Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1908.321ON85085043760.0
YLR127C (APC2)8.321ON85385137680.0
Suva_10.2208.321ON85485236110.0
Skud_12.1968.321ON85485235850.0
ZYRO0F10340g8.321ON81885515990.0
TDEL0F044708.321ON80983915670.0
SAKL0H15598g8.321ON78782815190.0
Kwal_56.239098.321ON77681813141e-169
KLTH0G12342g8.321ON77482012821e-164
TPHA0C008308.321ON84285411861e-149
TBLA0A039208.321ON73273011361e-143
CAGL0M04235g8.321ON78382010871e-135
KAFR0H022808.321ON8178839711e-118
NCAS0C032808.321ON8118789351e-112
AGL193W8.321ON7097277994e-94
Ecym_42528.321ON6897337783e-91
KNAG0G024308.321ON7978307828e-91
Kpol_YGOB_Anc_8.3218.321ON5115267172e-84
NDAI0G026008.321ON9118737274e-82
KLLA0D16324g8.321ON6977565133e-54
ZYRO0C09438g7.296ON819116910.041
AFR617C1.343ON77178860.12
SAKL0F10054g7.296ON807183820.37
TDEL0D031404.138ON754158820.46
Kwal_0.701.343ON772114800.68
TPHA0A008803.151ON716104790.94
Ecym_23361.343ON77575761.9
NCAS0A138107.296ON818116762.0
KNAG0K014703.211ON249687752.8
TDEL0D021101.343ON77989743.6
TBLA0A086008.198ON368133734.3
Ecym_81685.364ON52792734.5
Suva_11.1902.544ON23664714.8
NCAS0I017603.244ON39464726.0
Ecym_80467.296ON798153726.1
KAFR0B011507.296ON811116726.3
NCAS0B073101.344ON634114726.7
AFL134W6.254ON47827718.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.190
         (850 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...  1690   0.0  
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...  1456   0.0  
Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...  1395   0.0  
Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...  1385   0.0  
ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...   620   0.0  
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...   608   0.0  
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   589   0.0  
Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...   510   e-169
KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...   498   e-164
TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...   461   e-149
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   442   e-143
CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...   423   e-135
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   378   e-118
NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...   364   e-112
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...   312   4e-94
Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...   304   3e-91
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   305   8e-91
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...   280   2e-84
NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...   284   4e-82
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   202   3e-54
ZYRO0C09438g Chr3 complement(715107..717566) [2460 bp, 819 aa] {...    40   0.041
AFR617C Chr6 complement(1549456..1551771) [2316 bp, 771 aa] {ON}...    38   0.12 
SAKL0F10054g Chr6 complement(770952..773375) [2424 bp, 807 aa] {...    36   0.37 
TDEL0D03140 Chr4 complement(583221..585485) [2265 bp, 754 aa] {O...    36   0.46 
Kwal_0.70 s0 complement(30290..32608) [2319 bp, 772 aa] {ON} YJL...    35   0.68 
TPHA0A00880 Chr1 complement(172938..175088) [2151 bp, 716 aa] {O...    35   0.94 
Ecym_2336 Chr2 complement(652787..655114) [2328 bp, 775 aa] {ON}...    34   1.9  
NCAS0A13810 Chr1 complement(2710214..2712670) [2457 bp, 818 aa] ...    34   2.0  
KNAG0K01470 Chr11 (301521..309011) [7491 bp, 2496 aa] {ON} Anc_3...    33   2.8  
TDEL0D02110 Chr4 complement(409766..412105) [2340 bp, 779 aa] {O...    33   3.6  
TBLA0A08600 Chr1 complement(2120498..2121604) [1107 bp, 368 aa] ...    33   4.3  
Ecym_8168 Chr8 (353777..355360) [1584 bp, 527 aa] {ON} similar t...    33   4.5  
Suva_11.190 Chr11 (357421..358131) [711 bp, 236 aa] {ON} YKL033W...    32   4.8  
NCAS0I01760 Chr9 (325595..326779) [1185 bp, 394 aa] {ON} Anc_3.2...    32   6.0  
Ecym_8046 Chr8 complement(100862..103258) [2397 bp, 798 aa] {ON}...    32   6.1  
KAFR0B01150 Chr2 (217323..219758) [2436 bp, 811 aa] {ON} Anc_7.2...    32   6.3  
NCAS0B07310 Chr2 (1381759..1383663) [1905 bp, 634 aa] {ON} Anc_1...    32   6.7  
AFL134W Chr6 (181202..182638) [1437 bp, 478 aa] {ON} Syntenic ho...    32   8.1  

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score = 1690 bits (4376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 826/850 (97%), Positives = 826/850 (97%)

Query: 1   MSYQIAPTRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIK 60
           MSYQIAPTRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIK
Sbjct: 1   MSYQIAPTRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIK 60

Query: 61  NIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFS 120
           NIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFS
Sbjct: 61  NIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFS 120

Query: 121 HFENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTR 180
           HFENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTR
Sbjct: 121 HFENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTR 180

Query: 181 LDKLIMDDDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIM 240
           LDKLIMDDDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIM
Sbjct: 181 LDKLIMDDDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKV 300
           ETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKV
Sbjct: 241 ETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKV 300

Query: 301 TLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360
           TLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC
Sbjct: 301 TLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360

Query: 361 LHSITTFVKPYFQERKHXXXXXXXXXXXXPEEELKEKITFKVDIKALISLVDTLHDSDIS 420
           LHSITTFVKPYFQERKH            PEEELKEKITFKVDIKALISLVDTLHDSDIS
Sbjct: 361 LHSITTFVKPYFQERKHLVDLLLYAMLDLPEEELKEKITFKVDIKALISLVDTLHDSDIS 420

Query: 421 QFTNVMKRNKNKKGPFLWNLKVKGKNGPSPTSQTMIYQHILNYYLTWVPEPNDMIPGSVK 480
           QFTNVMKRNKNKKGPFLWNLKVKGKNGPSPTSQTMIYQHILNYYLTWVPEPNDMIPGSVK
Sbjct: 421 QFTNVMKRNKNKKGPFLWNLKVKGKNGPSPTSQTMIYQHILNYYLTWVPEPNDMIPGSVK 480

Query: 481 SSCIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKF 540
           SSCIKTNLFEVLLDL            NLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKF
Sbjct: 481 SSCIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKF 540

Query: 541 RETSHVNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPA 600
           RETSHVNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPA
Sbjct: 541 RETSHVNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPA 600

Query: 601 IFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKV 660
           IFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKV
Sbjct: 601 IFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKV 660

Query: 661 EIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFW 720
           EIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFW
Sbjct: 661 EIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFW 720

Query: 721 IQKGVISKENGVYSVIENCETDFDKVHKDIPMETENNNRGLRNESEAERKCELTLQRSLP 780
           IQKGVISKENGVYSVIENCETDFDKVHKDIPMETENNNRGLRNESEAERKCELTLQRSLP
Sbjct: 721 IQKGVISKENGVYSVIENCETDFDKVHKDIPMETENNNRGLRNESEAERKCELTLQRSLP 780

Query: 781 FIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSY 840
           FIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSY
Sbjct: 781 FIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSY 840

Query: 841 EIVKNEHKTL 850
           EIVKNEHKTL
Sbjct: 841 EIVKNEHKTL 850

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score = 1456 bits (3768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 706/851 (82%), Positives = 759/851 (89%), Gaps = 3/851 (0%)

Query: 1   MSYQIAPTRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIK 60
           MS+QI PTRDLKVITDELQTLSSYIFHT I DDLNSLL W SPND KSNHQLRPPSLRIK
Sbjct: 1   MSFQITPTRDLKVITDELQTLSSYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRIK 60

Query: 61  NIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFS 120
           NIIKVLFPN+A+TSPYS++NT Q +NSIVNEGNTNKELQLQL STLKE+YIFQVRYHFF 
Sbjct: 61  NIIKVLFPNNATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFFL 120

Query: 121 HFENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTR 180
           HF NINYLKDIQRWENYYEFPLRYVPIFD+++N W+LELNSLRHYLLNRN+KFKNNLRTR
Sbjct: 121 HFNNINYLKDIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNIKFKNNLRTR 180

Query: 181 LDKLIMDDDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIM 240
           LDKLIMDDDFDLADNLIQWL SA+GSLSS ELIVNAL++KINKFCED MS VWNKRFMIM
Sbjct: 181 LDKLIMDDDFDLADNLIQWLKSANGSLSSTELIVNALYSKINKFCEDNMSRVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKV 300
           ETFNKFINQYWSQFSKL+GCPEDDHELTTTVFNCFESNFLRIRT EIFDICVLAYP+SKV
Sbjct: 241 ETFNKFINQYWSQFSKLVGCPEDDHELTTTVFNCFESNFLRIRTNEIFDICVLAYPDSKV 300

Query: 301 TLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360
           TLLEL+KIMKDFKDY NIVTTFLSDFKKYILNPS+TTVDALLRYVKTIKAFLVLDPTGRC
Sbjct: 301 TLLELRKIMKDFKDYTNIVTTFLSDFKKYILNPSVTTVDALLRYVKTIKAFLVLDPTGRC 360

Query: 361 LHSITTFVKPYFQERKHXXXXXXXXXXXXPEEELKEKITFKVDIKALISLVDTLHDSDIS 420
           LHSITTFVKPYFQERKH            PEEELKEKI F VD+KAL+SLVDTLHDSDI+
Sbjct: 361 LHSITTFVKPYFQERKHLVNVLLYAMLDLPEEELKEKINFNVDMKALLSLVDTLHDSDIN 420

Query: 421 QFTNVMKRNKNKKGPFLWNLKVKGK---NGPSPTSQTMIYQHILNYYLTWVPEPNDMIPG 477
           Q TN+ KR+KNKK PFLWNLKVKGK   N   P    M+Y+HILNYY+ WVPEPNDMIPG
Sbjct: 421 QDTNITKRDKNKKSPFLWNLKVKGKRELNKDLPIRHAMLYEHILNYYIAWVPEPNDMIPG 480

Query: 478 SVKSSCIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQCLKLIREKV 537
           ++KSS IKTNLFEVLLDL            NLLTDRLFTLKFY LD+KWT+CLKLIREK+
Sbjct: 481 NIKSSYIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYTLDEKWTRCLKLIREKI 540

Query: 538 VKFRETSHVNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGL 597
           VKF ETSH NYITNGILGL ETTAP+ADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGL
Sbjct: 541 VKFTETSHSNYITNGILGLLETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGL 600

Query: 598 DPAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQ 657
           DP IFPKFISLLYWKYNCD Q SN+L FHLPI L++ELQKYSD+YSQLKPGRKLQLCKD+
Sbjct: 601 DPIIFPKFISLLYWKYNCDTQGSNDLAFHLPIDLERELQKYSDIYSQLKPGRKLQLCKDK 660

Query: 658 GKVEIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLL 717
           GKVEI+L FKDGRKLVLDVSLEQCSVINQFDS +++ I L+LEQLS+SLNI PPRL HLL
Sbjct: 661 GKVEIQLAFKDGRKLVLDVSLEQCSVINQFDSPNDEPICLSLEQLSESLNIAPPRLTHLL 720

Query: 718 DFWIQKGVISKENGVYSVIENCETDFDKVHKDIPMETENNNRGLRNESEAERKCELTLQR 777
           DFWIQKGV+ KENG YSVIE+ E DFD+  K  PME EN+N  L N+SE ERK ELTLQR
Sbjct: 721 DFWIQKGVLLKENGTYSVIEHSEMDFDQAQKTAPMEIENSNYELHNDSEIERKYELTLQR 780

Query: 778 SLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIAN 837
           SLPFIEGML NLGAMKL+KIHSFLKITVPKDWGYNR++LQQLE YL+ LADEGRLKYIAN
Sbjct: 781 SLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIAN 840

Query: 838 GSYEIVKNEHK 848
           GSYEIVKN HK
Sbjct: 841 GSYEIVKNGHK 851

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score = 1395 bits (3611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 675/852 (79%), Positives = 750/852 (88%), Gaps = 4/852 (0%)

Query: 1   MSYQIAPTRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIK 60
           M+YQI PTRDLK+ITDELQTLSSYIFHT I DDLNSLLIW SP+DPKSNHQLRPPSLRIK
Sbjct: 1   MTYQITPTRDLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIK 60

Query: 61  NIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFS 120
           NIIK LFPN+A TS Y  +NT Q +NSIVNEGNTNKELQLQ +ST KEYYIFQVRYHFF 
Sbjct: 61  NIIKNLFPNNACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFL 120

Query: 121 HFENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTR 180
           HF +INYLKDIQRWENYYEFPLRYV IFDL++NGW+LELNSLRHYLLNRN KFKNNLRTR
Sbjct: 121 HFSSINYLKDIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTR 180

Query: 181 LDKLIMDDDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIM 240
           L+KLI+DDDFDLA NLI+WLNSA+GSLSSM+LIVNALF+KI+ FCE  MSGVWNKRFMIM
Sbjct: 181 LNKLIIDDDFDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKV 300
           ETFNKFINQYWSQFS+LIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYP SK+
Sbjct: 241 ETFNKFINQYWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKI 300

