Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1868.318ON57255626820.0
YLR120C (YPS1)8.318ON56955623450.0
Skud_12.1928.318ON56953721970.0
Suva_10.2118.318ON56653820700.0
CAGL0M04191g8.318ON60153413461e-180
Kpol_543.618.318ON58848713161e-176
Skud_4.4038.318ON59050312911e-172
Suva_2.3058.318ON59749112851e-171
SAKL0H15664g8.318ON55655512811e-171
YDR144C (MKC7)8.318ON59650212791e-170
TPHA0A015808.318ON60049312591e-167
NCAS0B035608.318ON58655912561e-167
Smik_4.3888.318ON59749212541e-166
Kwal_26.7254singletonON57048912361e-164
NDAI0J010308.318ON65253412391e-163
NCAS0C033008.318ON55949912151e-161
KAFR0B057108.318ON57554311541e-151
NDAI0G026208.318ON59048911531e-151
KNAG0G024108.318ON53050111301e-148
TDEL0F044508.318ON52448111291e-148
KLLA0E04049g8.318ON58949411301e-147
YLR121C (YPS3)8.319ON50848711141e-146
Smik_12.1878.319ON50748711031e-145
KLTH0G12386g8.318ON58050511001e-143
Skud_12.1938.319ON49752610891e-143
ZYRO0F10230g8.318ON58052910871e-141
KAFR0H023008.318ON52150110771e-141
KNAG0I009108.318ON56950310791e-140
ZYRO0F10274gsingletonON57250710731e-139
TBLA0D00140singletonON60751210451e-135
TBLA0H012908.318ON66738010391e-133
Kwal_56.239028.318ON62951710271e-132
TBLA0E02630singletonON68934110061e-128
KAFR0B06530singletonON5385009691e-124
ZYRO0G02904gsingletonON5314869681e-124
Suva_10.2128.319ON7453489671e-121
TBLA0A039108.318ON5965039491e-120
ZYRO0F10318g8.319ON4864619291e-119
Ecym_42518.318ON5025019281e-118
ZYRO0F10252gsingletonON5514729121e-115
KNAG0E03220singletonON5404938931e-113
SAKL0C02970gsingletonON5925498881e-111
KAFR0E03940singletonON6384878751e-109
Kwal_33.14239singletonON6514788711e-108
KLTH0F06754gsingletonON7674798681e-106
AGL192W8.318ON4994888321e-104
CAGL0E01419g8.318ON5915088301e-103
KAFR0I01700singletonON5525288006e-99
ZYRO0E02266gsingletonON5065037853e-97
SAKL0F07172g7.182ON5424567727e-95
CAGL0E01815gsingletonON5194857663e-94
CAGL0E01749gsingletonON4824807537e-93
CAGL0E01859gsingletonON5055037513e-92
CAGL0E01793gsingletonON5164627374e-90
CAGL0E01771gsingletonON5194767314e-89
ZYRO0F10296gsingletonON5284977246e-88
CAGL0E01837gsingletonON5215017113e-86
Suva_9.13singletonON4644867056e-86
YIR039C (YPS6)singletonON5374727091e-85
KNAG0I009008.319ON5314687072e-85
Suva_16.14singletonON5404727039e-85
CAGL0E01727gsingletonON5394356961e-83
TPHA0C008408.318ON10004907193e-83
KNAG0I01200singletonON6774946945e-82
Suva_34.1singletonON3873056561e-79
CAGL0E01881gsingletonON5084826625e-79
Smik_65.1singletonON3423006363e-77
KAFR0B06700singletonON5313166365e-75
NCAS0A124607.182ON5404806025e-70
KLLA0D15917g7.182ON5114635953e-69
YIL015W (BAR1)7.182ON5874205924e-68
Skud_9.1547.182ON5164735771e-66
ZYRO0D15554g7.182ON5214675692e-65
NDAI0B017207.182ON5474705521e-62
KNAG0H027607.182ON5634565223e-58
SAKL0E15356gsingletonON5573185171e-57
Smik_5.7singletonON3042264763e-54
Smik_9.1757.182ON5933274944e-54
CAGL0J02288g7.182ON5414054783e-52
AGR240W7.182ON4524534663e-51
TDEL0H026507.182ON5524624698e-51
Suva_79.1singletonON2272284194e-47
Ecym_43947.182ON5183014282e-45
SAKL0H00330gsingletonON5784423979e-41
TBLA0D045807.182ON3954173394e-34
Suva_9.1877.182ON3331852914e-28
Suva_9.186singletonOFF5431902942e-27
Kpol_1063.227.182ON3362122615e-24
KLLA0F22088g5.401ON5583542402e-20
ZYRO0F07392g8.677ON4182852292e-19
KLTH0D11264g8.677ON4172882247e-19
AGR407CsingletonON2682702161e-18
Kwal_26.88028.677ON4122882212e-18
NCAS0C013608.677ON4063102184e-18
KNAG0J017108.677ON4152792167e-18
Suva_62.1singletonON2522862081e-17
TBLA0B038308.677ON4132792132e-17
Smik_6.3518.677ON4052862095e-17
KLLA0D05929g8.677ON4092782095e-17
Skud_16.1288.677ON4052862087e-17
YPL154C (PEP4)8.677ON4052862078e-17
Ecym_13245.401ON5762852072e-16
Suva_16.1568.677ON4062862042e-16
KAFR0H024208.677ON4162712033e-16
Kpol_1013.68.677ON4022782015e-16
SAKL0H06512g8.677ON4042782015e-16
TPHA0D012608.677ON4192802007e-16
NDAI0E021058.677ON4082792008e-16
Skud_4.6185.401ON5862391858e-14
Kpol_1072.158.677ON3992781839e-14
TDEL0E022305.401ON5732311832e-13
ZYRO0A06578g5.401ON7202931832e-13
YDR349C (YPS7)5.401ON5963001822e-13
Suva_2.5205.401ON5983011822e-13
KLTH0E02596g5.401ON5961971813e-13
Kwal_55.200345.401ON5932411771e-12
Smik_5.6singletonON123741611e-12
Ecym_23968.677ON4152781713e-12
TPHA0E019205.401ON6242361723e-12
TDEL0A062308.677ON4082821696e-12
NDAI0C046105.401ON6092781707e-12
TBLA0H016805.401ON6092441681e-11
Smik_4.6135.401ON5963051652e-11
KAFR0E040805.401ON5962791644e-11
KNAG0C051405.401ON5982391626e-11
NCAS0F031505.401ON6454521618e-11
ACR144W8.677ON4083231572e-10
CAGL0A02431g5.401ON5873361572e-10
CAGL0M02211g8.677ON4152881543e-10
SAKL0G07524g5.401ON6322821502e-09
ACR143WsingletonON3932371473e-09
ACR150W5.401ON5532421449e-09
Smik_67.1singletonON110811249e-08
YGL259W (YPS5)singletonON165821154e-06
Kpol_1059.335.401ON6623251216e-06
YGL258W-AsingletonON77791015e-05
Ecym_4614na 1ON481219960.005
SAKL0D01408gna 1ON506300706.2
ZYRO0B01892gna 2ON36731697.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.186
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...  1037   0.0  
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...   907   0.0  
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   850   0.0  
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   801   0.0  
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   523   e-180
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   511   e-176
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...   501   e-172
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   499   e-171
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   498   e-171
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   497   e-170
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   489   e-167
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   488   e-167
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...   487   e-166
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   480   e-164
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}             481   e-163
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              472   e-161
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   449   e-151
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   448   e-151
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   439   e-148
TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   439   e-148
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   439   e-147
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   433   e-146
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   429   e-145
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   428   e-143
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   424   e-143
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   423   e-141
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   419   e-141
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}              420   e-140
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   417   e-139
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                407   e-135
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...   404   e-133
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...   400   e-132
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   392   e-128
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            377   e-124
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   377   e-124
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   377   e-121
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   370   e-120
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   362   e-119
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   362   e-118
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   355   e-115
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   348   e-113
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   346   e-111
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              341   e-109
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   340   e-108
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   338   e-106
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   325   e-104
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   324   e-103
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   312   6e-99
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   306   3e-97
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   301   7e-95
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   299   3e-94
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   294   7e-93
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   293   3e-92
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   288   4e-90
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   286   4e-89
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   283   6e-88
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   278   3e-86
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   276   6e-86
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   277   1e-85
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              276   2e-85
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   275   9e-85
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   272   1e-83
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   281   3e-83
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              271   5e-82
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   257   1e-79
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   259   5e-79
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       249   3e-77
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   249   5e-75
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   236   5e-70
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   233   3e-69
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   232   4e-68
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   226   1e-66
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   223   2e-65
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   217   1e-62
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   205   3e-58
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   203   1e-57
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       187   3e-54
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   194   4e-54
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   188   3e-52
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   184   3e-51
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   185   8e-51
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   166   4e-47
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   169   2e-45
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   157   9e-41
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   135   4e-34
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...   116   4e-28
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...   117   2e-27
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   105   5e-24
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    97   2e-20
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    93   2e-19
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    91   7e-19
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    88   1e-18
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    90   2e-18
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    89   4e-18
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    88   7e-18
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    85   1e-17
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    87   2e-17
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    85   5e-17
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    85   5e-17
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    85   7e-17
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    84   8e-17
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    84   2e-16
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    83   2e-16
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    83   3e-16
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    82   5e-16
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    82   5e-16
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    82   7e-16
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     82   8e-16
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    76   8e-14
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    75   9e-14
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    75   2e-13
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    75   2e-13
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    75   2e-13
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    75   2e-13
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    74   3e-13
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    73   1e-12
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        67   1e-12
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    70   3e-12
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    71   3e-12
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    70   6e-12
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    70   7e-12
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    69   1e-11
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    68   2e-11
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    68   4e-11
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    67   6e-11
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    67   8e-11
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    65   2e-10
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    65   2e-10
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    64   3e-10
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    62   2e-09
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    61   3e-09
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    60   9e-09
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        52   9e-08
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    49   4e-06
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    51   6e-06
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    44   5e-05
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...    42   0.005
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...    32   6.2  
ZYRO0B01892g Chr2 complement(151888..152991) [1104 bp, 367 aa] {...    31   7.9  

