 226 VKLWKL 231
           +K+W +
Sbjct: 131 IKVWTI 136

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH   +  +     GT + S  KD  I++W+L  +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTL 233

Query: 160 RSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
            +  +     +     WL + +  G IK++ L  Q  ++
Sbjct: 234 SAQDEVFALAFSPNRYWLAAATASG-IKIFCLDPQSLVD 271

 Score = 38.9 bits (89), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 12/128 (9%)

Query: 389 GQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G   ++ ++  S D  L+A+A  +G + +WN+   K + T           F P    + 
Sbjct: 193 GHNGNVNTVTASPDGTLIASAGKDGEIMLWNLAEKKAMYTLSAQDEVFALAFSPNRYWLA 252

Query: 447 LGTRNGELQLFDLASSSLLDTI--------EDAHDAAIWSLDLTSDGKRLVTGSADKTVK 498
             T +G +++F L   SL+D +        + A   A+ SL  ++DG+ L  G  D  ++
Sbjct: 253 AATASG-IKIFCLDPQSLVDDLRPEFAGYNKSAEPHAV-SLAWSADGQTLFAGYTDSVIR 310

Query: 499 FWDFQVEN 506
            W     N
Sbjct: 311 VWQVMTAN 318

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 126/283 (44%), Gaps = 27/283 (9%)

Query: 346 ITSSKLELVLTTSNNTIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRL 405
           IT+ K +L+    +  +  Y I       T+P P+ +     +G R ++ S+    DN+ 
Sbjct: 40  ITNDK-KLLAAAGHQNVRLYDI-----RTTNPNPVAS----FEGHRGNVTSVSFQQDNKW 89

Query: 406 LATAS-NGSLKIWNVKTHKCIRTFECGYALTCKFL-PGGLLVILGTRNGELQLFDLASSS 463
           +AT+S +G++K+W+V+     R ++    +    + P    +I   R+G ++++DL  + 
Sbjct: 90  MATSSEDGTIKVWDVRAPSIPRNYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQ 149

Query: 464 LLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD--KFLPILK 521
               +    D  + SL L SDG  LV  +       W+       +P   D     P+ K
Sbjct: 150 CTHQLTPEDDTPLQSLSLASDGSMLVAANNKGNCYVWE-------MPNRTDASNLKPVTK 202

Query: 522 LNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLD-SMKFYLSLYGHKLPVLSID 580
                T      I  + +S D ++LA    D+T +V+ +D + K   +L GH+  V    
Sbjct: 203 FRSHNTY-----ITRILLSSDVKHLATCSADHTARVWSVDDNFKLETTLDGHQRWVWDCA 257

Query: 581 ISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKF 623
            S DS  ++T+S+D  +++W L   +  +    H    + V  
Sbjct: 258 FSADSAYLMTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVAL 300

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/293 (20%), Positives = 122/293 (41%), Gaps = 31/293 (10%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGG---LLVILGTRNGELQLFDLAS 461
           L++   + +++ W   T  C RT +   +   +        LL   G +N  ++L+D+ +
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQN--VRLYDIRT 62

Query: 462 SSLLDTIE-DAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPIL 520
           ++       + H   + S+    D K + T S D T+K WD +              P +
Sbjct: 63  TNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRA-------------PSI 109

Query: 521 KLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHK-LPVLSI 579
             N+    +LN  +  + I P+   L     D  ++++ L   +    L      P+ S+
Sbjct: 110 PRNY----KLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSL 165

Query: 580 DISFDSKMIITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMSVKFLPESHNFFSC 633
            ++ D  M++ ++   N  +W +       +L       +H   I  +    +  +  +C
Sbjct: 166 SLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATC 225

Query: 634 SKDAVVKYWD-GEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           S D   + W   + F+    L  HQ  VW  A S D ++++++S DH +R+W+
Sbjct: 226 SADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWD 278

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 66/156 (42%), Gaps = 13/156 (8%)

Query: 41  LITSALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYAD 100
           L  +  +NV ++DI+T +         P   +   G +    T +   QD   +A    D
Sbjct: 47  LAAAGHQNVRLYDIRTTN---------PNPVASFEGHR-GNVTSVSFQQDNKWMATSSED 96

Query: 101 GVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLR 160
           G IKVWD+ + ++  N+  +     ++     G  LIS  +D +I +WDL      ++L 
Sbjct: 97  GTIKVWDVRAPSIPRNYKLNAPVNEVVIHPNQG-ELISCDRDGHIRIWDLGENQCTHQLT 155

Query: 161 SHKDSITGFWCQGED--WLISTSKDGMIKLWDLKTQ 194
              D+         D   L++ +  G   +W++  +
Sbjct: 156 PEDDTPLQSLSLASDGSMLVAANNKGNCYVWEMPNR 191

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 59/117 (50%), Gaps = 4/117 (3%)

Query: 576 VLSIDISFDSKMIITSSADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSC 633
           V  ++I+ D K++  ++  +N++++ +   + +   S   H+ ++ SV F  ++    + 
Sbjct: 35  VNRLEITNDKKLL-AAAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATS 93

Query: 634 SKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETEDQ 690
           S+D  +K WD  +   I + Y   + V  + I  +   ++S   D  IRIW+  E+Q
Sbjct: 94  SEDGTIKVWD-VRAPSIPRNYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQ 149

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 126/290 (43%), Gaps = 21/290 (7%)

Query: 397 IDISDDNRLLATASNGSLKIWNVKTHKCIRTFECGY--ALTCKFLPGGLLVILGTRNGEL 454
           +   D  RL + + +G++KIW+     C+ T   G+  +++C    G  L+  G+ +  +
Sbjct: 243 VAAGDKPRLASASKDGTIKIWDASRRTCLYTLS-GHTNSVSCVKWGGQGLLYTGSHDKTI 301