Query: 301 TLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360
           TLLELKKIMKDFKDY NIVTTFLSDFKK+ILNPSITTVDALL YVKTIKAFLVLDPTGRC
Sbjct: 301 TLLELKKIMKDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRC 360

Query: 361 LHSITTFVKPYFQERKHXXXXXXXXXXXXPEEELKEKITFKVDIKALISLVDTLHDSDIS 420
           LHSITTFVKPYFQERKH            PEEELKEKI+FKVD+KAL+ LV+TLHDSDI 
Sbjct: 361 LHSITTFVKPYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDID 420

Query: 421 QFTNVMK-RNKNKKGPFLWNLKVKG---KNGPSPTSQTMIYQHILNYYLTWVPEPNDMIP 476
           Q TN  K ++KNK G F WNL VKG   KNG S  +Q+M+Y+HILNYYLTWVPEPNDMIP
Sbjct: 421 QITNTPKSKDKNKGGSFPWNLHVKGKKEKNGSSSITQSMLYEHILNYYLTWVPEPNDMIP 480

Query: 477 GSVKSSCIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQCLKLIREK 536
           G++KSS IKTNLFEVLLDL            NLLTDRLFTLKFYKLD+KW++CLKLIREK
Sbjct: 481 GNIKSSSIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYKLDNKWSRCLKLIREK 540

Query: 537 VVKFRETSHVNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 596
           +VK  ET+  NYI NGI+GLP+TTAP+ADAD SN+NSIDVMLWDIKCSEELC KMHEVAG
Sbjct: 541 IVKSTETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAG 600

Query: 597 LDPAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKD 656
           LDPAI+PKFISLLYWK+N D  ++NELTFHLP +L+ ELQKYSD+YSQLKPGRKLQLCKD
Sbjct: 601 LDPAIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKD 660

Query: 657 QGKVEIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHL 716
           QGK+E+EL+F DGRKLVLDVSLEQCSVINQF+STD + I L+LEQLS+ LNI P RL+ L
Sbjct: 661 QGKIEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDL 720

Query: 717 LDFWIQKGVISKENGVYSVIENCETDFDKVHKDIPMETENNNRGLRNESEAERKCELTLQ 776
           L+FWIQ+GV+S+ENGVYSVIE   TDF++   + PM+ ENNN  LR+E+E ERKCEL L+
Sbjct: 721 LNFWIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCELILE 780

Query: 777 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIA 836
           RSLPFIEGMLANLGAMKLNKIHSFLKITVPK+WGYNR++L QLE+YL+ LADEG+LKYI 
Sbjct: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYIT 840

Query: 837 NGSYEIVKNEHK 848
           NGSYE+ KN HK
Sbjct: 841 NGSYELEKNGHK 852

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score = 1385 bits (3585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/852 (78%), Positives = 746/852 (87%), Gaps = 4/852 (0%)

Query: 1   MSYQIAPTRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIK 60
           MSYQI PTRDLKVITD+LQTLSSY+FHT IADDLNSLLIW SPNDPKSNHQLRPPSLRIK
Sbjct: 1   MSYQITPTRDLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIK 60

Query: 61  NIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFS 120
           NIIKVLFPN+ STS Y V+N+GQT N++  EGNTNKELQLQLLSTLKEYY+FQVRYHFF 
Sbjct: 61  NIIKVLFPNNVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFL 120

Query: 121 HFENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTR 180
            F +I YLKDIQRWENYYEFPLRYVPIFDL +N WSLELNSLRHY+LNRN+KFKNNLR R
Sbjct: 121 RFNDIIYLKDIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVR 180

Query: 181 LDKLIMDDDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIM 240
           L+KLIMDDDFDLA NLI+WLN A+GSLSSMELIVNALFNKI KFCE  MSGVWNKRFMIM
Sbjct: 181 LNKLIMDDDFDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIM 240

Query: 241 ETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKV 300
           ETFNKFINQYWSQF +LI CPEDDHELTTTVFNCFESNFLRIRT+EIFDICVLAYP+SKV
Sbjct: 241 ETFNKFINQYWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKV 300

Query: 301 TLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360
            LLELKKIMKDFKDY NIVT FLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC
Sbjct: 301 ALLELKKIMKDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360

Query: 361 LHSITTFVKPYFQERKHXXXXXXXXXXXXPEEELKEKITFKVDIKALISLVDTLHDSDIS 420
           LHSI TFVKPYFQERKH            PEEELKEKITFKVD+KAL+SLVD LHD DI 
Sbjct: 361 LHSIITFVKPYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIG 420

Query: 421 QFTNVMK-RNKNKKGPFLWNLKVKGK---NGPSPTSQTMIYQHILNYYLTWVPEPNDMIP 476
           Q T+  K ++KNK+ PFLWNLKVKGK   N      QTM+Y+H+LN+YLTWVPEPND+IP
Sbjct: 421 QNTDAHKSKDKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIP 480

Query: 477 GSVKSSCIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQCLKLIREK 536
           GSVKSS IKTNLFE+LLDL            NLLTDRL +LKFYKLDDKW+QCLKLIRE+
Sbjct: 481 GSVKSSYIKTNLFEILLDLFESREFFISEFRNLLTDRLSSLKFYKLDDKWSQCLKLIRER 540

Query: 537 VVKFRETSHVNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 596
           +VKF ET+H NYITNGILGLPETTAP+ADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG
Sbjct: 541 IVKFTETNHANYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAG 600

Query: 597 LDPAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKD 656
           LDP +FPKFISLLYWK+N D Q+  +  F +P  L++ELQKYSD+YSQ+KPGR+LQLCKD
Sbjct: 601 LDPTVFPKFISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKD 660

Query: 657 QGKVEIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHL 716
           QGKVE+EL+F+DGRKLVLDVSLEQ SV+NQF+ST+++ I+L+L+QLS+SLNIT  +L+ L
Sbjct: 661 QGKVEMELSFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQL 720

Query: 717 LDFWIQKGVISKENGVYSVIENCETDFDKVHKDIPMETENNNRGLRNESEAERKCELTLQ 776
           L+FWIQKGV+S+E  VYSVIE  +T F +  KD+ M+  NNN  LR+ESE E+KCELTLQ
Sbjct: 721 LNFWIQKGVLSEEGEVYSVIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELTLQ 780

Query: 777 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIA 836
           RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNR++L QLE+YL+ L DEG+LKYIA
Sbjct: 781 RSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIA 840

Query: 837 NGSYEIVKNEHK 848
           NGSYEI KN HK
Sbjct: 841 NGSYEIAKNGHK 852

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/855 (40%), Positives = 508/855 (59%), Gaps = 48/855 (5%)

Query: 1   MSYQIAPTRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIK 60
           M+  +    DLK +  ++Q ++    H    DDL SLL W +PN+P+SNHQ +PP+LR+K
Sbjct: 1   MNAVMRAGEDLKRLLVQIQEVALRT-HPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLK 59

Query: 61  NIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFS 120
           N IK+L                Q  N  + E    ++     +  ++++Y++QVR HFF+
Sbjct: 60  NSIKML--------------VNQYYNMELREDE--RDTGYLFIQLVRQFYVYQVRLHFFA 103

Query: 121 HFENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTR 180
              N++  KD+QR   YYEFPL+YV IF+     W  E + L HYLLNR+ K + N+ +R
Sbjct: 104 SLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSR 163

Query: 181 LDKLIMDDDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIM 240
           L  L+M+DDFDLA ++++WLN ++ ++SSM+L+++ +  KI++FC+D M+G WN RF+IM
Sbjct: 164 LKDLVMEDDFDLAMDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIM 223

Query: 241 ETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKV 300
           ETFN+FI  YWSQF  L+ CPED+HELTT V++ FE  F+++RTKEIFDI V  YP+SK 
Sbjct: 224 ETFNRFITSYWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKP 283

Query: 301 TLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360
           TLLEL++++   KD+  IV  FLS+F++ ILNPSI+TV+ALL YVKT+KAFL LDPTGRC
Sbjct: 284 TLLELRRVLVKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRC 343

Query: 361 LHSITTFVKPYFQERKHXXXXXXXXXXXXPEEELKEKITFKVDIKALISLVDTLHDSDI- 419
           L+S++ FVKPYFQER                EE +      +D  +L  L   L D +  
Sbjct: 344 LNSVSAFVKPYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFG 403

Query: 420 --SQFTNVMKRNKNKKGPFLWNLKVKGKNGPSPTSQTMI-----YQHILNYYLTWVPEPN 472
             S F  + + +            +  +   + T+  M+     Y+ ++  +L W PEP 
Sbjct: 404 IESSFETIPQAD------------LLSRPASTATTAAMLDPRLPYKSVIKNFLQWTPEPM 451

Query: 473 DMIPGSV-KSSCIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQCLK 531
           D I  +  KS     NL ++L+D+            +LLT +L TLK Y LD KW+ CL+
Sbjct: 452 DTISKNYSKSLSASRNLLDILMDMFESKDFFVSEFLSLLTRKLLTLKLYTLDRKWSHCLR 511

Query: 532 LIREKVVKFRETSHVNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKM 591
           L++ K       +     T    G   +       D SN+N+IDVML D++ S ELC++M
Sbjct: 512 LLKTKFGP--AGAAAVVATGIGGGDGGSIDGVRGGDPSNINNIDVMLRDVRGSSELCKRM 569

Query: 592 HEVAGLDPAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKL 651
           H+VAGLD  I+PKFIS LYW  +    SSN  TF L   +  EL KY  VYS++KPGR L
Sbjct: 570 HQVAGLDQRIYPKFISPLYWNRD---NSSNGWTFQLDPQMALELDKYCQVYSEIKPGRAL 626

Query: 652 QLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPP 711
            L KDQG V + L+F+DGRK   + +LEQCSVI QFD++   +  LT + +   L + P 
Sbjct: 627 HLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPA 686

Query: 712 RLVHLLDFWIQKGVISKENGVYSVIENCETDFDKVHKDIPMETENNNRGLRNESEAERKC 771
           R    L  W+Q+GV+  +   Y   E  +   D+  +++P   +++          +R  
Sbjct: 687 RARAALQHWVQEGVLYYDGNAYKTREYLD---DQPAENLPASKDSSASSQARTMSPDRDS 743

Query: 772 ELT--LQRSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADE 829
            LT  L+++ PFI+GML NLGA+K+ KIHSFLK+T PK+ G++ V+  QLE YL +L +E
Sbjct: 744 RLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEE 803

Query: 830 GRLKYIANGSYEIVK 844
            RL    N +Y++ K
Sbjct: 804 ERLICTTNDTYKLPK 818

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/839 (41%), Positives = 508/839 (60%), Gaps = 42/839 (5%)

Query: 8   TRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLF 67
           + +L VI D ++ ++  + H    DDL +LL W +PN+ +SNH +RPP LR+K+ IK LF
Sbjct: 6   SSELPVIIDSIKEVALRL-HPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIK-LF 63

Query: 68  PNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINY 127
            N          N+G  S S   +G  NK  + +L + L+++YI+QVR HFF+ F  I  
Sbjct: 64  VNQ-------YYNSGYISGS---DGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQT 113

Query: 128 LKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMD 187
            KDIQR E YY  PL Y+ +F+     W +E + LRHYLLNRNM+F NN++ R++ L M 
Sbjct: 114 FKDIQRLEKYYVSPLAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQ 173

Query: 188 DDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFI 247
           DDF+    ++ W+  A  SLSS +++++ +  K+ +FC+D M GV+ K +++M+TFNKFI
Sbjct: 174 DDFEYVAEMLDWVEKAHTSLSSKDILLDLIIAKVKQFCDDHMMGVYGKTYLVMKTFNKFI 233

Query: 248 NQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKK 307
            +YWS F++L+GCP+DDH LT  V+ CFE  F+RIRT+E+FDI V  +PNSK T++E++K
Sbjct: 234 IKYWSNFAQLLGCPQDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRK 293

Query: 308 IMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTF 367
           ++    D+  IV  FLS F+K +LNPS+TT DALL YVK++KAFL LDP+GR L S+ +F
Sbjct: 294 LITHSTDFKTIVIAFLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISF 353

Query: 368 VKPYFQERKHXXXXXXXXXXXXPEEELKEKITFKVDIKALISLVDTLHDSDISQFTNVM- 426
           VK  FQER                + L      +VD   L +L   L D ++    ++  
Sbjct: 354 VKQTFQERSDLVVILLYAILDLQLDGLVGS-HIQVDPVCLKALASELRDPELGIENDIYP 412

Query: 427 KRNKNKKGPFLWNLKVKGKNGPSPTSQTMIYQHILNYYLTWVPEPNDMIPGSV-KSSCIK 485
             N       +  L  +G          + Y+ ++  +L+W P+P DM P ++ K S   
Sbjct: 413 DDNLANVATGMAKLNYEG---------CLPYEEVMQRFLSWNPDPRDMAPRAISKQSPSH 463