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score = 1037 bits (2682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/556 (93%), Positives = 520/556 (93%)

Query: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRD 60
           MRLATVRSAVLSSLFALQVLAKIIPVASKR         KFVKLPFHKLYGDSLDNVGRD
Sbjct: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRDNDDDDSNSKFVKLPFHKLYGDSLDNVGRD 60

Query: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120
           KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC
Sbjct: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120

Query: 121 SSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSV 180
           SSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSV
Sbjct: 121 SSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSV 180

Query: 181 PASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLS 240
           PASEATMDCKEYG               YFSISYGDGTFASGTFGTDVLDLSDLNVTGLS
Sbjct: 181 PASEATMDCKEYGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGLS 240

Query: 241 FAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLY 300
           FAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLY
Sbjct: 241 FAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLY 300

Query: 301 LNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNG 360
           LNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNG
Sbjct: 301 LNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNG 360

Query: 361 EKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFD 420
           EKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFD
Sbjct: 361 EKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFD 420

Query: 421 FGGFHINASLSSFILSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA 480
           FGGFHINASLSSFILSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA
Sbjct: 421 FGGFHINASLSSFILSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA 480

Query: 481 QYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSSQTASFSGNVXXXX 540
           QYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSSQTASFSGNV    
Sbjct: 481 QYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSSQTASFSGNVTSST 540

Query: 541 XXXXXXXXKRNAADCI 556
                   KRNAADCI
Sbjct: 541 ASATSTSSKRNAADCI 556

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/556 (81%), Positives = 488/556 (87%), Gaps = 3/556 (0%)

Query: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRD 60
           M+L TVRSAVLSSLFA QVL KIIP A+KR         KFVKLPFHKLYGDSL+NVG D
Sbjct: 1   MKLKTVRSAVLSSLFASQVLGKIIPAANKRDDDSNS---KFVKLPFHKLYGDSLENVGSD 57

Query: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120
           KKPE  L KRADGYEEIIITNQQSFYSV+L+VG+PPQNVTVLVDTGSSDLWIMGS+NPYC
Sbjct: 58  KKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYC 117

Query: 121 SSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSV 180
           SS++  +SRRRVIDKRDDSSS G+L+NDINPFGWLTGTG  IGPTATG GG S TATQSV
Sbjct: 118 SSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSAIGPTATGLGGGSGTATQSV 177

Query: 181 PASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLS 240
           PASEATMDC++YG               YFSISYGDGTFASGTFGTDVLDLSDLNVTGLS
Sbjct: 178 PASEATMDCQQYGTFSTSGSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGLS 237

Query: 241 FAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLY 300
           FAVANETNSTMGVLGIGLPELEVTYSGSTAS   + +KYDNFPIVLKNSGAIK+N YSLY
Sbjct: 238 FAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYSLY 297

Query: 301 LNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNG 360
           LNDSDA HGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIG+SDS + 
Sbjct: 298 LNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGISDSGSS 357

Query: 361 EKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFD 420
            KTLTTTKIPALLDSGTTLTYLP+TVV++IA E+GAQYS R+GYYVLDCPSDDS +IVFD
Sbjct: 358 NKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSMEIVFD 417

Query: 421 FGGFHINASLSSFILSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA 480
           FGGFHINA LSSFILSTG+TCLLGIIPTSD+TGTILGDSFLTNAYVVYDL+NLEISMAQA
Sbjct: 418 FGGFHINAPLSSFILSTGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQA 477

Query: 481 QYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSSQTASFSGNVXXXX 540
           +YNTT+ENIE+I+SS+PSAVKAPGYTNTWSTSA+IVTGGNIFTV+SSQTASFSGN+    
Sbjct: 478 RYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIFTVNSSQTASFSGNLTTST 537

Query: 541 XXXXXXXXKRNAADCI 556
                   KRN  D I
Sbjct: 538 ASATSTSSKRNVGDHI 553

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/537 (83%), Positives = 478/537 (89%), Gaps = 6/537 (1%)

Query: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRD 60
           M+L TVRSAVLSSLFALQ LAKIIP ASKR         KFVKLPFHKLYGD+ D+VG D
Sbjct: 1   MKLTTVRSAVLSSLFALQTLAKIIPAASKRDDDSNS---KFVKLPFHKLYGDTRDDVGTD 57

Query: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120
           KKPE  L KRADGYEEIIITNQQSFYSV+L+VG+PPQNVTVLVDTGSSDLWIMGSNNPYC
Sbjct: 58  KKPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSNNPYC 117

Query: 121 SSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSV 180
           SS + S+SRRRVI+KRDDSSSSGALVNDINPFGWLTGTG  IGPTATGSGG S TATQSV
Sbjct: 118 SSGSMSSSRRRVINKRDDSSSSGALVNDINPFGWLTGTGSAIGPTATGSGGGSGTATQSV 177

Query: 181 PASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLS 240
           PASEATM+C+E+G               YFSISYGDGTFASGTFGTD+LDLSDLNVTGLS
Sbjct: 178 PASEATMNCQEFGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDILDLSDLNVTGLS 237

Query: 241 FAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLY 300
           FAVANETNSTMGVLGIGLPELEVTYSGSTAS  RRP+ YDNFP+VLKNSGAIKTNAYSLY
Sbjct: 238 FAVANETNSTMGVLGIGLPELEVTYSGSTASSSRRPYTYDNFPMVLKNSGAIKTNAYSLY 297

Query: 301 LNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNG 360
           LNDSDA+HGTILFGAVDHSKY GTLYT+PIVNTLSASGFSSPIQFDVTINGIG+S   N 
Sbjct: 298 LNDSDAKHGTILFGAVDHSKYAGTLYTVPIVNTLSASGFSSPIQFDVTINGIGISYPDNS 357

Query: 361 EKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSD-DSTQIVF 419
           +KTLTTT+IPALLDSGTTLTYLP+ VVA+IADE+ AQYS RLGYYVLDCPS+ +STQIVF
Sbjct: 358 QKTLTTTQIPALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLDCPSNSNSTQIVF 417

Query: 420 DFGGFHINASLSSFILSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQ 479
           DFGGFHINASLSSFIL+ G+ CLLGII T D   TILGDSFLTNAYVVYDLDNLEISMAQ
Sbjct: 418 DFGGFHINASLSSFILNAGNICLLGIIATDDT--TILGDSFLTNAYVVYDLDNLEISMAQ 475

Query: 480 AQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSSQTASFSGNV 536
           AQYN T ENIEVI+SSIPSA+KAPGYT+TWSTSA+IVTGGNIFTVDSSQTASFSGNV
Sbjct: 476 AQYNITNENIEVITSSIPSAIKAPGYTSTWSTSASIVTGGNIFTVDSSQTASFSGNV 532

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/538 (75%), Positives = 460/538 (85%), Gaps = 11/538 (2%)

Query: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRD 60
           MRLAT+RSA+LSSLFA Q LAK+IPVA+           KFVKL F KLYGDSLD  GRD
Sbjct: 1   MRLATIRSALLSSLFASQTLAKLIPVATD--GDGGDTGSKFVKLSFDKLYGDSLDTAGRD 58

Query: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120
           KKPE  L KRADGYEEIIITNQQSFYSV+L+VG+P QN+TVLVDTGSSDLWIMGS+NPYC
Sbjct: 59  KKPEVRLSKRADGYEEIIITNQQSFYSVDLEVGTPAQNITVLVDTGSSDLWIMGSSNPYC 118

Query: 121 SSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSV 180
           SSD   +S + V+ KRD SSSSG LVNDINPFGWLT TG + G TAT +G  S TATQSV
Sbjct: 119 SSD---DSSKYVLRKRDTSSSSGDLVNDINPFGWLTETGSVTGATATATG--SGTATQSV 173

Query: 181 PASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLS 240
           PASEATMDC+EYG                F ISYGDGTFA+GTFGTDVL+LSDLNVTGLS
Sbjct: 174 PASEATMDCEEYGTFTSSDSSTFKSNNTAFEISYGDGTFAAGTFGTDVLNLSDLNVTGLS 233