Query: 455 QLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKD 514
           +++D+ +      I  +H   +  L L          S D  ++   F  +    P  ++
Sbjct: 302 RVWDIKAGGKCINILKSHAHWVNHLSL----------STDYAIRVGPFGPDGKASPSPQE 351

Query: 515 KFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKL 574
               I K N++  +  +  +  L ++  D +     L N +K     S K    + GH+ 
Sbjct: 352 A-RDIAKKNYEKVVRKSGQVEELMVTASDDFTM--FLWNPLK-----SAKPLARMTGHQK 403

Query: 575 PVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCS 634
            V  +  S D + I+++S D +IK+W    G    +   H  S+  V +  +     SCS
Sbjct: 404 LVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCS 463

Query: 635 KDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           KD  +K WD +  +    L  HQ EV+ +  S DG  V S   D  +R+W
Sbjct: 464 KDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGQRVCSGGKDKMVRLW 513

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 71/164 (43%), Gaps = 16/164 (9%)

Query: 534 ILSLRISPD-DRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSS 592
           IL    +PD    +     DNT +++   +      L GH   VL +  S D ++I T S
Sbjct: 146 ILCSAFAPDTSSRMVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPDGELIATGS 205

Query: 593 ADKNIKIW----GLDFGDCHKSLFAHQDSIMSVKFLP-------ESHNFFSCSKDAVVKY 641
            D  I++W    G  +GD  K    H   I S+ + P       +     S SKD  +K 
Sbjct: 206 MDNTIRLWESKAGKPWGDAMK---GHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKI 262

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           WD  +  C+  L  H + V  +     G  + + SHD +IR+W+
Sbjct: 263 WDASRRTCLYTLSGHTNSVSCVKWGGQG-LLYTGSHDKTIRVWD 305

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 86/425 (20%), Positives = 157/425 (36%), Gaps = 88/425 (20%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD-LVG 152
           +  G  D   ++WD  ++T L    GH   +  + +   G  + +GS D+ I +W+   G
Sbjct: 159 MVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPDGELIATGSMDNTIRLWESKAG 218

Query: 153 EVGLYKLRSHKDSITGF-W-------CQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHT 204
           +     ++ H   IT   W          +  L S SKDG IK+WD   + C+ T   HT
Sbjct: 219 KPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTCLYTLSGHT 278

Query: 205 GEC----WGLSVKDDLLITTGTDSQVKLWKLNIENDKLGGKLTEMGTFEKQSKQRGLKIE 260
                  WG      LL T   D  +++W +     K GGK   +       K     + 
Sbjct: 279 NSVSCVKWG---GQGLLYTGSHDKTIRVWDI-----KAGGKCINI------LKSHAHWVN 324

Query: 261 FITNTSDGNSFFYIQNADKTXXXXXXXXXXXXXXXXXXXXXXXXXXXXTDEEITKSIKDS 320
            ++ ++D    + I+                                   EE+  +  D 
Sbjct: 325 HLSLSTD----YAIRVGPFGPDGKASPSPQEARDIAKKNYEKVVRKSGQVEELMVTASDD 380

Query: 321 YSSLILHPFQTVRSLYKI----KSASWTTITSSKLELVLTTSNNTIEYYSIPYEKREPTS 376
           ++  + +P ++ + L ++    K  +    +     +V  + +N+I+     ++ R+   
Sbjct: 381 FTMFLWNPLKSAKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKL----WDGRDGKF 436

Query: 377 PAPLKTHTIELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYALT 435
            A  + H   +         +  S D RLL + S + +LK+W+VKT K          L+
Sbjct: 437 IATFRGHVASVY-------QVAWSSDCRLLVSCSKDTTLKVWDVKTRK----------LS 479

Query: 436 CKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADK 495
              LPG                              H   ++++D + DG+R+ +G  DK
Sbjct: 480 VD-LPG------------------------------HQDEVYTVDWSVDGQRVCSGGKDK 508

Query: 496 TVKFW 500
            V+ W
Sbjct: 509 MVRLW 513

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 88/191 (46%), Gaps = 26/191 (13%)

Query: 487 RLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYL 546
           R+VTG+ D T + WD   +  L          +LK +       ++ +L +  SPD   +
Sbjct: 158 RMVTGAGDNTARIWDCATQTPLS---------VLKGH-------SNWVLCVAWSPDGELI 201

Query: 547 AISLLDNTVKVFFLDSMKFYL-SLYGHKLPVLSID-------ISFDSKMIITSSADKNIK 598
           A   +DNT++++   + K +  ++ GH   + S+         + D   + ++S D  IK
Sbjct: 202 ATGSMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIK 261

Query: 599 IWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWD-GEKFECIQKLYAHQ 657
           IW      C  +L  H +S+  VK+  +    ++ S D  ++ WD     +CI  L +H 
Sbjct: 262 IWDASRRTCLYTLSGHTNSVSCVKWGGQGL-LYTGSHDKTIRVWDIKAGGKCINILKSHA 320

Query: 658 SEVWALAISTD 668
             V  L++STD
Sbjct: 321 HWVNHLSLSTD 331

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 74/319 (23%), Positives = 134/319 (42%), Gaps = 48/319 (15%)

Query: 387 LQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYA-----LTCKFLP 440
           L+G    +  +  S D  L+AT S + ++++W  K  K       G++     LT + L 
Sbjct: 182 LKGHSNWVLCVAWSPDGELIATGSMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPL- 240

Query: 441 GGLLVILG--------TRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGS 492
              LV  G        +++G ++++D +  + L T+   H  ++  +     G  L TGS
Sbjct: 241 --HLVAAGDKPRLASASKDGTIKIWDASRRTCLYTLS-GHTNSVSCVKWGGQG-LLYTGS 296

Query: 493 ADKTVKFWDFQVENTLVPGTKDKFLPILK-----LNHDTTLELNDDILSLRISPDDRYLA 547
            DKT++ WD +           K + ILK     +NH   L L+ D  ++R+ P      
Sbjct: 297 HDKTIRVWDIKAGG--------KCINILKSHAHWVNH---LSLSTD-YAIRVGPFGPDGK 344