Query: 486 TNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSH 545
            +L ++L++L             LLT RL +LKFY LD  W++CL+L+++K+   R   +
Sbjct: 464 MSLLDILMELFESKDFFVSEFLKLLTKRLLSLKFYNLDRNWSKCLQLLKKKLA--RGAPN 521

Query: 546 VNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKF 605
           ++    G     +  +   D D SN+NS DVMLWD+K S ELC++MH+V+GLD  I+PKF
Sbjct: 522 ISLAPTG----QQNNSERGD-DYSNINSNDVMLWDVKLSYELCKQMHQVSGLDQRIYPKF 576

Query: 606 ISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELN 665
           IS LYW  NC ++S N+  F +P  L  E +KYS VYS++K GR L+L KDQG +E++L 
Sbjct: 577 ISYLYW--NCQLESKND--FEIPEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVIELDLE 632

Query: 666 FKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGV 725
           FKDGR L  DV+LEQ +VI QFD  D+ +  L  E +S  LN+   R+   L FW++KGV
Sbjct: 633 FKDGRVLQCDVTLEQYAVIQQFDE-DSYANRLMAETISLYLNMEISRVKSALQFWVEKGV 691

Query: 726 ISKENGVYSVIENCETDFDKVHKDIPMET--ENNNRGLRNESEAERKCELTLQRSLPFIE 783
           + + +  Y+  E+ +    K  K   + +  E N   +  E+   +    TL    PF++
Sbjct: 692 LYQVDAFYATQESRQDSNIKTAKSDSVGSFFEKNETIIEEETTLSK----TLNAIWPFVQ 747

Query: 784 GMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYEI 842
           GML NLG++K  KIHSFLK+TVPK+ GY  V+  QLE YL++L +E RL    +GSY++
Sbjct: 748 GMLTNLGSLKAAKIHSFLKVTVPKEVGYIVVTQSQLESYLNSLVEEERLACTTSGSYKL 806

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/828 (39%), Positives = 483/828 (58%), Gaps = 70/828 (8%)

Query: 26  FHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTS 85
           ++  + D+L+ +L W +PN+P SNHQLRPPSLR+KN IK+            VVN     
Sbjct: 21  YNPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRLKNGIKL------------VVN----- 63

Query: 86  NSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYV 145
                    N+++    +  L+++ + Q R HFFS+F +I   KDIQR E YYEFPL+Y+
Sbjct: 64  ---------NEDVPPGFVHLLRQFVLLQTRIHFFSNFNSITSFKDIQRLEKYYEFPLKYI 114

Query: 146 PIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDFDLADNLIQWLNSADG 205
            IF  D   W +E+N  RHYL+++N  F +N++ R+ +LIM+DDFD+A  +  WL    G
Sbjct: 115 NIFTPD--EWFIEMNGFRHYLMSKNRIFGDNIKHRVRQLIMEDDFDMAWKIYTWLTETMG 172

Query: 206 SLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCPEDDH 265
               + L++  L +KI  F +  M G W +RF++METFN FI +YWS F++ + CPEDDH
Sbjct: 173 H-QLVSLLLEILMDKIADFSKQNMMGKWTQRFLVMETFNTFITKYWSTFAQALRCPEDDH 231

Query: 266 ELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDYANIVTTFLSD 325
           E+TT +F+CFE  F++IRT EI++ICVL YP+SK  LLEL+ +MK   DY+ ++  FLS 
Sbjct: 232 EITTEIFHCFEKEFVKIRTSEIYEICVLEYPHSKPALLELRNVMKTSADYSKLMIEFLSK 291

Query: 326 FKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHXXXXXXXX 385
           F+  ++NPS+TT + LL Y++TIK+FL +DP GR L S+T ++KPY +ER+         
Sbjct: 292 FESKLMNPSVTTTEILLSYIRTIKSFLTVDPAGRYLQSVTAYIKPYLRERRDTVVHLLYA 351

Query: 386 XXXXPEEELKEKITFKVDIKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKVKGK 445
                E E+ +     +++  L  L   L D D        K  KNK       L V   
Sbjct: 352 MLELDESEIDDA-NVSLNMPILTELSKELKDPDFGIEDADSKSRKNK-------LMVTD- 402

Query: 446 NGPSPTSQTMIYQHILNYYLTWVPEPNDMIPGSVKSSCIKTNLFEVLLDLXXXXXXXXXX 505
           + P    +  + + +LNY+L W PEP+D+      ++ +  +L ++LLD+          
Sbjct: 403 SSPVFKVEKPLCEQVLNYFLQWTPEPSDVAHRKPNNTFVNKSLLDILLDIFDSKDVFISE 462

Query: 506 XXNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTAPSAD 565
             +L T +L  LK+YKL+ KW + L+L+++K               G    P+       
Sbjct: 463 FLSLFTKKLLGLKYYKLETKWIKILRLLKKKF--------------GHTSFPQHQF---- 504

Query: 566 ADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYWKYNCDMQSSNELTF 625
            D SN+N+ID+ML D+K S EL  KMHEVAGLD  +FPKFIS L+W    + ++S+   F
Sbjct: 505 QDTSNINNIDIMLRDVKTSYELISKMHEVAGLDDRVFPKFISYLFWNSALEAETSD---F 561

Query: 626 HLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVIN 685
            LP  L+ E++KYS+VYSQLKPGR+L L KDQG VE++L FKDGRK+  +V L + +VI+
Sbjct: 562 QLPGWLETEIEKYSEVYSQLKPGRRLHLYKDQGTVELDLEFKDGRKISCEVPLNKAAVIS 621

Query: 686 QFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVISKEN--GVYSVIENCETDF 743
            FD  D     L +EQ+ D++ +    +  +L FW +K  I  ++    Y V+E  E + 
Sbjct: 622 CFDQ-DTALKGLAVEQIVDNVKMEKALVTSILQFWCKKNAIYYDDRYNTYRVLEYYEPNS 680

Query: 744 DKVHKDIPMETENNNRGLR---NESEAERKCELTLQRSL----PFIEGMLANLGAMKLNK 796
                 +     N N G+    ++  A  K +    +S+    PFI+GML NLG+MK  K
Sbjct: 681 ALSASTVISSKGNTNGGINPMDDQDNAGDKQQQEFIQSMSKIWPFIQGMLTNLGSMKPEK 740

Query: 797 IHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYEIVK 844
           IHSFLK+ VPKD GY   ++ QLE YL+ L DE +L  + NGSY++VK
Sbjct: 741 IHSFLKMAVPKDIGYT-ATVNQLESYLNVLVDEDKLAAVPNGSYKLVK 787

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score =  510 bits (1314), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 285/818 (34%), Positives = 458/818 (55%), Gaps = 70/818 (8%)

Query: 29  TIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSI 88
           T+ DDL S+L W +PN+P SNHQLRPPSLR+K+ IK+L                      
Sbjct: 24  TVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKIL---------------------- 61

Query: 89  VNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPIF 148
           +NE      L       L++Y IFQ R HFF+H+ ++ + KD+Q+ E YYEFPLR+V +F
Sbjct: 62  INENGNGPALT----DILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLF 117

Query: 149 DLDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDFDLADNLIQWLNSADGSLS 208
           + +   W+ E+N LR+YL+++N+ F  N R RL +L+++DDF++A  L +WL  A+G L 
Sbjct: 118 NRE--EWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLL 175

Query: 209 SMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCPEDDHELT 268
           +  L+V+A+ +K+  F    M   W+KRF+ +E +N FI++YWS  S+++ CPEDDH++T
Sbjct: 176 T-HLLVDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVT 234

Query: 269 TTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDYANIVTTFLSDFKK 328
             ++ CFE  F+RIRT++ F I V  YP S+ TLLEL+ ++K    Y  +VT  LS F+ 
Sbjct: 235 NEIYRCFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEA 294

Query: 329 YILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHXXXXXXXXXXX 388
            +LNPSITT + LL YVK IK+ L +D + R    +T FV+P+  ER+            
Sbjct: 295 RMLNPSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLG 354

Query: 389 XPEEELKEKITFKVDIKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKVKGKNGP 448
               E +              L   L DS    F + +  +K+ + P          +  
Sbjct: 355 LDASETRGPKPTGAHASIASQLSAELKDSHQPIFRSAL--DKSAQSPV--------DDMA 404

Query: 449 SPTSQTMIYQHILNYYLTWVPEPNDMIPGSVKSSCIKTNLFEVLLDLXXXXXXXXXXXXN 508
           S   +  +YQ ++N+YL W PEP+D I  +   + +   LF+++++L             
Sbjct: 405 SVNPKEPVYQQVINFYLHWTPEPSDSIQANNSDTLMNKGLFDIIVELFDSKDIIIGEFLT 464

Query: 509 LLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTAPSADADQ 568
           L TD+L  LK Y+L+  W + LK+++ +   F+  S+   +                   
Sbjct: 465 LFTDKLLDLKGYRLEQNWVKSLKILKNR-FDFKNYSNAQGV------------------- 504

Query: 569 SNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYWKYNCDMQSSNELTFHLP 628
           SN+N+IDVML D+K SEELC +MH V  +   + P FIS L+W       S+      LP
Sbjct: 505 SNINNIDVMLRDVKHSEELCAQMHSVPEISREVIPMFISYLFWNAGSKF-STLPKDCRLP 563

Query: 629 IHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVINQFD 688
             L+ E++KY D+Y+Q+KPGRKL+L ++Q  V ++L+F D R +  +VS+++ SV+    
Sbjct: 564 SQLESEIRKYKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVL---- 619

Query: 689 STDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVI--SKENGVYSVIENCETDFDKV 746
           +   ++  ++ +++ ++  +   ++   L FW+   V+    +  +YS +E  +TD +  
Sbjct: 620 ACVAETTGISRDKIVEATGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDTD-NAS 678

Query: 747 HKDIPMETENNNRGLRNESEAERKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLKITVP 806
            ++  M  E+  R   + S+ ++  E ++++  PFI GML NLG +K+ KIHSFLK+ VP
Sbjct: 679 EREAQMRAEDQARSAFD-SQQQQFVE-SMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVP 736

Query: 807 KDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYEIVK 844
           K+ G+N  +  QLE YL  L DE +L   AN ++++VK
Sbjct: 737 KEIGFN-ATTAQLEAYLRLLVDENKLVCSANNAFKLVK 773

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score =  498 bits (1282), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 289/820 (35%), Positives = 445/820 (54%), Gaps = 71/820 (8%)

Query: 28  TTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNS 87
           +++ DDL  +L W +PN+P SNHQ+RPPSLR+K+ IK            S++N   TS S
Sbjct: 23  SSLEDDLEGILTWVNPNEPGSNHQMRPPSLRVKSAIK------------SLLNGVVTSES 70

Query: 88  IVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPI 147
            ++               L +Y IFQ R HFF +++++ Y KD+Q+ E YYEFP RYV I
Sbjct: 71  FID--------------LLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFPTRYVNI 116

Query: 148 FDLDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDFDLADNLIQWLNSADGSL 207
           F  +   W  E++ LR+YL+ +N   KNN++ RL++L+ +DDFD+A  + +WL  A+G L
Sbjct: 117 FSSE--EWCDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLCQAEGRL 174

Query: 208 SSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCPEDDHEL 267
              E++V+ L +K+  F    M+  W +RF IME +N F+  YWS F +++ C EDDHE+
Sbjct: 175 LP-EILVDVLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCMEDDHEI 233

Query: 268 TTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDYANIVTTFLSDFK 327
           T  ++ CFE  F+RIRT ++FDI V  +P +K TLLEL+ ++K    Y  ++T FL  F+
Sbjct: 234 TNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITEFLYQFE 293

Query: 328 KYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHXXXXXXXXXX 387
             +LNPSITT + LL YV+ IK+ L++D + R    +T FV+PY  ER            
Sbjct: 294 SKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVATFLYAML 353

Query: 388 XXPEEELKEKITFKVDIKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKVKGKNG 447
                +L  K +    +     L   L  S     ++  +R          NL   GK+ 
Sbjct: 354 GLDASDLSSKNSTSTHMSIASQLSAELRGSHQPISSSTAERG---------NLP-HGKHA 403

Query: 448 PSPTSQTMIYQHILNYYLTWVPEPNDMIPGSVKSSCIKTNLFEVLLDLXXXXXXXXXXXX 507
            S       YQ I++YYL W PEP D I  +   + I   LF+++++L            
Sbjct: 404 LSMNPYEPAYQQIIDYYLHWNPEPADSIQANNDQALISKELFDIIVELFDSKDVIVREFL 463

Query: 508 NLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTAPSADAD 567
            L T +L  L+ YKL+  W Q LK++++K+                    +    S+  +
Sbjct: 464 GLFTRKLLGLRGYKLESNWVQSLKVVKKKL--------------------DFKTYSSAQE 503

Query: 568 QSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYWKYNCDMQSSNELTFHL 627
            SN+N+IDVML D+K SEELC  MHE  GL   I PKF+S L+W  + D  S+      L
Sbjct: 504 FSNINNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDF-SALPKDHPL 562