Query: 241 FAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLY 300
           FAVANETNSTMGVLGIGLP LEVTYSGS+AS G + +KYDNFPIVLKNSGAIK+NAYSLY
Sbjct: 234 FAVANETNSTMGVLGIGLPSLEVTYSGSSASNGGKSYKYDNFPIVLKNSGAIKSNAYSLY 293

Query: 301 LNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNG 360
           LNDSDA+HGTILFG VDH+KY+GTLYT+ +VNTL  SGF+SPIQFD+T+NG+G+ D    
Sbjct: 294 LNDSDAKHGTILFGGVDHNKYSGTLYTVALVNTL--SGFTSPIQFDITLNGLGIIDDNGD 351

Query: 361 EKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVF 419
           EKTLTTTKIP LLDSGTTLTYLP  +V LIA+ +GAQYS R+GYYV++CP SD+ST+IVF
Sbjct: 352 EKTLTTTKIPVLLDSGTTLTYLPVEMVELIAENVGAQYSSRIGYYVMECPSSDNSTEIVF 411

Query: 420 DFGGFHINASLSSFILST-GSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMA 478
           DFGGFHINASLSSFILST G+TCLLGIIPTSD+TG+ILGDSFLTNAYVVYDL+NLEISMA
Sbjct: 412 DFGGFHINASLSSFILSTSGNTCLLGIIPTSDSTGSILGDSFLTNAYVVYDLENLEISMA 471

Query: 479 QAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSSQTASFSGNV 536
           QA+YN T+E+IEVIS+S+P+AVKAPGYTNTWST+A+I TGGNIFTVDSS TAS+SGNV
Sbjct: 472 QAKYNVTSEDIEVISTSVPNAVKAPGYTNTWSTTASIATGGNIFTVDSSSTASYSGNV 529

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  523 bits (1346), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 286/534 (53%), Positives = 367/534 (68%), Gaps = 24/534 (4%)

Query: 20  LAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRDK-KPEAHLFKRADGYEEII 78
           L  +  VA+            +VKL F K YG++ +   R + + +  + KRA+GYEE+ 
Sbjct: 6   LCMLASVAAHSKAAKNVADLSYVKLDFDKYYGETFETAKRGRSQADIRVNKRANGYEEVQ 65

Query: 79  ITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDT---------RSNSR 129
           ITNQ SFYSV L+VG+PPQ+V VLVDTGSSDLWI GS+NPYC   T          +  +
Sbjct: 66  ITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGSDNPYCRGSTGTSGKNMLLEAELK 125

Query: 130 RRVIDKRDDSSSSGALV-----NDINPFGWLTGTGGLIG----PTATGSGGSSETATQSV 180
           R + D RD +     L      ++     WLTG+ GL+G     T T +  +  TA  + 
Sbjct: 126 RALEDARDIAKERTTLAPRDDEHNDGLLSWLTGSDGLLGGQGGTTITLTDSAQPTAAGTS 185

Query: 181 PASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLS 240
             + AT++C +YG                F I YGD TFASGT+G D L LSDLNVTGLS
Sbjct: 186 NGARATINCAKYGTFDTSKSSTWHSNDTAFMIQYGDSTFASGTWGMDNLHLSDLNVTGLS 245

Query: 241 FAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLY 300
           FAVAN TNST+GVLGIGLP LEVTYSG TA  G+RP++YDNFP+VL  +GAIK+N+YSL+
Sbjct: 246 FAVANRTNSTVGVLGIGLPALEVTYSGRTAVSGQRPYQYDNFPLVLLRNGAIKSNSYSLF 305

Query: 301 LNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNG 360
           LN++ AE G++LFGAVDHSKY G LYTIP+VNT ++ G+ +PIQF+VT+NG+G+S S + 
Sbjct: 306 LNNASAETGSVLFGAVDHSKYLGDLYTIPMVNTYASQGYKNPIQFEVTLNGLGISSSSD- 364

Query: 361 EKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSD-DSTQIVF 419
             T+TTTKIPALLDSGTTLTYLP+ +V  I  ++ A YS R GYYV  CPS  D T++VF
Sbjct: 365 NTTITTTKIPALLDSGTTLTYLPQALVTRIVQKLQATYSNRAGYYVFSCPSQSDDTEVVF 424

Query: 420 DFGGFHINASLSSFIL-STGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMA 478
           DFGGFHINA +++FI+ S+G +C+LGI+P S   G ILGDSFL +AYVVYDL+N EISMA
Sbjct: 425 DFGGFHINAPITNFIIGSSGDSCILGIMPQSGG-GIILGDSFLNSAYVVYDLENYEISMA 483

Query: 479 QAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSAT-IVTGGNIFTVDSSQTAS 531
           QA Y    E+IEVISSS+P AV+APG+++TWST AT   T G+IFTV ++ T S
Sbjct: 484 QANYAGGQEDIEVISSSVPGAVRAPGFSSTWSTLATSFNTQGDIFTVQAAATVS 537

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  511 bits (1316), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 271/487 (55%), Positives = 333/487 (68%), Gaps = 61/487 (12%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           FV+  F KL GDS +N     K  A++ KR +G EE+ I NQ +FYSV L +GS  QNVT
Sbjct: 64  FVRYHFDKLVGDSFENASNKNKRYANIVKRDNGVEEVEIMNQSNFYSVSLSIGSNAQNVT 123

Query: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGG 160
           VL+DTGSSDLW+ GSNNP CS              R DS+S                   
Sbjct: 124 VLLDTGSSDLWVTGSNNPLCS--------------RGDSNSDA----------------- 152

Query: 161 LIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFA 220
                                     +DC ++G                FSISY D ++A
Sbjct: 153 --------------------------VDCAKFGTFNPSTSDTWSSNETSFSISYADSSYA 186

Query: 221 SGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYD 280
           SGT+G D L L DL+VTGLSFAVAN TNST+GVLGIGLP LEVTYSGS    G R ++Y+
Sbjct: 187 SGTWGQDTLKLQDLDVTGLSFAVANYTNSTVGVLGIGLPSLEVTYSGSNNVAGTR-YQYE 245

Query: 281 NFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFS 340
           NFP++LKNSGA K NAYSLYLND D+  G++LFG VDH+KY+GTLYTIP+VNTL A+GFS
Sbjct: 246 NFPLLLKNSGATKANAYSLYLNDLDSRTGSVLFGGVDHNKYSGTLYTIPLVNTLRAAGFS 305

Query: 341 SPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSY 400
            P++FDVT+ G+G+SD ++G  TLTTTKIPALLDSGTTL YLP  +V+LIADE  A Y+ 
Sbjct: 306 QPVEFDVTLQGMGISDDEHGNVTLTTTKIPALLDSGTTLVYLPSALVSLIADEYDAVYNS 365

Query: 401 RLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFIL-STGSTCLLGIIPTSDNTGTILGD 458
           R GYYV++CP SD+ +QIVFDFGGFHI+ +L+++I+ + G  C+LGI+P S  T  ILGD
Sbjct: 366 RTGYYVMNCPDSDEDSQIVFDFGGFHISTNLTTYIIQAVGGICVLGILPQSSGTA-ILGD 424

Query: 459 SFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTG 518
           SFL +AYVVYDLDNLEISMAQA + T  EN+EVISSSIPSAVKAPGY++TWST ++I +G
Sbjct: 425 SFLQHAYVVYDLDNLEISMAQASFETDDENVEVISSSIPSAVKAPGYSSTWSTFSSISSG 484

Query: 519 GNIFTVD 525
           GNIFTVD
Sbjct: 485 GNIFTVD 491

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score =  501 bits (1291), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 268/503 (53%), Positives = 347/503 (68%), Gaps = 23/503 (4%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           +V + F K YGDS +N   D+   AHL +R D YE + +TN+ SFYSVELD+G+PPQ +T
Sbjct: 36  YVIMNFEKKYGDSFENASNDRNAGAHLVRREDDYELVKLTNENSFYSVELDIGTPPQKIT 95

Query: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNS--RRRVIDKRDDSSSSGALVNDINPFGWLTGT 158
           VLVDTGSSDLW+ GSNNPYCS+  +  S    + I K + +S   +++ +I+       T
Sbjct: 96  VLVDTGSSDLWVTGSNNPYCSTKGKDTSDFSFKQIHKDNPASVVESVITEIS----YDTT 151

Query: 159 GGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGT 218
             +I  TAT           + P +   ++C  YG                FSI+YGD T
Sbjct: 152 ISVIEATAT---------LDNTPLASQKINCGTYGTFDSSKSSTFESNKTKFSITYGDST 202

Query: 219 FASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFK 278
           FASGT+G D L+L++LNVTGLSFAVANETNST+GVLGIGLP LE TYSG + S  ++ + 
Sbjct: 203 FASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSYT 262

Query: 279 YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 338
           Y+NFP+VLKNSGAIK++AYSL+ N S++EHGTILFGAVDH KYTG LYTIPI+N L  +G
Sbjct: 263 YNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHGKYTGDLYTIPIINILQNNG 322