Query: 548 ISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWG-LDFGD 606
            S      +     + +  +   G              ++++T+S D  + +W  L    
Sbjct: 345 ASPSPQEARDIAKKNYEKVVRKSGQV-----------EELMVTASDDFTMFLWNPLKSAK 393

Query: 607 CHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAIS 666
               +  HQ  +  V F P+     S S D  +K WDG   + I     H + V+ +A S
Sbjct: 394 PLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWS 453

Query: 667 TDGSFVVSSSHDHSIRIWE 685
           +D   +VS S D ++++W+
Sbjct: 454 SDCRLLVSCSKDTTLKVWD 472

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 64/141 (45%), Gaps = 9/141 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMS-KTVLLNFNGHKAAITLLQFD-------GTGTRLISGSK 141
           D +L+A G  D  I++W+  + K       GH   IT L ++       G   RL S SK
Sbjct: 197 DGELIATGSMDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASK 256

Query: 142 DSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKT-QQCIETH 200
           D  I +WD      LY L  H +S++     G+  L + S D  I++WD+K   +CI   
Sbjct: 257 DGTIKIWDASRRTCLYTLSGHTNSVSCVKWGGQGLLYTGSHDKTIRVWDIKAGGKCINIL 316

Query: 201 IAHTGECWGLSVKDDLLITTG 221
            +H      LS+  D  I  G
Sbjct: 317 KSHAHWVNHLSLSTDYAIRVG 337

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 58/282 (20%), Positives = 111/282 (39%), Gaps = 51/282 (18%)

Query: 445 VILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQV 504
           ++ G  +   +++D A+ + L  ++  H   +  +  + DG+ + TGS D T++ W+ + 
Sbjct: 159 MVTGAGDNTARIWDCATQTPLSVLK-GHSNWVLCVAWSPDGELIATGSMDNTIRLWESKA 217

Query: 505 ENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMK 564
                      +   +K +      L  + L L  + D   LA +  D T+K++      
Sbjct: 218 GK--------PWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRT 269

Query: 565 FYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDF-GDCHKSLFAHQD------- 616
              +L GH   V  +       ++ T S DK I++W +   G C   L +H         
Sbjct: 270 CLYTLSGHTNSVSCVKWGGQG-LLYTGSHDKTIRVWDIKAGGKCINILKSHAHWVNHLSL 328

Query: 617 ----SIMSVKFLPESHN----------------------------FFSCSKDAVVKYWDG 644
               +I    F P+                                 + S D  +  W+ 
Sbjct: 329 STDYAIRVGPFGPDGKASPSPQEARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNP 388

Query: 645 EK-FECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            K  + + ++  HQ  V  +A S DG ++VS+S D+SI++W+
Sbjct: 389 LKSAKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 430

 Score = 51.2 bits (121), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 66/145 (45%), Gaps = 4/145 (2%)

Query: 89  QDTDLLAVGYADGVIKVWD-LMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIV 147
           Q  +L+     D  + +W+ L S   L    GH+  +  + F   G  ++S S D++I +
Sbjct: 369 QVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKL 428

Query: 148 WDLVGEVGLYKLRSHKDSITGF-WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGE 206
           WD      +   R H  S+    W      L+S SKD  +K+WD+KT++       H  E
Sbjct: 429 WDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDE 488

Query: 207 CWGL--SVKDDLLITTGTDSQVKLW 229
            + +  SV    + + G D  V+LW
Sbjct: 489 VYTVDWSVDGQRVCSGGKDKMVRLW 513

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 81  ECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGS 140
           E  +L    D   LA    DG IK+WD   +T L   +GH  +++ +++ G G  L +GS
Sbjct: 238 EPLHLVAAGDKPRLASASKDGTIKIWDASRRTCLYTLSGHTNSVSCVKWGGQGL-LYTGS 296

Query: 141 KDSNIIVWDL-VGEVGLYKLRSH 162
            D  I VWD+  G   +  L+SH
Sbjct: 297 HDKTIRVWDIKAGGKCINILKSH 319

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 610 SLFAHQDSIMSVKFLPE-SHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTD 668
           ++  H  +I+   F P+ S    + + D   + WD      +  L  H + V  +A S D
Sbjct: 138 AIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPD 197

Query: 669 GSFVVSSSHDHSIRIWE 685
           G  + + S D++IR+WE
Sbjct: 198 GELIATGSMDNTIRLWE 214

 Score = 39.3 bits (90), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/109 (21%), Positives = 50/109 (45%), Gaps = 13/109 (11%)

Query: 41  LITSALEN-VNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYA 99
           +++++ +N + +WD + G  ++T    +            A    +    D  LL     
Sbjct: 417 IVSASFDNSIKLWDGRDGKFIATFRGHV------------ASVYQVAWSSDCRLLVSCSK 464

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVW 148
           D  +KVWD+ ++ + ++  GH+  +  + +   G R+ SG KD  + +W
Sbjct: 465 DTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGQRVCSGGKDKMVRLW 513

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 101/227 (44%), Gaps = 22/227 (9%)

Query: 470 DAHDAAIWSLDLTSDGKR--LVTGSADKTVKFWDFQVENTLVPGTKDKF-LPILKLNHDT 526
           + H+  + SL  TS G+   L++ S DKT+  W          G   KF +P+      +
Sbjct: 14  EGHNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLT-------GDDQKFGVPVRSFKGHS 65

Query: 527 TLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSK 586
            +     +    ++ D  Y   +  D T++++ + + + Y    GHK  V+S+ I   + 
Sbjct: 66  HI-----VQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKAS 120

Query: 587 MIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN-----FFSCSKDAVVKY 641
           MII+ S DK IK+W +  G C  +L  H D +  V+  P   N       S   D +VK 
Sbjct: 121 MIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKA 179