Query: 628 PIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVINQF 687
           P  L+ ++  Y   Y+ +K GRKL+L  +Q  VE++L   DGR L  +V+L++  V++  
Sbjct: 563 PKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSYL 622

Query: 688 DSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVI--SKENGVYSVIENCETDFD- 744
            S  +     T+E++    N+   ++   L FW++  ++  S E   YSV E    D   
Sbjct: 623 SSNGDG----TVEEIVKQTNLDISQVEKSLKFWVKSSILRYSTETSRYSVEERQNVDVKH 678

Query: 745 KVHKDIPMETENNNRGLRNESEAERKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLKIT 804
            V +    E  N    +  +   +++   ++Q+ LPFI+GML NLG++K +KIHSFLK+ 
Sbjct: 679 AVERQSSSEIVNATDSVDLQ---QQQFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLKMA 735

Query: 805 VPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYEIVK 844
           VPK+ GY+  +  QL+ YL+AL +E +L    NG++ + K
Sbjct: 736 VPKEIGYS-ATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score =  461 bits (1186), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 295/854 (34%), Positives = 450/854 (52%), Gaps = 80/854 (9%)

Query: 31  ADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSIVN 90
           +DD++SLL W +PNDPKSNHQL+PP++R+K +IK +  +  +   Y  + T         
Sbjct: 25  SDDIDSLLDWLNPNDPKSNHQLKPPTIRLKKVIKKILLDVNTLGDYDSIET--------- 75

Query: 91  EGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPIFDL 150
                      L S L+ YYIFQVR +FFS+ ++I Y KDI + E YYEFP+ +VPIF  
Sbjct: 76  -----------LNSLLRYYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLN 124

Query: 151 DINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDFDLADNLIQWLNSADGSL-SS 209
           +   W  ELN +RHYLL  N+ F++NL  RL KL+ +DDFDLA  +I+W N A+ SL SS
Sbjct: 125 NNYIWETELNKIRHYLLRTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSS 184

Query: 210 MELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCPEDDHELTT 269
            ++I+NAL +KI  + +   +  W++RF+IMET+NKFIN+YWS F+ L+ C EDDHE+T 
Sbjct: 185 KQIILNALLDKITMYADKQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITK 244

Query: 270 TVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDYANIVTTFLSDFKKY 329
            ++  FE  FLRIR++EIFDICV++YP+SK T++EL+ ++   K   NI+   LS+F+  
Sbjct: 245 VLYKYFEKQFLRIRSEEIFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLK 304

Query: 330 ILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHXXXXXXXXXXXX 389
           +LN SI T   L+ Y+KT+K+ L+LDPT R L S T+F  PY Q++              
Sbjct: 305 VLNLSIPTCTILIAYIKTVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDL 364

Query: 390 PEEELKEKITFKVDIKALISLVDTLHDSDIS---QFTNVMKRNKNKKGPFLWNLKVKGKN 446
             +++K     KVD   L  L + L +S       F++V   +  + G    N+      
Sbjct: 365 RTDDIKTNPIVKVDQNLLKLLSEELRESHFGINLNFSDVDISDNLENGNNNKNISQLDYA 424

Query: 447 GPSPTSQTMIYQHILNYYLTWVPEPNDMIPGSVKSSCIKTNLFEVLLDLXXXXXXXXXXX 506
           G    S  ++Y  ILN  LTW+PE   + P        K NL ++L  +           
Sbjct: 425 GQE--SSQLLYSQILNRALTWLPESKLVSPNKSIKMMRKKNLLDILFAIFDDHELFLKRF 482

Query: 507 XNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETT---APS 563
             LL  +LF +K Y L++ W QCL+L + K           +  N +   P +T     +
Sbjct: 483 VELLKQKLFVIKGYNLEESWVQCLRLFKTK-----------FSPNSLDDAPTSTNLETLT 531

Query: 564 ADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYWKYNCDMQSSNEL 623
            + D   + +IDVMLWD++ S++L  +MH +  LD  I  K IS LYW+Y  DM++    
Sbjct: 532 GNNDSMYMTNIDVMLWDMRGSKKLTEQMHLIDELDNRINLKIISSLYWQY--DMKNEKRK 589

Query: 624 TFHLPIH-----LKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSL 678
           T++  ++     L  +L KYS +YS+LKPGR L L  DQ  +EI+ NF+D R +  + + 
Sbjct: 590 TYYGLLNKMDQTLFNQLDKYSKLYSRLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTF 649

Query: 679 EQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVI------------ 726
           E    I  F   +  S S TLE+LS   +     L   L FW+ + ++            
Sbjct: 650 ENYMSICPFLENEGTS-SYTLEELSIITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEY 708

Query: 727 -------------SKENGVYSVIENCETDFDKVHK-----DIPMETENNNRGLRNESEAE 768
                        +  N V S+  N    F  + K     D P + EN  +   +  +  
Sbjct: 709 LDRSEIIIESPESNNVNSVMSITNNPLNGFAILGKGNDTIDRPSQ-ENITKCTPDHDKTF 767

Query: 769 RKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALAD 828
                 + +   ++  +L NLG   + K+++ L+ T   D    +VS   LE  ++ L +
Sbjct: 768 NATSQEVSKIKEYVLSILTNLGEQNIEKLYNVLQ-TTSHDTAIKKVSSVTLENIVTELVE 826

Query: 829 EGRLKYIANGSYEI 842
            G++  + NG Y++
Sbjct: 827 NGQILCLPNGLYQL 840

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  442 bits (1136), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 255/730 (34%), Positives = 411/730 (56%), Gaps = 50/730 (6%)

Query: 30  IADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSIV 89
           I+D+L +LLIW  PNDP SNH L PP+L++K IIK + P+S              SNSI 
Sbjct: 29  ISDELETLLIWLDPNDPNSNHHLHPPTLQLKTIIKQITPSSDIYK--------DPSNSIK 80

Query: 90  NEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPIFD 149
           N           + + LK +Y++QVR +FF   +NI   KD+ + E YY+FPL+++P+F 
Sbjct: 81  N----------NIQNWLKLFYVYQVRTYFFKKIDNIRQYKDMIKLEKYYQFPLQFIPLFT 130

Query: 150 LDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDFDLADNLIQWLNSADGSLSS 209
                W  EL SLRHY+L++N +F   +   L +LI ++DF+ + +++ W+   D +L S
Sbjct: 131 FQ--EWCFELLSLRHYILHQNKEFTQKIILELRQLIKEEDFETSLDIVTWIREVDSNLLS 188

Query: 210 MELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCPEDDHELTT 269
              I++ L  KI  +CE TM G W +R+++MET+N F+  YW  F++L+ C ED+H++T 
Sbjct: 189 ENFILDILLEKITLYCEQTMKGNWTRRYLVMETYNTFMMNYWLNFTQLLNCKEDNHKITN 248

Query: 270 TVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDYANIVTTFLSDFKKY 329
            +F  FE  F++IR +EIF IC+L+YP++K TLLEL+ ++  +  +  +V  FLS F++ 
Sbjct: 249 ILFKYFEKQFIKIRIQEIFKICILSYPDTKPTLLELRNLLVTYNFFQKLVVNFLSAFERI 308

Query: 330 ILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHXXXXXXXXXXXX 389
           +L P+I T+D LL Y++T+K+F +LDP+GR L+SIT ++ P+F+ERK             
Sbjct: 309 VLTPTINTIDCLLAYIRTVKSFQILDPSGRYLYSITNYINPHFRERKMLAPILLHAILAL 368

Query: 390 PEEELKEKI-TFKVDIKALISLVDTLHDSDISQFTNVMKRNKNKK-----GPFLWNLKVK 443
           P+ +L+  I   KV   +L  +++ L D ++       K+N  KK      P  +N    
Sbjct: 369 PKIDLENAIYPIKVSSISLKLIINELEDPELGIENTSTKKNSIKKFNEILSPKRFNNHNS 428

Query: 444 GKNGP--------SPTSQTMIYQHILNYYLTWVPEPNDMIPGSVKSSCIKTNLFEVLLDL 495
            +  P          ++ T++ Q ++  +LTWVP PND+     K     TNL ++LL++
Sbjct: 429 SEYLPDLLQNTSSEDSNSTLLVQKVVKQFLTWVPIPNDIATNDTKKLYSSTNLLDILLNI 488

Query: 496 XXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILG 555
                        LL+ RL   K YKL+ KW  CL+L+R+     R +S  +  TN  L 
Sbjct: 489 FESKEFLLTEFSKLLSKRLLITKNYKLEGKWGACLQLLRK-----RFSSGSDNYTNTNLA 543

Query: 556 LPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYWKYNC 615
             +      +   +N+N   VML D+  S ELC+  H   G++  ++PKFIS  YW    
Sbjct: 544 DTDNLVNGENLKITNMN---VMLSDLNYSSELCKIFHHANGVNTRVYPKFISSHYWVDLD 600

Query: 616 DMQSS---NELT--FHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGR 670
           D   S   NE T  F +P  L    ++Y+ +Y  L  GRK+ +  ++G +EI+L+F+DGR
Sbjct: 601 DENVSNGPNEETNHFQIPPSLLGYFEEYAKLYEDLNEGRKVDIWPNEGVIEIKLSFEDGR 660

Query: 671 KLVLDVSLEQCSV---INQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVIS 727
            L +D +L Q ++   I + ++    +   T+ +LS  LN++   +  L+DFW++K V+ 
Sbjct: 661 VLEIDATLPQYALLQYIQEKNAIMQNNQGFTVNELSVPLNLSLQNVTELVDFWLKKNVLK 720

Query: 728 KENGVYSVIE 737
           K +  YS++E
Sbjct: 721 KVDDKYSILE 730

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score =  423 bits (1087), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 262/820 (31%), Positives = 433/820 (52%), Gaps = 75/820 (9%)

Query: 31  ADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSIVN 90
           A++ N LL W  P   K NHQL+PP+L +K +I+ L   S                    
Sbjct: 27  AEEWNVLLQWLDPA-GKKNHQLKPPNLLVKTMIEKLLLGSND------------------ 67

Query: 91  EGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPIFDL 150
                     QLLS +++YY +Q R +F++ ++ I  L +++R E +  FPL+Y+PIF+ 
Sbjct: 68  ---------YQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEG 118

Query: 151 DINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDFDLADNLIQWLNSADGSLSSM 210
           + N    E+    +YLL  N K  +    RL   +++DDF+LA  ++ + +       S 
Sbjct: 119 N-NRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEIVDYFDYCQT--DST 175

Query: 211 ELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCPEDDHELTTT 270
            ++++ + +KI +FC+   +  WNKR++IMETFN+FI+QYW Q S L+ C ED+H +T T
Sbjct: 176 SIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNT 235

Query: 271 VFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDYANIVTTFLSDFKKYI 330
           ++  FE  F+ IRT EIFDIC+    + + TLLEL+K +    D+  +V   LS F   +
Sbjct: 236 LYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKV 295

Query: 331 LNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHXXXXXXXXXXXXP 390
           +NPSI T DAL  Y++TIK F +LDP+GR L +I+++VKP+F++RK              
Sbjct: 296 INPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLD 355

Query: 391 EEELKEKITFKVDIKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKVKGKNGPSP 450
           E +    +  +V  + L +L + L D++I  +T   + + +   P + +         S 
Sbjct: 356 ETDQLNTMPSQVSEEKLTALTNELKDTEICSYT---EESDDVVDPMIGSF--------SK 404

Query: 451 TSQTMIYQHILNYYLTWVPEPNDMIPGSVKSSCI---KTNLFEVLLDLXXXXXXXXXXXX 507
              +M+ + ++  Y+ W+PE    +P S     +   K +LF++LL+L            
Sbjct: 405 EEDSMVLEQVIKRYMEWIPE----VPTSFGKGILSDHKLDLFDILLELLESKETLVIEFK 460

Query: 508 NLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTAPSADAD 567
           NLLT +L  L+ Y LD KW++ L L++++                      +T    + D
Sbjct: 461 NLLTKKLLDLRGYTLDKKWSKFLSLLKKRFDN------------------RSTETMDEED 502

Query: 568 QSNLNSIDVMLWDIKCSEELCRKMH-EVAGLDPAIFPKFISLLYWKYNCDMQSSNELTFH 626
            +N+N+ID+ML DI  S ++   M  ++   +  ++PK +S LYW  N D QS     F 
Sbjct: 503 LNNINTIDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAG-DFE 561

Query: 627 LPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVINQ 686
           +   L+  L+ YS  YSQ + G+KL+L +D G V + L+F DGR +    SL Q SV+  
Sbjct: 562 MDGELEHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTL 621

Query: 687 FDSTDNKS----ISLTLEQLSDSLNITPPRLVHLLDFWIQKGVISKENGVYSVIENCETD 742
           F S  + S      LT+ +L     +   ++  +L +W+ K V+   +G Y  +E     
Sbjct: 622 FKSPKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWK 681