Query: 339 FSSPIQFDVTINGIGVS--DSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGA 396
           +  PIQF VT+ GI V+  D  +   TLTTTKIPALLDSGTT++YLP  +V L+AD++GA
Sbjct: 323 YKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGTTISYLPVKLVELLADKVGA 382

Query: 397 QYSYRLGYYVLDCPSDDSTQI--VFDFGGFHINASLSSFILSTGST---CLLGIIPTSDN 451
            YS   GYYV++C  +    I  VFDFGGFHI++ LS+F L T S+   C+LG  P SD 
Sbjct: 383 SYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQLFTDSSSDVCILGFAPQSDP 442

Query: 452 TGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWST 511
           T  ILGD+FL + Y+VYDLDN+EISMA A ++   E I+VI S++PSA+KAP Y+NTWST
Sbjct: 443 T-VILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIESAVPSALKAPNYSNTWST 501

Query: 512 SATIVTGGNIFTVDSSQTASFSG 534
             +IV GGNIF+  S+ + S SG
Sbjct: 502 YESIVPGGNIFSTSSNVSMSGSG 524

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  499 bits (1285), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 261/491 (53%), Positives = 346/491 (70%), Gaps = 13/491 (2%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           +V++ F K YGDS +N   +KK EA L KR D YE + ++NQ SFYSV+LD+G+P Q VT
Sbjct: 36  YVRIQFQKKYGDSFENASSNKKTEARLVKRGDDYEVVDLSNQNSFYSVDLDIGTPSQKVT 95

Query: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGG 160
           VLVDTGSSDLW+ GSNNPYCS  T+S        +R D  +  +LV  +     +     
Sbjct: 96  VLVDTGSSDLWVTGSNNPYCS--TKSGHTSSSSKERKDEDNILSLVQSV-----VQSVAS 148

Query: 161 LIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFA 220
            I    T +   +     S  ++  T+DC  YG                FSI+YGD TFA
Sbjct: 149 EISYDTTITDTDATATQDSTSSALQTIDCTTYGVFDSSKSSTFQSNKTDFSITYGDLTFA 208

Query: 221 SGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYD 280
           SGT+G D L+L++LNVTGLSFAVANETNST+GVLGIGL  LE TYSG+T S  +  + Y+
Sbjct: 209 SGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLAGLESTYSGATLSSAQESYTYN 268

Query: 281 NFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFS 340
           NFP+VLKNSGAIK+ AYSL+LN+++A+HG+ILFGAVDH KY+G LYTIPI+NTL   G+ 
Sbjct: 269 NFPMVLKNSGAIKSAAYSLFLNETNAKHGSILFGAVDHGKYSGDLYTIPIINTLQDHGYK 328

Query: 341 SPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSY 400
            PIQF VT+ G+G++   +   T+TTTKIPALLDSGTT++Y+P  ++ ++AD++GA YS 
Sbjct: 329 DPIQFQVTLQGLGLAKGDSESTTITTTKIPALLDSGTTISYMPVELMEMLADKLGASYSS 388

Query: 401 RLGYYVL--DCPSDDSTQIVFDFGGFHINASLSSFILSTGST---CLLGIIPTSDNTGTI 455
           ++GYY++     +DD   +VFDFGGF+I+ +LSS+ LS  S+   C+LG  P SD+T  I
Sbjct: 389 KVGYYLMDCITDTDDDINVVFDFGGFYISGNLSSYQLSADSSSDVCILGFAPQSDST-VI 447

Query: 456 LGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATI 515
           LGD+FL+NAYVVYDLDN+EISMAQ   +  +E+I+VI  S+PSAVKAP Y++TWST  +I
Sbjct: 448 LGDNFLSNAYVVYDLDNMEISMAQVDLSGRSEDIDVIEDSVPSAVKAPSYSSTWSTDGSI 507

Query: 516 VTGGNIFTVDS 526
           V+GG+IFTV S
Sbjct: 508 VSGGDIFTVSS 518

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  498 bits (1281), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 279/555 (50%), Positives = 357/555 (64%), Gaps = 50/555 (9%)

Query: 1   MRLATVR-SAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGR 59
           MR   +  S +LS L    VL K  P              K+V LPF K  G + +   +
Sbjct: 1   MRFDIIAISLLLSQLVTASVLKKRSP--------------KYVSLPFDKSRGSTYEESSK 46

Query: 60  DKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPY 119
             KP A L KR DG++EI + NQ SF+SVEL++G+P QNVTVLVDTGSSDLW+ GSNNPY
Sbjct: 47  HNKPYAVLSKRDDGFQEIELKNQVSFFSVELEIGTPRQNVTVLVDTGSSDLWVTGSNNPY 106

Query: 120 CSSDTRSNSR-----------------RRVIDKRDDSSSSGALVNDINPFGWLTGTGGLI 162
           C + +  N R                 +RV  KRD+ SS  +         WLT +G   
Sbjct: 107 CRAGSVGNRRNDASSGSGSGSGSSNNKKRVNIKRDEISSVRS---------WLTASGT-- 155

Query: 163 GPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASG 222
             T T SG +S T   S+ ++ AT+DC +YG                F I YGD ++A G
Sbjct: 156 -NTRTQSGSASATRANSLSSALATIDCSQYGTFNTSASSTFSSNDTLFVIFYGDSSYAYG 214

Query: 223 TFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNF 282
           T+G D L L D+++ GLSFAVAN+TNST+GVLGIGLP LEVTYSG  AS  R  ++YDNF
Sbjct: 215 TWGQDELYLHDIDIGGLSFAVANQTNSTVGVLGIGLPGLEVTYSG-YASSARNRYQYDNF 273

Query: 283 PIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSP 342
           P++LK +  IK NAYSL+LN +++  G++LFGAVDHSKY+G LYT+P++NTL +SG++ P
Sbjct: 274 PLILKRNNVIKANAYSLFLNSTNSSSGSLLFGAVDHSKYSGQLYTVPLLNTLESSGYTDP 333

Query: 343 IQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRL 402
           IQF+V + GIGV  S     TLTTT IPALLDSG TL+Y P  V  +IAD + A YS   
Sbjct: 334 IQFEVAVQGIGVRTS-GSNTTLTTTVIPALLDSGATLSYFPVQVAEMIADALDATYSSSY 392

Query: 403 GYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILSTG--STCLLGIIPTSDNTGTILGDS 459
           GYY++DCP SDD T+I++DFGGFHI + L+ +IL+T   S C+LGI+P + N   ILGD 
Sbjct: 393 GYYIVDCPSSDDDTEIIYDFGGFHIASKLTDYILTTNRPSICVLGIVPQNSNR-FILGDV 451

Query: 460 FLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGG 519
           FLT+AYVVYDLDN EIS+AQA Y    E IEVIS S+PSA+KAP Y++T  +SA+  TGG
Sbjct: 452 FLTSAYVVYDLDNFEISLAQANYEGGDEQIEVISESVPSAIKAPSYSSTRFSSASASTGG 511

Query: 520 NIFTVDSSQTASFSG 534
           +IFTV  S T S S 
Sbjct: 512 DIFTVTGSNTTSSSA 526

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  497 bits (1279), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 262/502 (52%), Positives = 346/502 (68%), Gaps = 25/502 (4%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           +VK+ F K YG S +N   D K    L  R D YE + +TNQ SFYSVELD+G+PPQ VT
Sbjct: 36  YVKMNFQKKYGSSFENALDDTKGRTRLMTRDDDYELVELTNQNSFYSVELDIGTPPQKVT 95

Query: 101 VLVDTGSSDLWIMGSNNPYCSS---DTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTG 157
           VLVDTGSSDLW+ GS+NPYCS+   DT  +S ++V     +  +  ++V  +  F  ++ 
Sbjct: 96  VLVDTGSSDLWVTGSDNPYCSTKKKDTTGSSFKQV-----NKDALASVVESV--FTEISY 148

Query: 158 TGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDG 217
              ++   AT +  S+ + +Q +       DC  YG                FSI+YGD 
Sbjct: 149 DTTIVTSEATATFDSTASTSQLI-------DCATYGTFNTSKSSTFNSNNTEFSIAYGDT 201

Query: 218 TFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPF 277
           TFASGT+G D L L+DLN+TGLSFAVANETNST+GVLGIGLP LE TYSG + S  ++ +
Sbjct: 202 TFASGTWGHDQLSLNDLNITGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSVQKSY 261

Query: 278 KYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSAS 337
            Y+NFP+VLKNSG IK+ AYSL+ NDSD++HGTILFGAVDH KY G LYTIPI+NTL   
Sbjct: 262 TYNNFPMVLKNSGVIKSTAYSLFANDSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQHR 321

Query: 338 GFSSPIQFDVTINGIGVS--DSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIG 395
           G+  PIQF VT+ G+G S  D ++   TLTTTKIP LLDSGTT++Y+P  +V ++AD++G
Sbjct: 322 GYKDPIQFQVTLQGLGTSKGDKEDNLTTLTTTKIPVLLDSGTTISYMPTELVKMLADQVG 381