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWEETE 688
           W+  +F+       H   V A+  S DGS + S+  D  I +W   E
Sbjct: 180 WNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLE 226

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 64/140 (45%), Gaps = 9/140 (6%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D  +++WD+ +      F GHK+ +  +  D   + +ISGS+D  I VW + G+  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 160 RSHKDSITGFWCQGEDW------LISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVK 213
             H D ++       D       +IS   D M+K W+L   Q     + H G    ++  
Sbjct: 145 LGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTAS 204

Query: 214 DD--LLITTGTDSQVKLWKL 231
            D  L+ + G D ++ LW L
Sbjct: 205 PDGSLIASAGKDGEIMLWNL 224

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 102/243 (41%), Gaps = 40/243 (16%)

Query: 481 LTSDGKRLVTGSADKTVKFWDFQVENT----------------------LVPGTKDKFLP 518
           LT DG   ++ S DKT++ WD     T                      ++ G++DK + 
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 519 ILKLNHD---TTLELNDDILSLRISP----DDRYLAISLL-DNTVKVFFLDSMKFYLSLY 570
           +  +      T L  ND +  +RI+P    DD    IS   D  VK + L+  +      
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V ++  S D  +I ++  D  I +W L       +L A QD + ++ F P  + +
Sbjct: 193 GHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTLSA-QDEVFALAFSPNRY-W 250

Query: 631 FSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWALAI--STDGSFVVSSSHDHSIR 682
            + +  + VK +  +    I  L      Y   +E  A+++  S DG  + +   D+ IR
Sbjct: 251 LAAATASGVKIFSLDPQSLIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIR 310

Query: 683 IWE 685
           +W+
Sbjct: 311 VWQ 313

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 568 SLYGHKLPVLSIDISF-DSKMIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMSV 621
           +L GH   V S+  S     +++++S DK +  W L      FG   +S   H   +   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 622 KFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSI 681
               +     S S D  ++ WD    E  Q+   H+S+V ++AI    S ++S S D +I
Sbjct: 72  TLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTI 131

Query: 682 RIW 684
           ++W
Sbjct: 132 KVW 134

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 47/99 (47%), Gaps = 1/99 (1%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D ++K W+L    +  +F GH   +  +     G+ + S  KD  I++W+L+ +  +Y L
Sbjct: 174 DKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTL 233

Query: 160 RSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
            +  +     +     WL + +  G +K++ L  Q  I+
Sbjct: 234 SAQDEVFALAFSPNRYWLAAATASG-VKIFSLDPQSLID 271

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 58/137 (42%), Gaps = 16/137 (11%)

Query: 116 NFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWC-QGE 174
           +F GH   +        G   +S S D  + +WD+       +   HK  +      +  
Sbjct: 60  SFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKA 119

Query: 175 DWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSVK-------DDLL--ITTGTDSQ 225
             +IS S+D  IK+W +K  QC+ T + H    W   V+       DD +  I+ G D  
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGHND--WVSQVRIAPTDQNDDTVTVISAGNDKM 176

Query: 226 VKLWKLN---IENDKLG 239
           VK W LN   IE D +G
Sbjct: 177 VKAWNLNQFQIEADFVG 193

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 53/127 (41%), Gaps = 10/127 (7%)

Query: 389 GQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G   ++ ++  S D  L+A+A  +G + +WN+     + T           F P    + 
Sbjct: 193 GHNGNVNAVTASPDGSLIASAGKDGEIMLWNLLEKTAMYTLSAQDEVFALAFSPNRYWLA 252

Query: 447 LGTRNGELQLFDLASSSLLDTIE-------DAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T +G +++F L   SL+D +         A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 253 AATASG-VKIFSLDPQSLIDDLRPEFAGYNKAAEPHAVSLTWSADGQTLFAGYTDNVIRV 311

Query: 500 WDFQVEN 506
           W     N
Sbjct: 312 WQVMTAN 318

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 81.6 bits (200), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 92/194 (47%), Gaps = 16/194 (8%)

Query: 506 NTLVPGTKDKFLPILKLNHD--------TTLELNDDILS-LRISPDDRYLAISLLDNTVK 556
           N LV  ++DK L   KL  D         + + ++ I+    ++ D  Y   +  D T++
Sbjct: 30  NLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDCALTADGAYALSASWDKTLR 89

Query: 557 VFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQD 616
           ++ + + + Y    GHK  V+S+ I   + MII+ S DK IK+W +  GDC  +L  H D
Sbjct: 90  LWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIK-GDCLATLLGHND 148

Query: 617 SIMSVKFLP------ESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAISTDGS 670
            +  V+  P      ++    S   D +VK W+  +F+       H + + ++  S DGS
Sbjct: 149 WVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQIEADFVGHNNYINSITASPDGS 208

Query: 671 FVVSSSHDHSIRIW 684
            V S+  D  I +W
Sbjct: 209 LVASAGKDGDIMLW 222

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 58/254 (22%), Positives = 107/254 (42%), Gaps = 41/254 (16%)

Query: 471 AHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENT----------------------L 508
            H+  +    LT+DG   ++ S DKT++ W+     T                      +
Sbjct: 62  GHNHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMI 121

Query: 509 VPGTKDKFLPILKLNHD---TTLELNDDILSLRISP-----DDRYLAISL-LDNTVKVFF 559
           + G++DK + +  +  D   T L  ND +  +R++P     DD    IS   D  VK + 
Sbjct: 122 ISGSRDKTIKVWSIKGDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWN 181

Query: 560 LDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 619
           ++  +      GH   + SI  S D  ++ ++  D +I +W L       +L A QD + 
Sbjct: 182 INQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSA-QDEVF 240

Query: 620 SVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKL------YAHQSEVWALAI--STDGSF 671
           ++ F P  + + + +    +K +  E    I +L      Y   +E  A+++  S DG  
Sbjct: 241 ALAFSPNRY-WLTAATATGIKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQT 299