Query: 743 FDKVHKDIPMETENNNRGLRNESEAERKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLK 802
            D  +  IP   E +   +   S+ E K E  ++R+LP+I+ +L NLG +K++K+H+ L+
Sbjct: 682 GDSTYAAIPDVLEES--VVERSSQHEDKQENHVERALPYIKDILLNLGTLKIDKLHALLQ 739

Query: 803 ITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYEI 842
             +PKD  Y+ V+ +QL+ YL  L +EG L   +N SY++
Sbjct: 740 SAMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKL 779

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  378 bits (971), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 287/883 (32%), Positives = 434/883 (49%), Gaps = 122/883 (13%)

Query: 14  ITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSAST 73
           ++DE Q L   + +   A+DL+ LL+W SP    + HQ +PPSLRIK  I+         
Sbjct: 1   MSDE-QILHMMLPNAKFAEDLDRLLLWLSP----AEHQCKPPSLRIKKSIQ--------- 46

Query: 74  SPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHF-ENINYLK--D 130
               +    Q S+   N               L + YI  +R+ F S+  EN N LK  D
Sbjct: 47  ---RIRECFQLSSDFTN--------------CLVKLYIDLIRFEFISYMKENANCLKFND 89

Query: 131 IQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDF 190
           + + EN  E P  ++P  + +   +   L+ LRHYLL+ +  FK  L T ++ LIM+DDF
Sbjct: 90  VLKLENRIEHPRLFIPELEFE---YFKNLHMLRHYLLDSDKSFKTALCTSIENLIMEDDF 146

Query: 191 DLADNLIQWLNSADG-SLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQ 249
             A  ++ W++SA    LS  +L+++ L  KI   C  ++ G W +RF+++ETFN FI  
Sbjct: 147 YSATIILDWIDSAYSIDLSPKDLVLDMLVKKIAGICSGSIRGSWTRRFIVIETFNDFIEV 206

Query: 250 YWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIM 309
           YWS F++L+ CPE+DHELT TVF CFE  F+ IR  EIF+I   AYP SK T+LEL+K+M
Sbjct: 207 YWSHFAQLLKCPENDHELTKTVFKCFEREFINIRINEIFEIFTSAYPESKPTILELRKVM 266

Query: 310 KDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVK 369
           K  KD   +  TFL  FK  +LNP +TT+DAL  Y+K IK FL+LDP GR L+ +TTFVK
Sbjct: 267 KAPKDLQRLTYTFLDTFKDEMLNPCVTTIDALTSYLKAIKGFLLLDPAGRYLNLVTTFVK 326

Query: 370 PYFQERKHXXXXXXXXXXXXPEEELKEKITFKVDIKALISL----VDTLHDSDISQFTNV 425
           PYFQ++                 +LK K    ++I  +  L    +D   D + S   NV
Sbjct: 327 PYFQDKSDLINILLYAIL-----DLKPKDFEDLNISYIPGLNKLSLDMREDPEFS-IENV 380

Query: 426 MKRNKNKKGPFLWNLKVKGKNGPSPTSQTMIYQHILNYYLTWVPEP------NDMIPG-- 477
              + N K   + NL+  G N       T+I  HI+  ++ WVPEP      ND   G  
Sbjct: 381 EPNDNNYKRT-VPNLESIGANSLHDKG-TLIQDHIMKQFMMWVPEPNMNNLENDHDNGND 438

Query: 478 ---------SVKSSCIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQ 528
                    +V S     NL ++LLDL            NLLT + F L+ Y++D  W +
Sbjct: 439 FEEDNNDVTAVNSIFYNVNLLDILLDLFESKEIFIGKFVNLLTIKFFKLQNYRVDPNWQK 498

Query: 529 CLKLIR-----------EKVVKFRETSHVNYITNGILGLPETTAPSADAD--QSNLNSID 575
           CL+LI            EK+ +      VN      +     T  S D +  Q +LN I+
Sbjct: 499 CLELINSKFNSSNISMDEKMEEDVAIGTVNPTNENYVDEKRKTNASNDMEEIQISLNKIE 558

Query: 576 VMLWDIKCSEELCRKM------HEVAGLDPAIFPKFISLLYWKYNCDMQSSNELTFH--- 626
           VML DI+ SE+   ++      + +   +  I PKFIS LYW Y       NEL  +   
Sbjct: 559 VMLNDIRHSEKFSFQISSELNRYGLRSNNVGIKPKFISPLYWDY-----EDNELGVNNFL 613

Query: 627 ----LPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCS 682
                     K + +Y+  Y  +  G  L  CK +  +E+E++F DG      V+  Q  
Sbjct: 614 KENVFDEECTKAILQYASEYCSINKGFALHYCKGKEMIEVEISFNDGAIKGFLVNASQYY 673

Query: 683 VINQFDSTDNKSISLTLEQL--SDSLNITPPRLVHLLDFWIQKGVISKENGVYSVIENCE 740
           V+  FD+ + K   LT+E +  +     +   ++  L FW++K V+  E G Y       
Sbjct: 674 VLTLFDTGNEK---LTIESILTAGEAKRSKNEIIDALKFWVEKNVLVYEGGYY------- 723

Query: 741 TDFDKVHKDIPMETENNNRGLRNESEAERKCELTLQRSLPFIEGMLANLGAMKLNKIHSF 800
                  +D  + +  N++G    +   R  +L ++ +LP+I+ ML + G +  ++I +F
Sbjct: 724 -----YSRD--LHSIENSKG----NTTTRTDDLLVKEALPYIKTMLESFGNLSASRIQNF 772

Query: 801 LKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYEIV 843
           LK T+P     + + +  +   L  L  +G L   ++GSY++ 
Sbjct: 773 LKATLPAAQDSDHI-ITDIHSVLDTLVSDGILFKNSSGSYKLA 814

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score =  364 bits (935), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 271/878 (30%), Positives = 431/878 (49%), Gaps = 120/878 (13%)

Query: 10  DLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPN 69
           DL  I   L+      FH      L SLL+W  PN  K   Q +PP+L +K+ I +L   
Sbjct: 6   DLPTIITSLREQVERQFHP----QLESLLLWLDPNSSKGTRQNKPPTLELKDCINLLRAG 61

Query: 70  SASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLK 129
            +    + +                           L+EYY++ V++HF  + + I+ LK
Sbjct: 62  YSQDEKFKM--------------------------WLREYYLYVVKFHFMKNVDEISVLK 95

Query: 130 DIQRWENYYEFPLRYVPIFD-LDINGWSLELNSLRHYLLNRNMKFKNNLRTRL-DKLIMD 187
           D +  E  Y +PL+++ + D  DI+     + S +HYL+++N+ F+ NL T+  D  ++ 
Sbjct: 96  DFKLLEMIYIYPLQFMDLVDSTDISNL---VKSFKHYLIDKNVTFRKNLITKFKDCFLVG 152

Query: 188 DDFDLA------DNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIME 241
           + F+          +I W+  ++G LS+ +LI++A   KI  F  + M G  N++F++ME
Sbjct: 153 NQFEFEYEFANIVEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQKFIVME 212

Query: 242 TFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVT 301
           TFNKFI+ YW   ++LIG  EDDH+LT  ++  FE  F++IR +EI  I V  YP +K T
Sbjct: 213 TFNKFIDIYWKNLTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPT 272

Query: 302 LLELKKIMKD-------------FKD--YANIVTTFLSDFKKYILNPSITTVDALLRYVK 346
           +LELK I+                KD     ++  FL  FK+  LNP I T+D L  YVK
Sbjct: 273 ILELKSILSKQNSSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVK 332

Query: 347 TIKAFLVLDPTGRCLHSITTFVKPYFQERKHXXXXXXXXXXXXPEEELKEKITFKV---D 403
             K+FL+LDP+G  L+SI  FVKPY +                 E E+ + + + +    
Sbjct: 333 ATKSFLLLDPSGSLLNSIVIFVKPYLRSN---------------EVEMVDILLYALLNLK 377

Query: 404 IKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKVKGKNGPSPTSQ----TMIYQH 459
            K LI L       D+     + K   N       ++  K K  P  T++    T+ Y+ 
Sbjct: 378 SKDLIELNCEKTTYDMRSIELLSKELSNDHSKHAGDVDYK-KFSPEGTNEFENSTLPYEQ 436

Query: 460 ILNYYLTWVPEPNDMIPGSVKS-----SCIKTNL--FEVLLDLXXXXXXXXXXXXNLLTD 512
           +   +L W P    + P S  S     + +  N+   + + +              LLT 
Sbjct: 437 VYTDFLNWKPS---ITPISESSNDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTI 493

Query: 513 RLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTAPSADADQSNLN 572
           +L  +K Y+++D+W +CLK++++KV     TS  N + +             ++  S++N
Sbjct: 494 KLLHMKGYEVEDRWQKCLKILQDKV-----TSDKNIVND-------------ESITSDIN 535

Query: 573 SIDVMLWDIKCSEELC-RKMHEVA-GLDPAIFPKFISLLYWKYNCDMQSSNELTFHLPIH 630
           +I +ML DI  S+E    K+ E     +  +FPKFIS LYWK+    +  +E  F L   
Sbjct: 536 TILIMLHDISISKESSNEKISEFQNSSEMQLFPKFISKLYWKF----KRQSEYQFPLDSK 591

Query: 631 LKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVINQF-DS 689
           L+K+L KY   Y    PG KL+L    G   + L FKDGRKL +D + EQ +V++ F + 
Sbjct: 592 LRKKLSKYMKSYHHSHPGMKLKLVNGTGICSLNLTFKDGRKLSVDATFEQYTVLSAFHND 651

Query: 690 TDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVISKENGVYSVIE---NCETDFDKV 746
            D+ S  L++ QLS  L + P R+   L FWI K V+  +N  Y++ E   N E      
Sbjct: 652 KDDSSQVLSINQLSTMLKMDPERVRAHLQFWINKKVLCHQNDYYTIQEYLNNQELSSGPT 711

Query: 747 ---HKDIPMETENNNRGLRNESEAERKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLKI 803
                 +P+  E         +      +  L R  P+I  M  NLG++K++KIHSFL +
Sbjct: 712 VITSSILPLSQERMPFKRSVPTNVLNDPKEILHRVYPYINDMFTNLGSLKVDKIHSFLNM 771

Query: 804 TVPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYE 841
           +VP+   Y++V++ QLE YL  L +E +L  + +GS++
Sbjct: 772 SVPRGLHYSKVTVTQLEAYLDQLVEEEQLIVLPDGSFK 809

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score =  312 bits (799), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 217/727 (29%), Positives = 358/727 (49%), Gaps = 84/727 (11%)

Query: 29  TIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSI 88
           ++ D++ ++L W  PND  +NHQ+RPPSLRIKN I++L               G+ +   
Sbjct: 24  SLKDEIEAVLEWMDPNDDHNNHQMRPPSLRIKNSIRLL-------------RLGEQA--- 67

Query: 89  VNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPIF 148
              G T        +  L++  + Q+R HFF H+E +    D+ + E YYEFPLRYV +F
Sbjct: 68  --PGTT--------VGLLRQCAVSQMRQHFFRHWERLEQYTDMVKLERYYEFPLRYVAVF 117

Query: 149 DLDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIM-DDDFDLADNLIQWLNSADGSL 207
             D    + EL  LR YLLN N  F+ N+  R+  LI+ DDDF+ A  L +W+    G  
Sbjct: 118 TED--EVAAELVGLRKYLLNGNPGFRANMEARIRALILQDDDFETAARLYKWIVQGLGH- 174

Query: 208 SSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCP-EDDHE 266
             ++ ++  L  KI  FC + M G  ++R++IME FN FI + W+QF +L+  P  DD E
Sbjct: 175 PMVKFVIEVLTQKIALFCRNRMDGNVDQRYLIMEVFNSFIARCWAQFIQLLQFPTADDPE 234

Query: 267 LTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMK-DFKDYANIVTTFLSD 325
           L   ++ CFE  F+ ++T+E+F   +  +P SK  LLE+K ++K D  +   +V    +D
Sbjct: 235 LNNLIYRCFEKKFIELKTQELFHQIIPKFPMSKPALLEMKSVIKGDTAELDRLVAQIYND 294

Query: 326 FKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHXXXXXXXX 385
           F K +L PS+TTV+ LL YVKTIK  +V+DPTGR ++  T+ +KP  +ER          
Sbjct: 295 FHKELLVPSVTTVEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPKIKERSDLIISVLCA 354

Query: 386 XXXXPEEELKEKI---TFKVDIKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKV 442
                 +E+ E I   T   + + L  L   L +S    F + M  +K K    ++++  
Sbjct: 355 ILELDSDEIHEVISKNTLTENPQLLSQLSKELKNSTALTFHS-MSTSKGKAA--IYSVAF 411

Query: 443 KGKNGPSPTSQTMIYQHILNYYLTWVPEPNDMIPGSVKSSC----------IKTNLFEVL 492
           + ++             ++  +L W PEP        K+            +  ++ EV+
Sbjct: 412 ERQD------------QLVKQFLEWTPEPGPFTADDAKALNSDDDGAETLELPKDVLEVV 459