Query: 396 AQYSYRLGYYVLDC--PSDDSTQIVFDFGGFHINASLSSFILSTGS---TCLLGIIPTSD 450
           A YS   GYY++DC    ++ + I+FDFGGF+++  LS F L T S    C+LGI P SD
Sbjct: 382 ATYSSAYGYYIMDCIKEMEEESSIIFDFGGFYLSNWLSDFQLVTDSRSNICILGIAPQSD 441

Query: 451 NTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWS 510
            T  ILGD+FL N YVVYDLDN+EISMAQA ++   E IE+I S++PSA+KAPGY++TWS
Sbjct: 442 PT-IILGDNFLANTYVVYDLDNMEISMAQANFSDDGEYIEIIESAVPSALKAPGYSSTWS 500

Query: 511 TSATIVTGGNIFTVDSSQTASF 532
           T  +IV+GGN+F+  ++ + S+
Sbjct: 501 TYESIVSGGNMFSTAANSSISY 522

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  489 bits (1259), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 265/493 (53%), Positives = 336/493 (68%), Gaps = 58/493 (11%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           F+K  F K YGDS  N  +  KP+  + KR DGYEEI + N+ SFYS++L +G+P QNVT
Sbjct: 44  FIKFKFDKSYGDSYKNSSKRNKPKLDIVKR-DGYEEIELKNESSFYSIKLSIGTPAQNVT 102

Query: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGG 160
           VL+DTGSSDLW+ GS+NP CSSD                                     
Sbjct: 103 VLIDTGSSDLWVTGSDNPLCSSD------------------------------------- 125

Query: 161 LIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFA 220
               T TGS GSS+++          +DC  YG                F+I+YGDG++A
Sbjct: 126 --DATFTGSDGSSQSS----------IDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSYA 173

Query: 221 SGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYD 280
            G +G DVL L D++VTGLSFAVAN TNST+GVLGIGLP LE TYSGS A  G  P++YD
Sbjct: 174 LGNWGQDVLSLQDIDVTGLSFAVANYTNSTVGVLGIGLPSLEATYSGSLA--GSNPYQYD 231

Query: 281 NFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFS 340
           N P+VL+NSGA+K+ AYSL+LND D+  G+ILFG VDHSKY GTL T+P+VN   +SGF 
Sbjct: 232 NLPLVLRNSGAVKSYAYSLFLNDEDSSEGSILFGGVDHSKYEGTLNTLPLVNYQKSSGFQ 291

Query: 341 SPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSY 400
           SP +FD+T+ G+G+S S     T++ T+I ALLDSGTTLTYLP T+ +L+A E+ A YS 
Sbjct: 292 SPYEFDITLQGLGISTSSK-NTTVSDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYSA 350

Query: 401 RLGYYVLDCPSD-DSTQIVFDFGGFHINASLSSFIL-STGSTCLLGIIPTSDNTGTILGD 458
           RLGYY + CPS  DST+IVFDFGGFHIN  L+SFI+ S+ + C+LGIIP S +   ILGD
Sbjct: 351 RLGYYTMSCPSSSDSTEIVFDFGGFHINVPLTSFIVTSSMNVCILGIIPRSGDQA-ILGD 409

Query: 459 SFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTG 518
           SFL +AYVVYDL+NLEIS+AQA+Y +++E+IE I SS+PSAV+A  Y+NTWST+ATI +G
Sbjct: 410 SFLQHAYVVYDLENLEISLAQAKYGSSSEDIEAIVSSVPSAVRAASYSNTWSTAATINSG 469

Query: 519 GNIFTVDSSQTAS 531
           G+IFTV  S TAS
Sbjct: 470 GDIFTV--STTAS 480

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  488 bits (1256), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 279/559 (49%), Positives = 367/559 (65%), Gaps = 42/559 (7%)

Query: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRD 60
           MRL+T++    SSL    +LA  IP              K+V LPF+KL GDS ++   D
Sbjct: 1   MRLSTIKYIFSSSLLFTNILASTIP-----EHETTDQSSKYVILPFNKLVGDSYEDATPD 55

Query: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120
           KKP   L KR   YE + I N+QSFYSVEL +G+P Q +TVLVDTGSSDLWIMGS+NPYC
Sbjct: 56  KKPHFALVKRDGSYENVAIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSDNPYC 115

Query: 121 SSDTRSNSRRRVIDKRDDSSSSGALVNDIN--------------PFGWLTGTGGLIGPTA 166
           +S   +++ + V+ K D +   G L  +I                F  ++ T    G T+
Sbjct: 116 AS---TSNGKNVMRKDDSNLPDGILFTEITVTNLSDLTGFFSDFSFIPMSETDIPTGVTS 172

Query: 167 TGSGGSS--ETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTF 224
           T + G     T T ++  SE T+DC +YG                F  SYGD TFASGT+
Sbjct: 173 TNTVGGPVFPTQTNNIALSERTIDCSQYGTFDKNQSSTFQTNFTSFLTSYGDSTFASGTW 232

Query: 225 GTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPI 284
             DVL+L  LN+TGLSFAVAN +NST+GVLGIGLP LE TYSGST+    + ++Y+NFP+
Sbjct: 233 AHDVLNLGGLNITGLSFAVANMSNSTVGVLGIGLPGLETTYSGSTS----KLYQYNNFPM 288

Query: 285 VLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQ 344
           +LK SGAI + +YSL+L+D DA+ G++LFGAVDH+KY G LYT+P+VN L++ G+ +PIQ
Sbjct: 289 LLKQSGAIDSTSYSLFLDDLDAKQGSVLFGAVDHTKYVGNLYTVPMVNILASKGYPNPIQ 348

Query: 345 FDVTINGIGV-SDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLG 403
           FDVT+ GIG+ +DSKN   T+TT K PALLDSGTT++Y P+ VV  IA ++GA+YS  LG
Sbjct: 349 FDVTLAGIGIQNDSKN--YTVTTNKFPALLDSGTTISYFPQEVVQTIARQLGARYSSALG 406

Query: 404 YYVLDCPS-DDSTQIVFDFGGFHINASLSSFILST-GSTCLLGIIPTSDNTGTILGDSFL 461
           +Y + C     ST  VFDFGGFHI   +S F+L T G+TC+L + P  ++   +LGD FL
Sbjct: 407 FYAMSCNGVSSSTNFVFDFGGFHITGPVSDFLLPTSGNTCVLAMAP-QESQHILLGDIFL 465

Query: 462 TNAYVVYDLDNLEISMAQAQYNTTTE----NIEVISSSIPSAVKAPGYTNTWSTSATIVT 517
           T+AYVVYDLDN EIS+AQA  NT T+    NI++IS S+PSA+KAP Y+ TWS +  I T
Sbjct: 466 THAYVVYDLDNYEISLAQA--NTGTQNLDSNIQIISDSVPSAIKAPLYSETWSKAMPIST 523

Query: 518 GGNIFTV--DSSQTASFSG 534
           GGNIFTV  + S T++ SG
Sbjct: 524 GGNIFTVPANGSATSTHSG 542

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  487 bits (1254), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 260/492 (52%), Positives = 336/492 (68%), Gaps = 25/492 (5%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           +VK+ F + YGDS ++   D K  A L  R D YE + +TNQ SFYSVELD+G+PPQ VT
Sbjct: 36  YVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVT 95

Query: 101 VLVDTGSSDLWIMGSNNPYC---SSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTG 157
           VLVDTGSSDLW+ GS+NPYC     DT  +S + V   +D+  S   +V  +  F  ++ 
Sbjct: 96  VLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHV--NKDNLVS---VVESV--FTEISY 148

Query: 158 TGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDG 217
              ++   AT + G++ + +Q+       M+C  YG                FSI+YGD 
Sbjct: 149 DTTMVTSVATATIGNTASTSQA-------MNCTTYGTFDTSKSSTFESNKTEFSITYGDS 201

Query: 218 TFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPF 277
           TFASGT+G D L L++LNVTGLSFAVANETNST+GVLGIGLP LE TYSG + S  ++ +
Sbjct: 202 TFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSY 261

Query: 278 KYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSAS 337
            Y+NFP++LKNSGAIK+ AYSL+ N SD++HGTILFGAVDH KY G LYTIPI+NTL   
Sbjct: 262 TYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNR 321

Query: 338 GFSSPIQFDVTINGIGVSDSKNGEK--TLTTTKIPALLDSGTTLTYLPETVVALIADEIG 395
           G+  PIQF VT+ GIGVS  +  E   TLTTTKIP LLDSGTT++Y+P  +V +IA E+G
Sbjct: 322 GYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVG 381

Query: 396 AQYSYRLGYYVLDC--PSDDSTQIVFDFGGFHINASLSSFILSTGS---TCLLGIIPTSD 450
           A YS   GYY++DC    ++ + ++FDFGGF+I   LS+F L T S    C+LGI P SD
Sbjct: 382 ATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSD 441

Query: 451 NTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWS 510
               ILGD+FL + YVVYDLDN+EISMA A ++   E I+ I  S+PSA+KAPGY++TWS
Sbjct: 442 -PAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWS 500