Query: 672 VVSSSHDHSIRIWE 685
           + +   D  IR+W+
Sbjct: 300 LFAGYTDSIIRVWQ 313

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 71/158 (44%), Gaps = 16/158 (10%)

Query: 89  QDTDLLAVG-YA-----DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKD 142
           QD  L A G YA     D  +++W++ +      F GHK+ +  +  D   + +ISGS+D
Sbjct: 68  QDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRD 127

Query: 143 SNIIVWDLVGEVGLYKLRSHKDSITGFWC-----QGED--WLISTSKDGMIKLWDLKTQQ 195
             I VW + G+  L  L  H D ++         Q +D   LIS   D M+K W++   Q
Sbjct: 128 KTIKVWSIKGDC-LATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQ 186

Query: 196 CIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKL 231
                + H      ++   D  L+ + G D  + LW L
Sbjct: 187 IEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNL 224

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 73/152 (48%), Gaps = 8/152 (5%)

Query: 47  ENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVW 106
           + + VW IK GD ++TL  G     S  R A P E    +   +  L++ G +D ++K W
Sbjct: 128 KTIKVWSIK-GDCLATLL-GHNDWVSQVRVA-PNEK---QEDDNVTLISAG-SDKMVKAW 180

Query: 107 DLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI 166
           ++    +  +F GH   I  +     G+ + S  KD +I++W+L  +  LY L +  +  
Sbjct: 181 NINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVF 240

Query: 167 TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
              +     WL + +  G IK++ L+ +  I+
Sbjct: 241 ALAFSPNRYWLTAATATG-IKVYSLEDEVLID 271

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 59/136 (43%), Gaps = 14/136 (10%)

Query: 109 MSKTVLL---NFNGHKAAITLLQFD-GTGTRLISGSKDSNIIVWDLVGE-------VGLY 157
           MS  VL+      GH   +T L    G    L+S S+D  +I W L G+       V  +
Sbjct: 1   MSTEVLVLRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSF 60

Query: 158 KLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV--KDD 215
           K  +H          G  + +S S D  ++LW++ T +  +    H  +   +++  K  
Sbjct: 61  KGHNHIVQDCALTADGA-YALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKAS 119

Query: 216 LLITTGTDSQVKLWKL 231
           ++I+   D  +K+W +
Sbjct: 120 MIISGSRDKTIKVWSI 135

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 52/127 (40%), Gaps = 10/127 (7%)

Query: 389 GQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFEC-GYALTCKFLPGGLLVI 446
           G    + SI  S D  L+A+A  +G + +WN+K    + T           F P    + 
Sbjct: 193 GHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVFALAFSPNRYWLT 252

Query: 447 LGTRNGELQLFDLASSSLLDTIE-------DAHDAAIWSLDLTSDGKRLVTGSADKTVKF 499
             T  G ++++ L    L+D ++        A +    SL  ++DG+ L  G  D  ++ 
Sbjct: 253 AATATG-IKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQTLFAGYTDSIIRV 311

Query: 500 WDFQVEN 506
           W     N
Sbjct: 312 WQVMTSN 318

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 63/284 (22%), Positives = 119/284 (41%), Gaps = 38/284 (13%)

Query: 424 CIRTFEC--GYALTCKFLPGGLLVILGTRNGELQLFDLASSSL-------LDTIEDA--- 471
           C+ TF    G   + +F     LV  G ++  ++L+ L  SSL        D+I      
Sbjct: 479 CMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMN 538

Query: 472 ---------HDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKL 522
                    H  A++S   + D + L++GS DKTV+ W      +LV             
Sbjct: 539 DNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLV------------- 585

Query: 523 NHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDIS 582
              +    N  +  ++ SP   Y A +  D T +++  D +       GH   V  +   
Sbjct: 586 ---SYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFH 642

Query: 583 FDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYW 642
            +   + T S+DK  ++W +  GD  +    H   ++     P+     + S+D ++  W
Sbjct: 643 PNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLW 702

Query: 643 DGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           D    + ++ +  H ++ + +L+   +G+ +VS   DHS+R+W+
Sbjct: 703 DIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWD 746

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 59/143 (41%), Gaps = 6/143 (4%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH + +  + F   G  + +GS D    +WD+   
Sbjct: 606 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTG 665

Query: 154 VGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC---W 208
             +     H   +  T     G  WL + S+DG+I LWD+ T + ++    H        
Sbjct: 666 DSVRLFLGHTAPVLCTAVSPDGR-WLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSL 724

Query: 209 GLSVKDDLLITTGTDSQVKLWKL 231
               + ++L++ G D  V++W L
Sbjct: 725 SYCKEGNVLVSGGADHSVRVWDL 747

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRNGELQLFDLASS 462
           +   +S+ + ++W++ T   +R F       L     P G  +  G+ +G + L+D+ ++
Sbjct: 648 VFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTA 707

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPG 511
             L  +      AI SL    +G  LV+G AD +V+ WD + ++T  PG
Sbjct: 708 KRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK-KSTAEPG 755

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +        G  L +GS+D  
Sbjct: 639 VSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGI 698

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDLK 192
           I +WD+     L  +R H K++I    +C+  + L+S   D  +++WDLK
Sbjct: 699 INLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 45/101 (44%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +WDI TGD +                  P  CT   V  D   LA G  DG+I +WD+ +
Sbjct: 659 MWDISTGDSVRLF----------LGHTAPVLCT--AVSPDGRWLATGSEDGIINLWDIGT 706

Query: 111 KTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
              L    GH K AI  L +   G  L+SG  D ++ VWDL
Sbjct: 707 AKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDL 747

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 58/148 (39%), Gaps = 9/148 (6%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L  G  D  +++W   + T L+++ GH   +  +QF   G    + S D    +W 
Sbjct: 560 DNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWS 619