Query: 493 LDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNG 552
             +             L+T+ +  +  Y L+ KW+Q LK + +K           Y  N 
Sbjct: 460 FQVFDSPEVLINEFIQLVTNHMLQMDGYVLNAKWSQLLKTVMKK-----------YFKNN 508

Query: 553 ILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYWK 612
              L       +  ++SNL ++ VM  D++ S        ++  + P ++PK IS LYWK
Sbjct: 509 KQVL------KSMCEESNLVNVFVMWSDLEKSATFQTWSTKLQLVPPNVYPKIISYLYWK 562

Query: 613 YNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKL 672
                + S    + +   L     +    +    PGRKL+  KDQG V+++L F+DGR  
Sbjct: 563 IG---RRSPYGDYAVAPGLAAIFDQMEKAFETRSPGRKLRFQKDQGSVDLQLVFEDGRHW 619

Query: 673 VLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVIS-KENG 731
              VSL + +VI+ F     ++  L++  ++   N++P  +  ++ FW  + V+   +N 
Sbjct: 620 SSRVSLPKYTVIDLF---QRQACPLSVTDIAAHTNMSPRLVEDIIQFWCHEHVLHLNKND 676

Query: 732 VYSVIEN 738
           +Y ++EN
Sbjct: 677 LYEILEN 683

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score =  304 bits (778), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 221/733 (30%), Positives = 359/733 (48%), Gaps = 85/733 (11%)

Query: 29  TIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVNTGQTSNSI 88
            + DDL +LL W +PND  +NHQ+R PSLRIKN IK+L  + A                 
Sbjct: 24  ALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKLLKLDDAE---------------- 67

Query: 89  VNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQRWENYYEFPLRYVPIF 148
                     Q+ LL  L+++ + Q+RYHFF ++E++   KD+ R E YYEFPL+YV +F
Sbjct: 68  ----------QVFLLQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFPLKYVGLF 117

Query: 149 DLDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMD-DDFDLADNLIQWLNSADGSL 207
             +    S EL  LR YLLNRN  F+NN+ +R+  LI++ DDF+++  L +W+    G  
Sbjct: 118 TAE--ELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWMVQGLGH- 174

Query: 208 SSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLIGCP-EDDHE 266
             ++ +++ L NKI  FC+  M G  +++ +I E FN FI++ W+QF +L+  P EDD E
Sbjct: 175 PMVKFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQFPNEDDQE 234

Query: 267 LTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDF-KDYANIVTTFLSD 325
           L   ++ CFE+ F+ ++TKE+FD  +  +P SK +LLE+K ++K   ++   +V    +D
Sbjct: 235 LNNLIYRCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRLVAQICND 294

Query: 326 FKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHXXXXXXXX 385
           F   +L PS+TT++ LL YVK IK  +V+DPTGR ++  T  +KP  +ER          
Sbjct: 295 FHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDLITTVLCA 354

Query: 386 XXXXPEEELKEKI---TFKVDIKALISLVDTLHDSDISQFTNVMKRNKNKKGPFLWNLKV 442
                ++E+ E I   T   + + L  L   L +S    F +V                +
Sbjct: 355 ILELTKDEIHEVISKNTLTENPQLLDQLSKELKNSTALNFHSVT--------------TI 400

Query: 443 KGKNGPSPTSQTMIYQHILNYYLTWVPEP-----------NDMIPGSVKSSCIKTNLFEV 491
           K K      +Q      ++  +L W PEP           N+    + ++  +  ++ EV
Sbjct: 401 KSKAAIYSVAQER-QNPLVKQFLEWTPEPGPFNEDISKLGNNDTDDTTETLELPKDVLEV 459

Query: 492 LLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITN 551
           +  +             L+T+ +  ++ Y L  KW+Q LK + +K           Y  N
Sbjct: 460 VFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKK-----------YFKN 508

Query: 552 GILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYW 611
               L       +  ++SNL ++ VM  D++ S        ++  +   ++PK IS LYW
Sbjct: 509 NKQVL------KSICEESNLVNVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLYW 562

Query: 612 KYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRK 671
           K +   + S    + +   L    Q+    +    PGRKL+   DQG VEI L F DGR 
Sbjct: 563 KIS---RKSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRH 619

Query: 672 LVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVI-SKEN 730
               VSL + +VI  F        +  + Q +D   +    +  ++ +W Q+ V+ S  +
Sbjct: 620 WSNKVSLPKYTVIELFQKVPRGLRTADIVQQTD---MAQHHVEAIVQYWCQEHVLYSTGD 676

Query: 731 GVYSVIENCETDF 743
             Y ++E  +  F
Sbjct: 677 DCYRILERADVAF 689

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  305 bits (782), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 235/830 (28%), Positives = 395/830 (47%), Gaps = 92/830 (11%)

Query: 21  LSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSASTSPYSVVN 80
           L  Y+      DDL  ++ W  P      H   PPSLR+K  I+ +              
Sbjct: 12  LKRYLATEQEQDDLERVMGWIHPQ----AHACHPPSLRMKKAIRSVL------------- 54

Query: 81  TGQTSNSIVNEGNTNKELQLQLLSTLKEYYIF-QVRYHFFSHFENINYLKDIQRWENYYE 139
            G+ S         +++ ++  +  +K+ Y+  QV+  F          K IQ  E+   
Sbjct: 55  -GKASE-------LDRQFKIYYIDVIKQEYLCDQVKREF----------KHIQVLESKLV 96

Query: 140 FPLRYVPIFDL-DINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDFDLADNLIQ 198
           +P+ Y+P   + D       + SLRHYL++ +   +N+L    + L+ DDDF+    +I+
Sbjct: 97  YPVTYLPFLSISDQLAIEQTICSLRHYLVDNDDNLRNSLVAEFETLMQDDDFESGYQIIE 156

Query: 199 WLNSADGSL-SSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKL 257
           WL +A+  L     L ++ + +KI+  C++ M   W  +F++M TFNKFIN YWS  +K 
Sbjct: 157 WLYTANAKLLRPWNLALDTIVSKISTLCDNEMRRNWEAKFLVMNTFNKFINLYWSHLAKF 216

Query: 258 IGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDYAN 317
           +   ED+H+ T  ++ CFE  F+RIRT+EIF+I V +Y  +K T+LEL+  M  ++  + 
Sbjct: 217 LHLSEDNHDFTKVLYKCFEKEFVRIRTEEIFEIVVESYQAAKTTILELRTFMSGYERLSK 276

Query: 318 IVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKH 377
           +V  FL  FK  +LNPS+ TV+AL+ +++++K F++LDP  R +H+IT FVKP+F +R  
Sbjct: 277 LVNQFLKQFKIKVLNPSVNTVEALVAFIRSVKCFVILDPRARHMHTITNFVKPFFHQRGD 336

Query: 378 XXXXXXXXXXXXPEEELKEKITFKVDIKALISLVDTLHDSDISQFTNVMKRNKNK----- 432
                          +L++    K+ +  +  L +  H+     + N+  + +       
Sbjct: 337 AVQIILYAIL-----DLRDVDFEKMGVSPVKGLSELSHELREDPYVNINAKCQTPTPSPS 391

Query: 433 --KGPFL---WNLKVKGKNGPSPTSQTMIYQHILNYYLT-WVPEPN----DMIPGSVKSS 482
               P L    ++ V  K     T   ++Y+ +LN +      E N    D +  +VK S
Sbjct: 392 KISSPHLNDSSSMDVDDKLDDGTTD--LVYKQVLNQFXXRGHHETNQGTRDYVGVNVKFS 449

Query: 483 --CIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKF 540
               +TNL + L +L             LLT +LF L  Y L+  W +C +LI+ KV K 
Sbjct: 450 QRSNRTNLLDPLFELFDKKDELLSCFLKLLTLKLFKLSGYTLEPNWNECYQLIKRKVTKG 509

Query: 541 RETSHVNYITNGILGLPETTAPSADADQS---NLNSIDVMLWDIKCSEELCRKMHEVAGL 597
                 +    G L      AP +  ++    +LN IDVML D++ + ++ R++H  + L
Sbjct: 510 ------DVGDGGPLSRDTADAPVSSNNEQVLLSLNKIDVMLHDLRENAKITRRLHRTSML 563

Query: 598 DPAIFPKFISLLYWKYNCD--MQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQLCK 655
           +  +FPKFIS  YW Y  D   ++ N     +   L+ ++ +Y   + +LK GR ++LCK
Sbjct: 564 NGNVFPKFISSQYWSYRDDTFTKAGNRDQIKIDPVLETDILQYGGRFCELKYGRMVRLCK 623

Query: 656 DQGKVEIELNFKDGR-KLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLV 714
           ++   EIEL   DG    V  V   + SVI ++ +T       T  +L +   +    + 
Sbjct: 624 EKTIFEIELTVNDGEVPQVFKVDAMKYSVIEKY-ATGGPRAGYTPTELCELCGMDIADVQ 682

Query: 715 HLLDFWIQKGVISKENGVYSVIENCETDFDKVHKDIPMETENNNRGLRNESEAERKCELT 774
             L +W+  G++   +  Y         ++   +  P      NRG   E+      +  
Sbjct: 683 TSLTYWVNAGLLRLSSSGY---------YESTSETGPPP----NRGTPLEASTREFLDGV 729

Query: 775 LQRSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNR-VSLQQLEQYL 823
           +     FI GML +LG +   +IH +L  TVP    Y   V++ QL+ YL
Sbjct: 730 V---WTFIRGMLESLGTLSCAEIHEYLAATVPATIRYQETVTMLQLQGYL 776

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score =  280 bits (717), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 191/526 (36%), Positives = 287/526 (54%), Gaps = 35/526 (6%)

Query: 331 LNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHXXXXXXXXXXXXP 390
           +NPSITTVDAL+ YVKT+K+FL LDP+G+ LHSI+TFV PY QER               
Sbjct: 1   MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERNDLVSVLLYAILDLQ 60

Query: 391 EEELKEKITFKVDIKALISLVDTLHDSD--ISQFTNV-MKRNKNKKGPFLWNLKVKGKNG 447
            E  +E+    +D  +L+ L D L D +  I    N+ + +N+    P         K+G
Sbjct: 61  SENFQEEAQNILDADSLVILSDELRDPEFGIEGELNIDLDKNELTGQP-------SNKSG 113

Query: 448 PSPTSQTMIYQHILNYYLTWVPEPNDMIPGSVKSSCIKTNLFEVLLDLXXXXXXXXXXXX 507
            S    +++Y+ ++   L WVPE + +     K   ++ NL ++LL++            
Sbjct: 114 DS----SLLYRQVITQMLNWVPESSKIDSKRQKMIGLRKNLLDILLEIFENNEVFIAEFL 169

Query: 508 NLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLPETTAPSADAD 567
            LLT +L  LK+YKLD +W++CLKL++E   KF+  S       G   +         +D
Sbjct: 170 KLLTKKLLKLKYYKLDSRWSKCLKLLKE---KFKGNSA------GTTSISTNIGNVTGSD 220

Query: 568 QSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPKFISLLYWKYNCDMQS--SNELTF 625
              +N+IDVMLWD+K S +L  +MH++ GLD  I PKFIS LYW    + +S  +N    
Sbjct: 221 LVYINNIDVMLWDLKTSGDLTSRMHQIEGLDRRIQPKFISSLYWDQAKESKSKGNNAKQT 280

Query: 626 HLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVIN 685
            +   L  +L+KY  VYS+LKPGR L L KD G VE+E  F+DGR +  D +LEQ ++IN
Sbjct: 281 QIDPLLSTQLEKYIRVYSELKPGRTLHLLKDHGTVELEFTFEDGRTISCDATLEQSNIIN 340

Query: 686 QFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVISKENGVYSVIENCETDFDK 745
            F    +++  L+LEQL     I    L  +L FW+ + V+  +  +Y ++E  +     
Sbjct: 341 YFSEAVSEN-GLSLEQLHILSGIESTGLKKILQFWVDEKVLYFDGQLYRILEYLDQPEII 399

Query: 746 V----HKDIPMETENNNRGLRNESEAERKCEL-----TLQRSLPFIEGMLANLGAMKLNK 796
           V    H    ++ E     L + S      ++     TL    P+I+GML NLG++KL K
Sbjct: 400 VQSLTHTGEVLKEEQKLNPLSSSSITSDIDQMNKIHETLNNVWPYIKGMLTNLGSLKLEK 459

Query: 797 IHSFLKITVPKDWGYNRVSLQQLEQYLSALADEGRLKYIANGSYEI 842
           IHSFL+ TVPKD  YN +++  LE YL++L ++  L+ +A+GSY +
Sbjct: 460 IHSFLRATVPKDVNYNSITVSSLEVYLNSLVEDDVLELLASGSYRL 505

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score =  284 bits (727), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 251/873 (28%), Positives = 409/873 (46%), Gaps = 158/873 (18%)