Query: 511 TSATIVTGGNIF 522
           T  +IV GGN+F
Sbjct: 501 TYESIVPGGNMF 512

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  480 bits (1236), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 258/489 (52%), Positives = 328/489 (67%), Gaps = 13/489 (2%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           K+V++ F KL GD+ ++      P A L KRADG E I I NQ +FYSVE+ VGSP QNV
Sbjct: 33  KYVRISFDKLRGDTAEDARVGLMPRAELVKRADGSETIKIKNQNNFYSVEVGVGSPAQNV 92

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159
           T+L+DTGSSD+W+MGSNNP+C   +RS+  + V+   +       +  D     + +   
Sbjct: 93  TLLIDTGSSDMWVMGSNNPFCEGSSRSS--KHVLLGENIGLEDETVKKD-----FFSSFR 145

Query: 160 GLIGPTATGSGGSSETATQ--SVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDG 217
            L+  TAT +  +S  A    SV AS+AT+ C  YG                F I YGD 
Sbjct: 146 SLLTATATSTVSASAVAPSRTSVAASDATLSCSSYGTFATGSSSSFKSNNTDFYIQYGDL 205

Query: 218 TFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPF 277
           T+A GT+G D + L D+ V+ LS AVANE+NST GVLGIGL  LEVT  GS  S  R  +
Sbjct: 206 TYALGTWGHDDVTLQDITVSDLSMAVANESNSTFGVLGIGLTGLEVTNVGSLVSSSRSAY 265

Query: 278 KYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSAS 337
            Y N P +L + G I  NAYSL+L+D DAEHG++LFGAVDHSKYTG LYT+P+VN   +S
Sbjct: 266 TYQNLPALLVDQGKIHQNAYSLFLDDLDAEHGSVLFGAVDHSKYTGNLYTVPLVNIYKSS 325

Query: 338 GFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQ 397
           GF  PIQ DVT+ G+G+S +K    T TTT IPALLDSGTTLTYLP ++V  IA  + AQ
Sbjct: 326 GFPDPIQLDVTLQGLGMSANKT-NITFTTTPIPALLDSGTTLTYLPSSMVQSIARRLSAQ 384

Query: 398 YSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFILSTGST-CLLGIIPTSDNTGTI 455
           YSY +GYYVL+C    DS ++VFDFGGFHI + L +F++   S  C LG++P S +   I
Sbjct: 385 YSYDVGYYVLECSEVSDSDELVFDFGGFHIKSKLQNFLIKASSNFCALGLVPQSSSRA-I 443

Query: 456 LGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATI 515
           LGD+FLT AYVVYDL+NLE+SMAQA Y+  +E+IEVISS+IP AVKAPGY++TWS+   I
Sbjct: 444 LGDNFLTAAYVVYDLENLEVSMAQANYDGGSEDIEVISSTIPGAVKAPGYSSTWSSRIPI 503

Query: 516 VTGGNIFTV 524
            TGGNIFTV
Sbjct: 504 STGGNIFTV 512

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score =  481 bits (1239), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 271/534 (50%), Positives = 354/534 (66%), Gaps = 58/534 (10%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRAD----GYEEIIITNQQSFYSVELDVGSP 95
           K+VKLPF K  GDS ++  R+ KP   L KR +    GYE++ ITNQQSFYSVEL +G+P
Sbjct: 56  KYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTP 115

Query: 96  PQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDD-----------SSSSGA 144
           PQ+VTVLVDTGS+DLW+ GS NP+C S   S   R V+ KRDD             ++G 
Sbjct: 116 PQHVTVLVDTGSADLWVTGSMNPFCQSSLNS---RNVVIKRDDDDDDDDDDDDTQQAAGM 172

Query: 145 ----LVNDINPFGWL-----------TGTGGLIGPTATGSGGSSE------------TAT 177
               LV +++  G L           TG  G I PT   +  ++             TAT
Sbjct: 173 FTEILVTNLSDLGNLSDLLGSFTIISTGIPGGIIPTGVTTATTTGGGGGAGGAGGLPTAT 232

Query: 178 QSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVT 237
             +P SE T+DC+EYG                FSISYGD TFASGT+  DVL+LSDLNVT
Sbjct: 233 NDIPRSERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVT 292

Query: 238 GLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAY 297
           GLSFAVAN TNST+GVLGIGLP LE TYSG++ +  R+ ++Y NFP+VLK SGAI T  Y
Sbjct: 293 GLSFAVANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTY 352

Query: 298 SLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDS 357
           SL+L+D D  HG++LFGA+DHSKYTG LYT+P++N +  SG+S+PIQFDVT+ GIG+   
Sbjct: 353 SLFLDDLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGL--- 409

Query: 358 KNGEK--TLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS- 414
           +NGE+  TLTTTK+ ALLDSGTT++Y P +VV L+A +I AQYS RLG+Y + C S  S 
Sbjct: 410 QNGERNLTLTTTKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSN 469

Query: 415 TQIVFDFGGFHINASLSSFILSTG-STCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNL 473
           T +VFDFGGFHI+  L  F++ T   TC+L + P  ++   ILGD FLT+AYVVYDLDN 
Sbjct: 470 TNLVFDFGGFHISGPLQDFLIQTSQQTCILAMAP-QESQHVILGDIFLTHAYVVYDLDNY 528

Query: 474 EISMAQAQ----YNTTTENIEVIS-SSIPSAVKAPGYTNTWSTSATIVTGGNIF 522
            I++AQA       +++ +IE+I+ S+IP A++AP Y+ TW+ +  + +GGNIF
Sbjct: 529 VIALAQADTSTSNQSSSSDIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  472 bits (1215), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 254/499 (50%), Positives = 330/499 (66%), Gaps = 67/499 (13%)

Query: 40  KFVKLPFHKLYGDSLDNVGRD-KKPEAHLFKRADG--YEEIIITNQQSFYSVELDVGSPP 96
           KFV L F+K YGD  D    D +KP+  L KR DG  YEE+ +TNQQSFYSVE+DVG+P 
Sbjct: 32  KFVNLRFNKKYGDHYDTASTDSRKPKLELVKR-DGSDYEEVELTNQQSFYSVEVDVGTPS 90

Query: 97  QNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLT 156
           Q VTVL+DTGSSD W+MGS+NPYCS               DD+S++G             
Sbjct: 91  QRVTVLLDTGSSDFWVMGSDNPYCS---------------DDTSTTG------------- 122

Query: 157 GTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGD 216
                                         +DC E+G                F+I YGD
Sbjct: 123 ------------------------------IDCSEFGTFDSSSSSTFHNNGTAFNIHYGD 152

Query: 217 GTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRP 276
           G+FA GT+GTD + + D+ +  LS AVAN +NS+MGV+G+GL  LE TYS S A +  + 
Sbjct: 153 GSFALGTWGTDTVSIDDITLDALSLAVANSSNSSMGVIGLGLAGLETTYSSSHAVKSGQT 212

Query: 277 FKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSA 336
           ++Y NFP+ LKN+G +  NAYSLYLND +   G ILFGAVDHS Y+G LYTIP+VN  S 
Sbjct: 213 YQYANFPLALKNAGIVAANAYSLYLNDPEETTGNILFGAVDHSLYSGQLYTIPLVNIYSG 272

Query: 337 SGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGA 396
           SGF + ++FDVT+NGIG+ DS     T++TT I ALLDSGTTLTY P   V+L+A ++GA
Sbjct: 273 SGFKNAVEFDVTLNGIGIVDSSGSATTVSTTPIIALLDSGTTLTYFPTQYVSLLAAQLGA 332

Query: 397 QYSYRLGYYVLDCPS--DDSTQIVFDFGGFHINASLSSFILSTG-STCLLGIIPTSDNTG 453
           QYS   GYY + C +  D +T++VFDFGGFHINA+L+ F++ +G STC L IIP  +++ 
Sbjct: 333 QYSSSNGYYTISCDAMQDTTTKLVFDFGGFHINATLADFVVQSGTSTCFLSIIP-QNSSS 391

Query: 454 TILGDSFLTNAYVVYDLDNLEISMAQAQYNTTT-ENIEVISSSIPSAVKAPGYTNTWSTS 512
            ILGD+FL NAYVVYDLDNLEISMAQA+++ ++ E+IEVISSS+PSAVKAPGY+NTWST+
Sbjct: 392 AILGDTFLNNAYVVYDLDNLEISMAQAKWDQSSDEDIEVISSSVPSAVKAPGYSNTWSTT 451

Query: 513 ATIVTGGNIFTVDSSQTAS 531
            +I +GGNIFTV++  +A+
Sbjct: 452 MSITSGGNIFTVNADASAT 470

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  449 bits (1154), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 259/543 (47%), Positives = 353/543 (65%), Gaps = 34/543 (6%)

Query: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRD 60
           M+L   +  + +SL      A I+   SK+         K++KL F K  G+S D   +D
Sbjct: 1   MKLLNSKLILSTSLITALTDASIVAKDSKQPSDFNKN--KYLKLGFDKYVGESFDKSSKD 58

Query: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120
                 L KRA+ Y    +TNQ SFYSVEL +G+P QNVTVLVDTGSSDLW+ GS+NP C
Sbjct: 59  S-----LQKRAE-YAIFNLTNQASFYSVELAIGTPSQNVTVLVDTGSSDLWVTGSDNPLC 112