Query: 150 LVGEVGLYKLRSHKDSITGFWC----QGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG 205
                 +Y LR     ++   C        ++ + S D   ++WD+ T   +   + HT 
Sbjct: 620 C---DHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTA 676

Query: 206 E--CWGLSVKDDLLITTGTDSQVKLWKL 231
              C  +S     L T   D  + LW +
Sbjct: 677 PVLCTAVSPDGRWLATGSEDGIINLWDI 704

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/192 (19%), Positives = 64/192 (33%), Gaps = 36/192 (18%)

Query: 75  RGAKPAECTY-----------LEVHQDTDLLAVGYADGVIKVWDL--------------- 108
           + A P+ C Y           L+  +D+ L+A G+ D  IK+W L               
Sbjct: 472 QAALPSVCMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADS 531

Query: 109 -----MSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHK 163
                M+        GH  A+    F      L+SGS+D  + +W       L   + H 
Sbjct: 532 INTGDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHN 591

Query: 164 DSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTG--ECWGLSVKDDLLIT 219
             +    F   G  +  + S D   +LW       +     H    +C         + T
Sbjct: 592 HPVWDVQFSPLGH-YFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFT 650

Query: 220 TGTDSQVKLWKL 231
             +D   ++W +
Sbjct: 651 GSSDKTCRMWDI 662

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 99/215 (46%), Gaps = 7/215 (3%)

Query: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVE--NTLVPGTKDKFLPILKLNHDTTLEL 530
           ++ + SL+ + D +    G  D  VK W    E  ++ +P  +D+     + N+ T +  
Sbjct: 427 NSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDE-----RSNNATLVGH 481

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIIT 590
           +  + S   SPD+RYL  +  D TV+++  D+    +S  GH  P+  +  S       T
Sbjct: 482 SGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFAT 541

Query: 591 SSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
           +S D+  ++W  D     +    H + + +V F P     F+ S D   + WD    + +
Sbjct: 542 ASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSV 601

Query: 651 QKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           +    H + V A A+S DG ++ + S D  I +W+
Sbjct: 602 RLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWD 636

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 127/296 (42%), Gaps = 46/296 (15%)

Query: 392 TDMRSIDISDDNRLLATASNGSL-KIWNVKTHKCIRTFECGYALTCKFLPGGLLVILGTR 450
           ++M S++ SDD RL +     S+ KIW++           G  L+ K         L ++
Sbjct: 428 SEMTSLEFSDDVRLASAGFQDSIVKIWSLD----------GEPLSSK---------LPSK 468

Query: 451 NGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVP 510
             E       +++L+      H   ++S   + D + L++ S DKTV+ W      +LV 
Sbjct: 469 QDERS----NNATLV-----GHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLV- 518

Query: 511 GTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLY 570
                          +    N  I  +  SP   Y A +  D T +++  D +       
Sbjct: 519 ---------------SYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFA 563

Query: 571 GHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNF 630
           GH   V ++    +   + T S+DK  ++W +  GD  +    H   + +    P+    
Sbjct: 564 GHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWL 623

Query: 631 FSCSKDAVVKYWDGEKFECIQKLYAH-QSEVWALAISTDGSFVVSSSHDHSIRIWE 685
            + S+D ++  WD    + ++++  H ++ V++L+ S +G  +VS   DHS+R+W+
Sbjct: 624 STGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD 679

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 65/132 (49%), Gaps = 4/132 (3%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTF--ECGYALTCKFLPGGLLVILGTRNGELQLFDLASS 462
           +   +S+ + ++W++ T   +R F             P G  +  G+ +G + ++D+ + 
Sbjct: 581 VFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTG 640

Query: 463 SLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKL 522
             L  +      A++SL  + +G  LV+G AD +++ WD + ++T  PG++ +  P    
Sbjct: 641 KRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVK-KSTAEPGSEPE-QPFTSF 698

Query: 523 NHDTTLELNDDI 534
           + D T  +N DI
Sbjct: 699 SGDVTTSVNQDI 710

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 61/142 (42%), Gaps = 4/142 (2%)

Query: 94  LAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGE 153
            A    D   ++W       L  F GH   +  + F   GT + +GS D    +WD+   
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTG 598

Query: 154 VGLYKLRSHKDSITGFWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAH-TGECWGLS 211
             +     H   +T      +  WL + S+DG+I +WD+ T + ++    H     + LS
Sbjct: 599 DSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 212 VKDD--LLITTGTDSQVKLWKL 231
              +  +L++ G D  +++W +
Sbjct: 659 YSKEGHVLVSGGADHSLRVWDV 680

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 2/110 (1%)

Query: 85  LEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSN 144
           +  H +   +  G +D   ++WD+ +   +  F GH A +T       G  L +GS+D  
Sbjct: 572 VSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGI 631

Query: 145 IIVWDLVGEVGLYKLRSH-KDSITGF-WCQGEDWLISTSKDGMIKLWDLK 192
           I VWD+     L ++R H K+++    + +    L+S   D  +++WD+K
Sbjct: 632 INVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVK 681

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 44/101 (43%), Gaps = 13/101 (12%)

Query: 51  VWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMS 110
           +WD+ TGD +        P             T   V  D   L+ G  DG+I VWD+ +
Sbjct: 592 MWDMSTGDSVRLFLGHTAP------------VTATAVSPDGRWLSTGSEDGIINVWDIGT 639

Query: 111 KTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
              L    GH K A+  L +   G  L+SG  D ++ VWD+
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDV 680

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/170 (19%), Positives = 60/170 (35%), Gaps = 18/170 (10%)

Query: 80  AECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFN-------------GHKAAITL 126
           +E T LE   D  L + G+ D ++K+W L  + +                  GH   +  
Sbjct: 428 SEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYS 487

Query: 127 LQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDG 184
             F      L+S S+D  + +W       L   + H   I    F   G  +  + S D 
Sbjct: 488 TAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGH-YFATASHDQ 546