Query: 96  KELQLQLLSTLKEYYIFQVRYHFF--SHFENINYLKDIQRWENYYEFPLRYVPIFDL-DI 152
           K+ Q++LL   K+YY F ++ HF   +  +N+  +++  + EN Y  PLR+   +DL D 
Sbjct: 67  KDDQIRLL--FKKYYSFVIKLHFMKDNRPKNMTSIREFHKLENLYLTPLRFT--YDLIDT 122

Query: 153 NGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIM-DDDFDLADNL------IQWLNSADG 205
           N     +N  + YL+N N  F+ N+   ++ L + +D F+   N+      + WLN A+G
Sbjct: 123 NEMQSLINIFKRYLINNNFTFRKNVLHSMETLFLTEDQFEFQYNMNSLNEIVIWLNDANG 182

Query: 206 SLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYWSQFSKLI------- 258
           ++S ++L+++ L  KI KFC+  M+G+WN RF+IME FN FINQYW   SKL        
Sbjct: 183 NVSPIDLLLDLLLRKIEKFCQREMAGLWNGRFIIMEKFNLFINQYWKLISKLFHHQQFDY 242

Query: 259 GCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIM--------- 309
           G  E+DH LT  ++  F   F++IR  E   I V  +P S  T++ELK ++         
Sbjct: 243 GDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPISTPTIIELKNVLITSSMPREN 302

Query: 310 ------KDFKD------YANI-VTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDP 356
                   F+D      Y  + V  FL DF++  LNP I T+  +   VK   +FL+LDP
Sbjct: 303 VSTTATTTFRDTNLSEEYLKLFVKKFLKDFQRKFLNPCIPTIPLIRALVKMTNSFLILDP 362

Query: 357 TGRCLHSITTFVKPYFQERKHXXXXXXXXXXXXPEEELKEKITFKV--DIKALISLVDTL 414
            G+ L +I   +KP  Q R                E    K+   +  DI++   LV  L
Sbjct: 363 RGQLLTTIILTLKPLIQRRTTDIVNILLYAMLNLNEMELHKLGCNIDFDIESFNILVSEL 422

Query: 415 HDSDISQFTNVMKRNKNK----------KGPFLWNLKVKGKNGPSPTSQTMIYQHILNY- 463
           + + I      M +N+N            G    N ++   + P    + M   + + Y 
Sbjct: 423 YPTIIKS----MNQNQNNPSVVPYTTAGTGTTCSNERITNDDIPYQNVKDMANANTMEYL 478

Query: 464 ----------------YLTWVPEPNDMIPGSVKSSCI---------KTNLFEVLLDLXXX 498
                           YL WVP  N +   + K++ +           +  + L      
Sbjct: 479 ARRKPETKPFFDLFKQYLEWVPPMNKIYDSTSKNTVVDDEETSRIRSRHAIDYLFRFFDS 538

Query: 499 XXXXXXXXXNLLTDRLFTLK-FYKLDDKWTQCLKLIREKVVKFRETSHVNYITNGILGLP 557
                     LLT++    K +Y LD+ W  CL L++EK      +S+V           
Sbjct: 539 IDLLLSEYLKLLTEKFIHSKNYYTLDNNWLWCLNLLKEK----SNSSNV----------- 583

Query: 558 ETTAPSADADQSNLNSIDVMLWDIKCSEELCR-----KMHEVAGLDPAIFPKFISLLYWK 612
               P  +  +S +N+ID+ML D+K S    +     K + +   D   +PK +S LYWK
Sbjct: 584 ----PDENV-KSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQGDIGFYPKEVSKLYWK 638

Query: 613 YNCDMQSSNELT-----FHLPIHLKKELQ------KYSDVYSQL-KPGRKLQLCKDQGKV 660
            N    +   +      FHL  + K          K +  +++L + G+K++L KD+  +
Sbjct: 639 INSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDIKLNRFFNELGRKGKKMELYKDKSLM 698

Query: 661 EIELNFKDGRKLVLD-VSLEQCSVINQFDSTDNKSISLTLEQLSD---SLNITPPRLVHL 716
           E++++F DGR+L  D +++EQ  V++ F  T  K  + TLE+  D    L     +L   
Sbjct: 699 EMKISFDDGRELFFDNITIEQYDVLSLF--TVEKGAAFTLEKAYDFFSGLKRGKQKLEEC 756

Query: 717 LDFWIQKGV--ISKENGVYSVIENCETDFDKVHKDIPMETE-----NNNRGLRNE----- 764
           + FW+ K V  +  ++G Y V+E   T  D++ +   M+ E     +   G+ ++     
Sbjct: 757 IQFWVDKKVLYLDDDDGCYKVLERL-TFLDEIKQRKKMQEETVIKSDARMGIDHDYVQEA 815

Query: 765 ----------------SEAERKCELTLQRSLPFIEGMLANLGAMKLNKIHSFLKITVPKD 808
                           S A  + +  L R  PFI GML NLG+MKL KIHSFLK+TVP+D
Sbjct: 816 AEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMKLEKIHSFLKMTVPRD 875

Query: 809 WGYNRVSLQQLEQYLSALADEGRLKYIANGSYE 841
           + YNR+++ QLE YL+ L ++ +L+   +G+++
Sbjct: 876 FEYNRIAIHQLENYLNGLVEDEKLETTTDGAFK 908

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  202 bits (513), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 188/756 (24%), Positives = 327/756 (43%), Gaps = 98/756 (12%)

Query: 16  DELQTLSSYIF---HTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVLFPNSAS 72
           DEL+ L   I     + + ++++ +L W +P       Q + P+LRIK  +KV+   S  
Sbjct: 6   DELKLLHEKILLNLASNLEEEVDMVLAWLNPT-----FQPQIPTLRIKQCLKVVLEQSDE 60

Query: 73  TSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSHFENINYLKDIQ 132
            + + +                            ++YY+  +R HFF  F++I   KD+ 
Sbjct: 61  RTRFLI----------------------------EQYYLTLIRTHFFLQFDDIVNWKDMI 92

Query: 133 RWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTRLDKLIMDDDFDL 192
           + E  Y   + +  +F   +     E+ S +  L+ +N +F+  L  +L+  I+D+D   
Sbjct: 93  KLEKLYISKVEF--MFGTSVYWIKEEMISFKRLLMKKNNEFRKQLHAKLESHILDNDLVR 150

Query: 193 ADNLIQWLNSA-DGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIMETFNKFINQYW 251
            D + QWL  A DG    +E  V  +  K+++  +  M    + R+++M T+N FI  +W
Sbjct: 151 FDQMYQWLAPAFDGQ--EIEFNVRIINLKVDQMSQKLMKNKIDDRYLVMNTYNHFIKDFW 208

Query: 252 SQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIM-K 310
           S+FSKL+   EDDHELT  ++  FE N+++ +  E +   V  +P S+  LLEL+ I+ K
Sbjct: 209 SKFSKLL-IIEDDHELTAIIYQSFEKNYIKYKCDEFYTDIVPKFPASRKCLLELRSILNK 267

Query: 311 DFKDYAN-IVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVK 369
           D K     ++ T    F    L  S+ T + L  Y+KT+K   ++DP G CL S++  V+
Sbjct: 268 DIKTVGTKVLETLYHGFVSRFLTSSLLTCEILYYYIKTVKCLKIIDPMGICLRSLSKAVR 327

Query: 370 PYFQERKHXXXXXXXXXXXXPEEELKEKITFKVDIKALISLVDTLHDSDISQFTNVMKRN 429
            Y   R                 E + KI    D         ++H   + QF+  +   
Sbjct: 328 VYLNPRPDIIKTLLLGIFPFQNNE-RFKIASSTD-------GSSVHLEKLEQFSREV--G 377

Query: 430 KNKKGPFLWNLKVKGKNGPS-PTSQTMIYQHILNYYLTWVPEPNDM------IPGSVKSS 482
               GP L    +   N P  P         +L  YL WVPEP  +         +    
Sbjct: 378 DFSMGPEL-PTALPWFNQPHLPRCTYDGDDQLLKQYLNWVPEPPRIKLDVEDFADNDGKY 436

Query: 483 CIKTNLFEVLLDLXXXXXXXXXXXXNLLTDRLFTLKFYKLDDKWTQCLKLIREKVVKFRE 542
               +L  VLLD+             +++ +    + Y LD +W + + +          
Sbjct: 437 VPPVDLIHVLLDVLESKRTLVDDLLGVVSGKFIESEEYSLDPEWQRIMDI---------- 486

Query: 543 TSHVNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPAIF 602
                 I N + G  + T  S +AD ++LN +D+ML D++ S +   ++          F
Sbjct: 487 ------ILNHLEGTRKGTVTSEEADLTHLNDVDIMLEDLRLSSQFRNQVAHKNNSHFENF 540

Query: 603 P--KFISLLYWKYNCDMQSSNELT-FHLPIHLKKELQKYSDVYSQLKPGRKLQL-CKDQG 658
           P  K +S LYW++  ++      T +     ++  +QK + VY +L  GR L+       
Sbjct: 541 PHIKILSKLYWRHYQNLNGRLVTTKYKWDSEMEPLIQKLTKVYERLNTGRTLKFDTGSSS 600

Query: 659 KVEIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSIS---------------LTLEQLS 703
           +V I +  K G +    V++EQ  VI+ F +  N   +                TL+ L 
Sbjct: 601 RVSINIVTKSGERRFFKVTMEQYLVISHFQNETNGRNAPGMMADCNYVIPERRYTLKDLH 660

Query: 704 DSLNITPPRLVHLLDFWIQKGVISKE-NGVYSVIEN 738
              ++   +++ +L FW QK +++K  +  YSV E 
Sbjct: 661 KMTSMPRQKILDILSFWQQKEIVTKHSDDSYSVQEG 696

>ZYRO0C09438g Chr3 complement(715107..717566) [2460 bp, 819 aa] {ON}
           highly similar to uniprot|Q12018 Saccharomyces
           cerevisiae YDL132W CDC53 Cullin structural protein of
           SCF complexes (which also contain Skp1p Cdc34p and an
           F-box protein) involved in ubiquitination SCF promotes
           the G1-S transition by targeting G1 cyclins and the
           Cln-CDK inhibitor Sic1p for degradation
          Length = 819

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 56/116 (48%), Gaps = 17/116 (14%)

Query: 599 PAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQ----LC 654
           P + P  ++   W +     S  ++ F LP+ L+   +K  ++YS    GR L+    LC
Sbjct: 552 PELQPFILAETMWPF-----SYQDVDFKLPLVLQHSYEKLEEMYSNKHNGRVLKWLWPLC 606

Query: 655 KDQGKVEIELNFKDGR-KLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNIT 709
           + + +  I    K GR      V+L Q S++ QF+  D     LTLEQ+ +  N++
Sbjct: 607 RGEIRAAIG---KQGRPPFQFTVTLFQMSILLQFNDND----VLTLEQIQEGTNLS 655

>AFR617C Chr6 complement(1549456..1551771) [2316 bp, 771 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL047C
           (RTT101) and YBR259W
          Length = 771

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 43/78 (55%), Gaps = 6/78 (7%)

Query: 660 VEIELNF--KDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLL 717
           +EIE  F  KD R L LDV++ Q  +++ F++ D    S++L+ +S+   I    L   +
Sbjct: 599 LEIETPFLLKDNRNLTLDVTMVQACILDMFNNQD----SVSLDDVSNKYGIQVAELKTAM 654

Query: 718 DFWIQKGVISKENGVYSV 735
           D ++   ++  E G Y++
Sbjct: 655 DSFVSINMMKCEGGQYTI 672

>SAKL0F10054g Chr6 complement(770952..773375) [2424 bp, 807 aa] {ON}
           highly similar to uniprot|Q12018 Saccharomyces
           cerevisiae YDL132W CDC53 Cullin structural protein of
           SCF complexes (which also contain Skp1p Cdc34p and an
           F-box protein) involved in ubiquitination SCF promotes
           the G1-S transition by targeting G1 cyclins and the
           Cln-CDK inhibitor Sic1p for degradation
          Length = 807

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 76/183 (41%), Gaps = 25/183 (13%)

Query: 574 IDVMLWDIKCSEELCRKMHEVAGLDPA--------IFPKFISLLYWKYNCDMQSSNELTF 625
           I  M  DI+ S++L R        DPA          P  ++   W +     S  E+ F
Sbjct: 519 ITKMFQDIRLSKQLERDFENTVKADPAYSKSKYADFQPFVLAETMWPF-----SYQEVDF 573

Query: 626 HLPIHLKKELQKYSDVYSQLKPGRKLQ----LCKDQGKVEIELNFKDGRK-LVLDVSLEQ 680
            LP  L    +    +Y+    GR L+    LC+ + K  I    K G+      V+L Q
Sbjct: 574 KLPQELVPTHEGLEKLYTSKHNGRVLKWLWPLCRGELKANIG---KPGKPPFQFTVTLFQ 630

Query: 681 CSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVISKENGVYSVIENCE 740
            +++  F    N   +LT+EQ+ ++  ++ P +   +  +I+  ++ +       +   E
Sbjct: 631 MAILLLF----NDVSTLTMEQIQEATELSTPSIASSMVPFIKSKLMQQSPPGLEALMKPE 686