Query: 121 SSDT-----------RSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGS 169
           S+D+           +  +   V+ +    + +G  ++ ++PFGWL G        +T +
Sbjct: 113 STDSSDDDDDSYAFKKKRAETIVVTEEATITENGNNLDGLDPFGWLGG--------STAT 164

Query: 170 GGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVL 229
            GS ET+  S  +S    DC EYG                F ISYGD + A G +G DVL
Sbjct: 165 SGSFETSFPSSSSSSGDFDCSEYGTFNTNDSSTWSSNHTSFFISYGDSSVAEGVWGQDVL 224

Query: 230 DLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNS 289
            +SD++V+G+SFAVAN TNST+GVLGIGL  LE TYSG+++S     + Y+N P++LK+S
Sbjct: 225 SISDVDVSGVSFAVANYTNSTVGVLGIGLSGLETTYSGTSSSE---SYIYENLPMLLKSS 281

Query: 290 GAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTI 349
           G I T AYSL+LN+     G +LFGAVDHSKY+G+LYT+PIVN  ++ G+ +P++FDVT+
Sbjct: 282 GVIDTIAYSLFLNEKSDTTGNLLFGAVDHSKYSGSLYTLPIVNVYASEGYKNPLEFDVTM 341

Query: 350 NGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDC 409
            G+G+S S +   T+ T KIPALLDSGTT+ Y PET++ L+AD++GA YS  LG+Y + C
Sbjct: 342 YGLGISTS-DSNTTIATMKIPALLDSGTTIVYFPETLLELVADQLGASYSDELGFYAMSC 400

Query: 410 -PSDDSTQIVFDFGGFHINASLSSFILS-TGSTCLLGIIPTSDNTGTILGDSFLTNAYVV 467
             S D T+ VFDFGGFHI   LS F++  +GS C+L +    D+   ILGD FLTNAYVV
Sbjct: 401 VSSSDDTEFVFDFGGFHITVPLSDFLIRVSGSECILAM-AAQDDESIILGDYFLTNAYVV 459

Query: 468 YDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSS 527
           YDL+N EISMAQA Y++  E+IEVISS++PSAVKA  Y+N+WS++ +I +GG+IFTV S+
Sbjct: 460 YDLENYEISMAQANYDSEDEDIEVISSTVPSAVKAASYSNSWSSTGSITSGGDIFTVASN 519

Query: 528 QTA 530
            TA
Sbjct: 520 STA 522

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  448 bits (1153), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 238/489 (48%), Positives = 320/489 (65%), Gaps = 58/489 (11%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           K++ L F K YGDS  N      P A L KR DGYE++ +TNQQSFYSVE+++G+P Q +
Sbjct: 32  KYLALNFEKRYGDSFLNSSSSNGPSAQLIKRDDGYEQVTLTNQQSFYSVEVEMGTPSQKL 91

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159
           TVL+DTGSSD W+  S+NPYC +                +S+ G+L              
Sbjct: 92  TVLLDTGSSDFWVTSSDNPYCGT----------------TSTEGSLY------------- 122

Query: 160 GLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTF 219
                     GG ++           T+DC  YG                F ISYGDG+F
Sbjct: 123 ----------GGETQD----------TIDCSTYGTFDSSKSSTFQSNDTDFLISYGDGSF 162

Query: 220 ASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFK 278
           A GT+GTDV+ L D L++  +S AVA+ TNS+MGVLGIGL  LE TYS + +   +  + 
Sbjct: 163 AEGTWGTDVIKLDDSLSLNDVSVAVASSTNSSMGVLGIGLRPLETTYSSTKSVNEKTSYM 222

Query: 279 YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 338
           YDNFPI LK SG I++ AYSLYLND  ++ G ILFG VDHSKYTG LYT+P+++  S + 
Sbjct: 223 YDNFPISLKKSGLIESTAYSLYLNDPSSKSGNILFGGVDHSKYTGQLYTVPMLS--STTS 280

Query: 339 FSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQY 398
           + +P++FDVT+NGIG+ DS   +KTLT T+   LLDSGTT +YLP  +VA+I +E+GA Y
Sbjct: 281 YKTPVEFDVTLNGIGIIDSSGNKKTLTATQFYGLLDSGTTFSYLPSALVAMIGEELGASY 340

Query: 399 SYRLGYYVLDCPSDDS--TQIVFDFGGFHINASLSSFILS-TGSTCLLGIIPTSDNTGTI 455
              +GYY +DC ++DS  T+IVFD GGFHIN +LS F++  + STC+L I+P   +   +
Sbjct: 341 DSNIGYYTIDCSAEDSDDTKIVFDMGGFHINTTLSDFVIQISTSTCILSIVP--QDGKVV 398

Query: 456 LGDSFLTNAYVVYDLDNLEISMAQAQYNTTTE-NIEVISSSIPSAVKAPGYTNTWSTSAT 514
           LGDSFL NAY+VYDLDN EI+MAQA +++T E NI+VIS++IPSA++APGY++TWSTS +
Sbjct: 399 LGDSFLNNAYIVYDLDNYEIAMAQAAWDSTREANIDVISTTIPSAIRAPGYSSTWSTSRS 458

Query: 515 IVTGGNIFT 523
           I +GG+IFT
Sbjct: 459 ISSGGDIFT 467

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  439 bits (1130), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 247/501 (49%), Positives = 329/501 (65%), Gaps = 68/501 (13%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           +V + F K +GD+     + ++P+  L KR  GYEEI +TNQQSF+SVELDVG+P QNVT
Sbjct: 21  YVGMRFEKKFGDNYAGATKWQRPQMRLAKRNTGYEEITLTNQQSFFSVELDVGTPAQNVT 80

Query: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGG 160
           VLVDTGSSDLWI G++                                 NP+        
Sbjct: 81  VLVDTGSSDLWITGAD---------------------------------NPYCL------ 101

Query: 161 LIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXY--FSISYGDGT 218
               T +GSG        S+P  +  +DC EYG                  F I+YGD T
Sbjct: 102 ----TYSGSGA------DSIPRRD-RVDCSEYGTFSLEDSSTWSQNSSAPPFYITYGDTT 150

Query: 219 FASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFK 278
           FASG +G D L L D+NVTG+SFAVAN TNST+GV+GIGLP LE T SGS      RP+ 
Sbjct: 151 FASGVWGQDHLHLQDVNVTGVSFAVANRTNSTVGVMGIGLPGLETTNSGS------RPYT 204

Query: 279 YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 338
           Y NFP VLKNSGA ++  YSLYLND + E G+ILFGAVDHSKYTG++YT+PI+N L + G
Sbjct: 205 YANFPQVLKNSGATQSALYSLYLNDLEEERGSILFGAVDHSKYTGSMYTLPIINRLQSYG 264

Query: 339 FSSPIQFDVTINGIGVSDSK-NG-EKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGA 396
           +++PIQFD+T+ GIG+S S+ NG E T+T+TK+PALLDSGTT+TYLP  +V+ IA ++GA
Sbjct: 265 YTTPIQFDITLQGIGLSSSESNGDEVTITSTKMPALLDSGTTMTYLPSNIVSQIAQQLGA 324

Query: 397 QYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFILSTGST-CLLGIIPTSDNTGT 454
             S R G YVL C +  ++  +V+DFGGFHIN++L+++I+    T C+LG+ P   NT  
Sbjct: 325 SMSARFGQYVLPCSNVPENMHLVYDFGGFHINSNLTNYIVQASQTLCILGLFPRDSNTA- 383

Query: 455 ILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTEN--IEVI--SSSIPSAVKAPGYTNTWS 510
           ILGD+FLT+AYVVYDL+NL+I +AQA++  +  +  I+++  S+ IPSA +AP Y++TWS
Sbjct: 384 ILGDTFLTDAYVVYDLENLQIGLAQAKFGVSDSDAKIDIVTGSAGIPSAQRAPDYSSTWS 443

Query: 511 TS-ATIVTGGNIFTVDSSQTA 530
           TS  T+ TGGNIFT++  +TA
Sbjct: 444 TSVGTVTTGGNIFTLNPHETA 464

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  439 bits (1129), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 247/481 (51%), Positives = 317/481 (65%), Gaps = 41/481 (8%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           K+V L F KL G+S +  G+  KP A L KR DGYEEI I N+Q+FYS+EL++G+P QNV
Sbjct: 30  KYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDGYEEIEIYNEQNFYSIELEIGTPSQNV 89

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159
           TVL+DTGSSDLW+    NPYC            ID            +D  P   L+ + 
Sbjct: 90  TVLLDTGSSDLWVSSPENPYC------------IDS-----------DDTKPVTQLSTS- 125

Query: 160 GLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTF 219
                 AT SG    TAT S  +  AT+DC EYG                FSISYGD TF
Sbjct: 126 ----TLATSSG----TATSSGNSGIATVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTF 177

Query: 220 ASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSG-STASRGRRPFK 278
           ASGT+GTD  DL DLNVT LSFAVAN++NST+GV+GIGL  L+ TY G ++AS G   ++
Sbjct: 178 ASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSG--AYQ 235