Query: 185 MIKLWDLKTQQCIETHIAHTGECWGLSVKDD--LLITTGTDSQVKLWKLN 232
             +LW       +     H  +   +S   +   + T  +D   ++W ++
Sbjct: 547 TARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMS 596

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/132 (22%), Positives = 52/132 (39%), Gaps = 16/132 (12%)

Query: 114 LLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL------RSHKDSIT 167
           +  F+   + +T L+F        +G +DS + +W L GE    KL      RS+  ++ 
Sbjct: 420 MYTFHNTNSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLV 479

Query: 168 GF--------WCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGECW--GLSVKDDLL 217
           G         +     +L+S S+D  ++LW   T   + ++  H    W    S      
Sbjct: 480 GHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYF 539

Query: 218 ITTGTDSQVKLW 229
            T   D   +LW
Sbjct: 540 ATASHDQTARLW 551

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 96/210 (45%), Gaps = 9/210 (4%)

Query: 479 LDLTSDGKRLVTGSADKTVKFW--DFQVENTLVPG-TKDKFLPILKLNHDTTLELNDDIL 535
           ++ + D +    G  D T+K W  D     +++P   KD+       N  T +  +  + 
Sbjct: 504 VEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQS------NSATLVGHSGPVY 557

Query: 536 SLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADK 595
           S+  SPD+RYL  +  D TV+++ LD+    +   GH  PV  +  S      IT+S D+
Sbjct: 558 SVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQ 617

Query: 596 NIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYA 655
             ++W  D     +    H + +    F P     F+ S D   + WD +  + ++    
Sbjct: 618 TARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLG 677

Query: 656 HQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
           H S V AL +S DG ++ + S D +I +W+
Sbjct: 678 HTSPVTALEVSPDGRWLTTGSEDGTIIVWD 707

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 80/175 (45%), Gaps = 14/175 (8%)

Query: 531 NDDILSLRISPDDRYLAISLLDNTVKVFFLDSMKFY-------------LSLYGHKLPVL 577
           N ++  +  S D R  A    D+T+KV++LD                   +L GH  PV 
Sbjct: 498 NGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVY 557

Query: 578 SIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDA 637
           S+  S D++ ++++S DK +++W LD   C      H   +  VKF P  H F + S D 
Sbjct: 558 SVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQ 617

Query: 638 VVKYWDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE-ETEDQV 691
             + W  +    ++    H ++V       +G +V + S D + R+W+ +T D V
Sbjct: 618 TARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSV 672

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/327 (20%), Positives = 136/327 (41%), Gaps = 48/327 (14%)

Query: 377 PAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVKTHK---CIRTFE-CGY 432
           P P+KT T++L+ +   +R              S  S+++ N++T     C+ TF     
Sbjct: 454 PLPVKT-TLDLKMEIQKVRE-------------SRDSIQLKNLQTSAPSVCMYTFHNTNG 499

Query: 433 ALTC-KFLPGGLLVILGTRNGELQLFDLASSSLLDTIED------------AHDAAIWSL 479
            +TC +F     L   G ++  ++++ L  S L   +               H   ++S+
Sbjct: 500 NMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSV 559

Query: 480 DLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRI 539
             + D + L++ S DKTV+ W       LV              H      N  +  ++ 
Sbjct: 560 AFSPDNRYLLSASEDKTVRLWSLDTFTCLV----------CYKGH------NHPVWYVKF 603

Query: 540 SPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKI 599
           SP   Y   +  D T +++  D +       GH   V       +   + T S+DK  ++
Sbjct: 604 SPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRM 663

Query: 600 WGLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAH-QS 658
           W +  GD  +    H   + +++  P+     + S+D  +  WD    + I+++  H ++
Sbjct: 664 WDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKN 723

Query: 659 EVWALAISTDGSFVVSSSHDHSIRIWE 685
            ++++  + +G+ +V+   D S+R+W+
Sbjct: 724 PIYSITFNKEGNCLVTGGADQSVRVWD 750

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 107/227 (47%), Gaps = 23/227 (10%)

Query: 381 KTHTIELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKTHKCIRTFECGYALTC--- 436
           ++++  L G    + S+  S DNR L +AS + ++++W++ T  C+  ++ G+       
Sbjct: 543 QSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYK-GHNHPVWYV 601

Query: 437 KFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKT 496
           KF P G   I  + +   +L+       L  I   H   +       +G  + TGS+DKT
Sbjct: 602 KFSPLGHYFITASHDQTARLWSCDHIYPL-RIFSGHLNDVDCSTFHPNGCYVFTGSSDKT 660

Query: 497 VKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRISPDDRYLAISLLDNTVK 556
            + WD Q  +++           L L H +       + +L +SPD R+L     D T+ 
Sbjct: 661 CRMWDIQTGDSVR----------LFLGHTSP------VTALEVSPDGRWLTTGSEDGTII 704

Query: 557 VFFLDSMKFYLSLYGH-KLPVLSIDISFDSKMIITSSADKNIKIWGL 602
           V+ + + K    + GH K P+ SI  + +   ++T  AD+++++W +
Sbjct: 705 VWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 88  HQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIV 147
           H +   +  G +D   ++WD+ +   +  F GH + +T L+    G  L +GS+D  IIV
Sbjct: 646 HPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIV 705

Query: 148 WDLVGEVGLYKLRSH-KDSITGFWCQGE-DWLISTSKDGMIKLWDLK 192
           WD+     + +++ H K+ I       E + L++   D  +++WD+K
Sbjct: 706 WDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 48/108 (44%), Gaps = 13/108 (12%)

Query: 44  SALENVNVWDIKTGDLMSTLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVI 103
           S+ +   +WDI+TGD +        P             T LEV  D   L  G  DG I
Sbjct: 656 SSDKTCRMWDIQTGDSVRLFLGHTSP------------VTALEVSPDGRWLTTGSEDGTI 703