Query: 741 TDF 743
           T+F
Sbjct: 687 TEF 689

>TDEL0D03140 Chr4 complement(583221..585485) [2265 bp, 754 aa] {ON}
           Anc_4.138 YGR003W
          Length = 754

 Score = 36.2 bits (82), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 64/158 (40%), Gaps = 17/158 (10%)

Query: 572 NSIDVMLWDIKCSEELCRKMHEVAGLDPAIFPK-------FISLLYWKYNCDMQSSNELT 624
           + +D ML DI  S EL R       LD A +PK        +++  W +     S  EL 
Sbjct: 473 SKLDGMLRDIGTSSELLRLFRN--SLDEAQWPKDLDFRPQILTMTSWPFQPPTNSDFEL- 529

Query: 625 FHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVI 684
             LP  L++    +   Y++    R LQ   + G +EI   F D     L + +    V 
Sbjct: 530 -QLPTELEQLKLDFESFYTRKYTERTLQWAHNLGYIEIGFQF-DASYHELSMPIPIGIVF 587

Query: 685 NQFDSTDNKSISLTLEQLSDSLNITPPRL-VHLLDFWI 721
             F+  D     LT+E + +  NI    L  HLL   I
Sbjct: 588 LMFEKYDE----LTIEMIEEQTNIPSQELHKHLLSLTI 621

>Kwal_0.70 s0 complement(30290..32608) [2319 bp, 772 aa] {ON}
           YJL047C (RTT101) - Regulator of Ty1 Transposition
           [contig 76] FULL
          Length = 772

 Score = 35.4 bits (80), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 57/114 (50%), Gaps = 9/114 (7%)

Query: 638 YSDVYSQLKPGRKLQLCKDQG---KVEIELNFK--DGRKLVLDVSLEQCSVINQFDSTDN 692
           +++ Y++ +P    +L   Q     +E+E NFK  DG  LVL+++L Q S++  F    N
Sbjct: 563 FTEFYARSEPKADKKLLTLQNTLHHLEVETNFKLDDGSYLVLELTLLQTSILELF----N 618

Query: 693 KSISLTLEQLSDSLNITPPRLVHLLDFWIQKGVISKENGVYSVIENCETDFDKV 746
           +   L+  ++   LN++   L   L+ +I+ G++       S+ E    D  KV
Sbjct: 619 EHKELSSLEIGSYLNVSGATLEVALESFIEVGLLETSEEKLSINEKFHPDKRKV 672

>TPHA0A00880 Chr1 complement(172938..175088) [2151 bp, 716 aa] {ON}
           Anc_3.151 YOL068C
          Length = 716

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 54/104 (51%), Gaps = 9/104 (8%)

Query: 256 KLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKVTLLELKKIMKDFKDY 315
           KL+G    D +L + +++C +   L++  ++  D+    + +     L+ K+IM+ FKD+
Sbjct: 261 KLMGYEIRDLDLLSRIYDCTDVQSLQLTAEDQDDVIYNNFDDP----LDQKQIMRIFKDF 316

Query: 316 ANIVTTFL-SDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTG 358
             +VT  L SDF+     P+  T  +L+  ++  K  +VL   G
Sbjct: 317 QMVVTRVLHSDFRI----PTYLTTSSLVDILERSKNIIVLTGAG 356

>Ecym_2336 Chr2 complement(652787..655114) [2328 bp, 775 aa] {ON}
           similar to Ashbya gossypii AFR617C
          Length = 775

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 659 KVEIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLD 718
           +VE    F D  K +LDV++ Q  +++ F+  D     +T++Q+S    I    L   ++
Sbjct: 604 EVETPFTFPDNSKFILDVTMVQACILDYFNDLDQ----ITVDQVSRRYGIEDFELTMAME 659

Query: 719 FWIQKGVISKENGVY 733
            ++  G++ K    Y
Sbjct: 660 SFVSIGMVKKVGNNY 674

>NCAS0A13810 Chr1 complement(2710214..2712670) [2457 bp, 818 aa]
           {ON} Anc_7.296 YDL132W
          Length = 818

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 56/116 (48%), Gaps = 17/116 (14%)

Query: 599 PAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQ----LC 654
           PA+ P  ++   W +     S  E+ F LPI L++   K   VY++   GR L+    LC
Sbjct: 556 PALQPFILAENMWPF-----SYQEVDFKLPIELQESHMKLEQVYTEKHNGRILKWLWPLC 610

Query: 655 KDQGKVEIELNFKDGR-KLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNIT 709
           + +   +I    K GR      V+L Q +++  F+ +D     LTLE + +  +++
Sbjct: 611 RGELIADIG---KPGRVPFQFTVTLFQMAILLLFNDSD----VLTLETIQEGTSLS 659

>KNAG0K01470 Chr11 (301521..309011) [7491 bp, 2496 aa] {ON}
           Anc_3.211 YBL004W
          Length = 2496

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 4/87 (4%)

Query: 122 FENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTRL 181
           F     +K+I + E  YE  L  +    +++    L LN+L  Y +   MK+K+NLR  L
Sbjct: 838 FGKFTTMKNIYKSEEVYERLLELLGSRHIEVQ--KLALNALFGYRIPALMKYKDNLRNLL 895

Query: 182 DKLIMDDDFD--LADNLIQWLNSADGS 206
           D  I  D+    L +N    +N +D S
Sbjct: 896 DDTIFKDEITNLLLNNTTSVVNESDES 922

>TDEL0D02110 Chr4 complement(409766..412105) [2340 bp, 779 aa] {ON}
           Anc_1.343 YJL047C
          Length = 779

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 659 KVEIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHLLD 718
           +VE ++   + + LVLD+S  Q  V+  F+ +D    SLTL+ +S    I    L  +L 
Sbjct: 598 EVETQIILSNSKPLVLDLSFHQTRVLCLFNDSD----SLTLDAISSRSRINRGVLTEVLK 653

Query: 719 FWIQKGVISKENGVYSVIENCETDFDKVH 747
            ++  G++  ++  Y + E    D  K+ 
Sbjct: 654 SFLNIGLLVSDSESYLLNEEFSPDESKIR 682

>TBLA0A08600 Chr1 complement(2120498..2121604) [1107 bp, 368 aa]
           {ON} Anc_8.198 YER149C
          Length = 368

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 59/133 (44%), Gaps = 25/133 (18%)

Query: 7   PTRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIKNIIKVL 66
           P  D  V+  +LQ +  YI    I +++N L     P +  SN  L  P   +K+ I +L
Sbjct: 174 PPYDSNVLNSKLQPIIKYIVSNFIKNNINFL-----PQNINSN--LNDPLDFLKDCIDIL 226

Query: 67  FPN-SASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFSH---F 122
             N S S S  ++  +  TSN I +     K+LQL               + F +    F
Sbjct: 227 LSNRSTSHSNPTLSLSKSTSNEIDDTETALKDLQL--------------AHDFLTEKFKF 272

Query: 123 ENINYLKDIQRWE 135
           E INY KDIQR +
Sbjct: 273 ERINYNKDIQRLQ 285

>Ecym_8168 Chr8 (353777..355360) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii AGR365C
          Length = 527

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 4/92 (4%)

Query: 761 LRNESEAERKCELTLQ-RSLPFIEGMLANLGAMK--LNKIHSFLKI-TVPKDWGYNRVSL 816
           L+ ++EAERK + ++Q ++L FI+  +  L  +   LN  +   +I T P    +N +++
Sbjct: 405 LQPDNEAERKIQRSIQIKALAFIQEKMLPLKKIPEVLNPSNPVTEIQTSPSKLLFNNLTI 464

Query: 817 QQLEQYLSALADEGRLKYIANGSYEIVKNEHK 848
            +++QY   L      KYI  G  E  K + K
Sbjct: 465 GEVKQYREQLMVLKEQKYIVEGLVEDAKKQRK 496

>Suva_11.190 Chr11 (357421..358131) [711 bp, 236 aa] {ON} YKL033W-A
           (REAL)
          Length = 236

 Score = 32.0 bits (71), Expect = 4.8,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 398 ITFKVDIKALISLVDTLHDSDISQFTNVMKRNKNK--KGPFLWNLKVKGKNGPSPTSQTM 455
           +T  VD+KA +  +D L  +    +T  +     +  KGP  W++K++ +  P P + T 
Sbjct: 1   MTHPVDVKACLFDMDGLLINTEDIYTETLNETLAEFGKGPLTWDVKIQLQGLPGPEAGTK 60

Query: 456 IYQH 459
           + +H
Sbjct: 61  VIEH 64

>NCAS0I01760 Chr9 (325595..326779) [1185 bp, 394 aa] {ON} Anc_3.244
           YBR042C
          Length = 394

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 12/64 (18%)

Query: 232 VWNKRFMIMETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDIC 291
           VW ++ +++E + K+            GC   D +L+T+V N F+ N L      +  IC
Sbjct: 333 VWQEKDLLLENYYKY------------GCFHQDEKLSTSVVNSFKINPLEFYGALLLPIC 380

Query: 292 VLAY 295
            L +
Sbjct: 381 TLMF 384

>Ecym_8046 Chr8 complement(100862..103258) [2397 bp, 798 aa] {ON}
           similar to Ashbya gossypii ADR106W
          Length = 798

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 64/153 (41%), Gaps = 19/153 (12%)

Query: 572 NSIDVMLWDIKCSEELCRKMHEVAGLD--------PAIFPKFISLLYWKYNCDMQSSNEL 623
             I  M  D++ S++L ++  ++   +        P   P  ++   W +        E+
Sbjct: 511 GKITKMFQDVRLSKQLDQEFDKLVKSEADYSKEKYPEFQPFVLAETMWPF-----PYQEV 565

Query: 624 TFHLPIHLKKELQKYSDVYSQLKPGRKLQLCKDQGKVEIELNF-KDGRK-LVLDVSLEQC 681
            F LP  L  E  K  D+Y +   GR L+      + E+  +  + GR      V+L Q 
Sbjct: 566 DFKLPQELVSEHFKLVDLYVKKHSGRVLKWLWPLSRGELRADIGRPGRPPFYFTVTLFQM 625

Query: 682 SVINQFDSTDNKSISLTLEQLSDSLNITPPRLV 714
           S+I  F+  D     LT EQ+ +  N+T   ++
Sbjct: 626 SIILMFNRND----MLTFEQIQEGTNLTTQHII 654

>KAFR0B01150 Chr2 (217323..219758) [2436 bp, 811 aa] {ON} Anc_7.296
           YDL132W
          Length = 811

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 56/116 (48%), Gaps = 17/116 (14%)

Query: 599 PAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKLQ----LC 654
           P + P  ++   W +     S   + ++LP  L+   +K   VY+    GR L+    LC
Sbjct: 551 PELQPFILAENMWPF-----SYQAVEYNLPEELRLSHEKLETVYTNKHNGRILKWLWPLC 605

Query: 655 KDQGKVEIELNFKDGRK-LVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNIT 709
           + + +  I    K G+      V+L Q S++ QF++ D     LTLE++ +S N++
Sbjct: 606 RAELRANIG---KPGKAPFNFTVTLFQLSILLQFNNKD----VLTLEEIQESTNLS 654

>NCAS0B07310 Chr2 (1381759..1383663) [1905 bp, 634 aa] {ON}
           Anc_1.344 YBR259W
          Length = 634

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 55/114 (48%), Gaps = 11/114 (9%)

Query: 626 HLPIHLKKELQKY--SDVYSQLKPGRKLQLCKDQGKVEIE--LNFKDGRKLVLDVSLEQC 681
           H PI + K  +    S+  S LK  ++L+       +E+   +   +GR L L ++    
Sbjct: 503 HEPIWIDKTFKDAWTSERQSMLKESKQLEGAFRFNVIEMSSPIELDNGRGLTLIINFTTA 562

Query: 682 SVINQFDSTDNKSISLTLEQLSDSLNITPPRLVHL---LDFWIQKGVISKENGV 732
           +++NQF+  +    ++T++ L   LN+T  +       L   I+ G+I ++ GV
Sbjct: 563 AILNQFNDFE----TITVDSLEKKLNVTQDQYADFSVNLKKLIRYGLIKEKKGV 612

>AFL134W Chr6 (181202..182638) [1437 bp, 478 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL228W (CET1) and
           YMR180C (CTL1)
          Length = 478

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 17/27 (62%)

Query: 297 NSKVTLLELKKIMKDFKDYANIVTTFL 323
           NS+  L    KI +D KDYA IV TFL
Sbjct: 427 NSQALLAAFDKIAQDSKDYATIVRTFL 453

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 96,358,181
Number of extensions: 4569450
Number of successful extensions: 16124
Number of sequences better than 10.0: 75
Number of HSP's gapped: 16537
Number of HSP's successfully gapped: 81
Length of query: 850
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 732
Effective length of database: 39,950,811
Effective search space: 29243993652
Effective search space used: 29243993652
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)