Query: 104 KVWDLMSKTVLLNFNGH-KAAITLLQFDGTGTRLISGSKDSNIIVWDL 150
            VWD+ +   +    GH K  I  + F+  G  L++G  D ++ VWD+
Sbjct: 704 IVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 59/137 (43%), Gaps = 6/137 (4%)

Query: 100 DGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKL 159
           D   ++W       L  F+GH   +    F   G  + +GS D    +WD+     +   
Sbjct: 616 DQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLF 675

Query: 160 RSHKDSITGFWCQGED-WLISTSKDGMIKLWDLKTQQCIETHIAHTGECWGLSV----KD 214
             H   +T      +  WL + S+DG I +WD+ T + I+    H G+    S+    + 
Sbjct: 676 LGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGH-GKNPIYSITFNKEG 734

Query: 215 DLLITTGTDSQVKLWKL 231
           + L+T G D  V++W +
Sbjct: 735 NCLVTGGADQSVRVWDI 751

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 62/146 (42%), Gaps = 5/146 (3%)

Query: 90  DTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWD 149
           D   L     D  +++W L + T L+ + GH   +  ++F   G   I+ S D    +W 
Sbjct: 564 DNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWS 623

Query: 150 LVGEVGLYKLRSHKDSI--TGFWCQGEDWLISTSKDGMIKLWDLKTQQCIETHIAHTGEC 207
                 L     H + +  + F   G  ++ + S D   ++WD++T   +   + HT   
Sbjct: 624 CDHIYPLRIFSGHLNDVDCSTFHPNG-CYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPV 682

Query: 208 WGLSVKDD-LLITTGT-DSQVKLWKL 231
             L V  D   +TTG+ D  + +W +
Sbjct: 683 TALEVSPDGRWLTTGSEDGTIIVWDI 708

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 67/136 (49%), Gaps = 12/136 (8%)

Query: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFL---PGGLLVILGTRNGELQLFDLAS 461
           +   +S+ + ++W+++T   +R F  G+      L   P G  +  G+ +G + ++D+ +
Sbjct: 652 VFTGSSDKTCRMWDIQTGDSVRLF-LGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGT 710

Query: 462 SSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILK 521
              +  ++      I+S+    +G  LVTG AD++V+ WD +   T  PG +    P  +
Sbjct: 711 GKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK-RFTNEPGME----PEQQ 765

Query: 522 LN---HDTTLELNDDI 534
            N    D  L +N+DI
Sbjct: 766 FNTYSGDMELSVNNDI 781

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 57/153 (37%), Gaps = 38/153 (24%)

Query: 83  TYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSK- 141
           T +E   D  L A G+ D  IKVW L                     DG+  + I  SK 
Sbjct: 502 TCVEFSDDARLTAAGFQDSTIKVWYL---------------------DGSPLQSILPSKA 540

Query: 142 --DSNIIVWDLVGEVG-LYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTQQCIE 198
              SN     LVG  G +Y +    D+          +L+S S+D  ++LW L T  C+ 
Sbjct: 541 KDQSNSAT--LVGHSGPVYSVAFSPDN---------RYLLSASEDKTVRLWSLDTFTCLV 589

Query: 199 THIAHTGECW--GLSVKDDLLITTGTDSQVKLW 229
            +  H    W    S      IT   D   +LW
Sbjct: 590 CYKGHNHPVWYVKFSPLGHYFITASHDQTARLW 622

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 116/283 (40%), Gaps = 37/283 (13%)

Query: 435 TCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSAD 494
           + KF P    + +G+ +G ++     S ++  ++E+AH   +  +D  S G  L TG  D
Sbjct: 183 SVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGGED 242

Query: 495 KTVKFW-----------DFQVENTLVPGTKDKFLP----ILKLNHDTTLELND------- 532
             VK +           D Q     V G +  F P    I   + D T  L D       
Sbjct: 243 GLVKLFTVQSGELRQVADLQGHERRVAGCR--FHPFGRYIASASFDNTWRLWDAETNHEL 300

Query: 533 --------DILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFD 584
                   ++  L    D   L  + LD T  ++ + S    + L GH  P+ S+D S  
Sbjct: 301 LLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPR 360

Query: 585 SKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMSVKFLPESHN---FFSCSKDAVVKY 641
              + T+S D  + IW +   +  + L AH   +  ++F  E HN     SC  D  +  
Sbjct: 361 GFEVATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRF--EKHNGKFLMSCGYDKNINV 418

Query: 642 WDGEKFECIQKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIW 684
           + G+ +  I  L  H  ++ AL + T    VVS+  D S++ W
Sbjct: 419 YSGDSWNKITILKGHTDKILALDLGTHDGSVVSAGWDRSVKSW 461

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 70/155 (45%), Gaps = 3/155 (1%)

Query: 534 ILSLRISPDDRYLAISLLDNTVKVFFLDSMKFYLSL-YGHKLPVLSIDISFDSKMIITSS 592
           I S++ SPDD++LA+   D  +K     S+    S+   H   V  +D +    ++ T  
Sbjct: 181 ISSVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGG 240

Query: 593 ADKNIKIWGLDFGDCHK--SLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECI 650
            D  +K++ +  G+  +   L  H+  +   +F P      S S D   + WD E    +
Sbjct: 241 EDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHEL 300

Query: 651 QKLYAHQSEVWALAISTDGSFVVSSSHDHSIRIWE 685
                H  EV+ LA  +DGS + S+  D +  IW+
Sbjct: 301 LLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWD 335

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 95/222 (42%), Gaps = 21/222 (9%)

Query: 386 ELQGQRTDMRSIDISDDNRLLATAS-NGSLKIWNVKT-HKCIRTFECGYALTC-KFLPGG 442
           +LQG    +         R +A+AS + + ++W+ +T H+ +     G  + C  F   G
Sbjct