Query: 279 YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 338
           Y+NFP+ LK+ G I  NAYSL+LN+ DA+ G++LFGAVDHSKY+G LYT+P++N     G
Sbjct: 236 YENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRG 295

Query: 339 FSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQY 398
             +PI+FDVT+ G+ V+ S +  + LT T+ PALLDSGTTL+Y+P T+  LIA  +GAQY
Sbjct: 296 IQNPIEFDVTVQGVSVT-SGSTIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQY 354

Query: 399 SYRLGYYVLDCPSDDS-TQIVFDFGGFHI---NASLSSFILSTGSTCLLGIIPTSDNTGT 454
           S   GYY + CPS+++ T++ FDFGGF I    +S      S+ STC LG+IP + N   
Sbjct: 355 SQYTGYYSMRCPSENNDTRLNFDFGGFQISANLSSYLLSSRSSSSTCYLGMIPLTSN-AA 413

Query: 455 ILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSAT 514
           I GD+FL +AYVVYDL+N EISMAQA +N +   IEVIS SIPSAV+A GY++TWST+  
Sbjct: 414 IFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPSAVRAQGYSSTWSTNQA 473

Query: 515 I 515
           I
Sbjct: 474 I 474

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  439 bits (1130), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 252/494 (51%), Positives = 327/494 (66%), Gaps = 13/494 (2%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           K V + F KL G+        K+   HL KRADGY ++ I NQ +FYSV+L++G+P Q V
Sbjct: 35  KHVFMSFDKLRGNDASEASLSKRRVGHLKKRADGYVDVEIDNQNTFYSVDLEIGTPAQKV 94

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159
            VL+DTGSSDLW+ GS NP+CS+   S+ ++R       SS       D+      TG  
Sbjct: 95  GVLIDTGSSDLWVPGSGNPFCSASRSSSKKKRQDYTALLSSLLSVFGTDVATDYTYTGIA 154

Query: 160 GLIG-------PTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSI 212
              G       PTA  SG  + T+ +SVP+S AT+DC E+G                F I
Sbjct: 155 SATGSAGTQTVPTALTSGTVAATSIRSVPSSLATLDCSEFGTFDTSKSSSWQSNDTRFYI 214

Query: 213 SYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASR 272
           SY DGTFA G +G D + L D+NVTGLSFAV+N T+S  GVLGIGL   E TYSG  ++ 
Sbjct: 215 SYADGTFADGDWGVDEIHLDDVNVTGLSFAVSNYTDSQFGVLGIGLTGSESTYSGQLSTY 274

Query: 273 GRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVN 332
            R  ++YDNFPIVL+ +G I+ NAYS++LND DA+ G+ILFGAVDHSKYTGTLYT+P+VN
Sbjct: 275 NR--YQYDNFPIVLQRNGVIEKNAYSVFLNDLDADSGSILFGAVDHSKYTGTLYTVPMVN 332

Query: 333 TLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIAD 392
            L + G++  I+  +T+ GIGV+ S  G +T+T TK PALLD+G T  Y P ++ A IA 
Sbjct: 333 ALRSIGYTEQIRLSITLQGIGVT-SSYGNETVTQTKYPALLDTGATFCYFPSSLAAAIAS 391

Query: 393 EIGAQYSYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILSTGST--CLLGIIPTSD 450
            + A YS   GYY +DC S     +VFDFGGFHI + LS +I++T S+  C+LGI+P SD
Sbjct: 392 SVSATYSSSSGYYFVDCDSGSDYDLVFDFGGFHIISPLSDYIVTTSSSSQCVLGILPQSD 451

Query: 451 NTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWS 510
           N  T LGD+FLT+AYVVYDL+ LEIS+AQA Y +  E IEVI  S+PSAV APGY++TWS
Sbjct: 452 NEIT-LGDAFLTSAYVVYDLEELEISLAQASYTSGDEKIEVIRDSVPSAVAAPGYSSTWS 510

Query: 511 TSATIVTGGNIFTV 524
           T+A++ TGGNIFTV
Sbjct: 511 TAASLSTGGNIFTV 524

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  433 bits (1114), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 234/487 (48%), Positives = 291/487 (59%), Gaps = 77/487 (15%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           K+VK+PF K          +       L KR++G+E+ ++ N+QSFYSVEL +G+P QN+
Sbjct: 27  KYVKIPFTK----------KKNGDNGELSKRSNGHEKFVLANEQSFYSVELAIGTPSQNL 76

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159
           TVL+DTGS+DL                                           W+ G G
Sbjct: 77  TVLLDTGSADL-------------------------------------------WVPGKG 93

Query: 160 GLIGPTATGSGGSSETATQSVPASEATMDCKEYGXX-XXXXXXXXXXXXXYFSISYGDGT 218
                                P   + MDC +YG                 F  +YGDGT
Sbjct: 94  N--------------------PYCGSVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGT 133

Query: 219 FASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFK 278
           +A G FG D L  ++L+++GLSFAVANE+NST GVLGIGL  LEVTYSG  A   +R ++
Sbjct: 134 YAEGAFGQDKLKYNELDLSGLSFAVANESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYE 193

Query: 279 YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 338
           YDNFP+ LK+SGAI   AYSL+LND     G+ILFGAVDHSKY G LYTIP+VN   + G
Sbjct: 194 YDNFPLFLKHSGAIDATAYSLFLNDESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQG 253

Query: 339 FSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQY 398
           +  P+ FDVT+ G+G+   K    TLTTTK+PALLDSGTTLTYLP   VAL+A  + A Y
Sbjct: 254 YQHPVAFDVTLQGLGLQTDKR-NITLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASY 312

Query: 399 SYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILSTG-STCLLGIIPTSDNTGTIL 456
           S  LGYY   CP SD+ T + FDFGGF INA LS F + T   TC+L IIP + N   IL
Sbjct: 313 SKTLGYYEYTCPSSDNKTSVAFDFGGFRINAPLSDFTMQTSVGTCVLAIIPQAGNATAIL 372

Query: 457 GDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIV 516
           GDSFL NAYVVYDLDN EIS+AQA+Y T  EN+EVI S++PSA++AP Y NTWS  A+  
Sbjct: 373 GDSFLRNAYVVYDLDNYEISLAQAKYGTGKENVEVIKSTVPSAIRAPSYNNTWSNYASAT 432

Query: 517 TGGNIFT 523
           +GGNIFT
Sbjct: 433 SGGNIFT 439

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  429 bits (1103), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 236/487 (48%), Positives = 288/487 (59%), Gaps = 77/487 (15%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           K+VK+PF K  G+S  +V         L KR+ G+E  ++ N+QSFYSVEL +G+P QN+
Sbjct: 27  KYVKMPFVKK-GNSESSV---------LSKRSSGHENFVLANEQSFYSVELAIGTPSQNL 76

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159
           TVL+DTGS+DL                                           W+ G G
Sbjct: 77  TVLLDTGSADL-------------------------------------------WVPGKG 93

Query: 160 GLIGPTATGSGGSSETATQSVPASEATMDCKEYGXX-XXXXXXXXXXXXXYFSISYGDGT 218
                                P   + MDC +YG                 F  +YGDGT
Sbjct: 94  N--------------------PYCGSVMDCDQYGVFDKSKSSTFKANKSSPFYAAYGDGT 133

Query: 219 FASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFK 278
           FA G FG D L  ++L+++GL FAVANE+NST GVLGIGL  LEVTYSG  A   +R ++
Sbjct: 134 FAEGAFGQDKLKYNNLDLSGLPFAVANESNSTFGVLGIGLSTLEVTYSGKVAVMDKRSYE 193

Query: 279 YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 338
           YDNFP+ LK+SGAI   AYSL+LND     G+ILFGAVDHSKY G LYTIP+VN   + G
Sbjct: 194 YDNFPLFLKHSGAIDATAYSLFLNDESQASGSILFGAVDHSKYEGQLYTIPLVNMYKSQG 253

Query: 339 FSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQY 398
           +  P+ FDVT+ G+G+   K    TLTTTK PALLDSGTTLTYLP   VAL+A  + A Y
Sbjct: 254 YQHPVAFDVTLQGLGLQTDKR-NTTLTTTKFPALLDSGTTLTYLPSQAVALLAKSLNASY 312

Query: 399 SYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILSTG-STCLLGIIPTSDNTGTIL 456
           S  LGYY   CP SD+ T I FDFGGF INA LS F + T   TC L +IP + N   IL
Sbjct: 313 SKTLGYYEYTCPSSDNKTSIAFDFGGFRINAPLSDFTMQTSVGTCALALIPQAGNATAIL 372

Query: 457 GDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIV 516
           GDSFL NAYVVYDLDN EIS+AQA+Y    ENIE I S++P A +AP Y NTWST A++ 
Sbjct: 373 GDSFLRNAYVVYDLDNYEISLAQAKYGKAKENIEAIKSTVPGATRAPSYNNTWSTYASVT 432

Query: 517 TGGNIFT 523
           +GGNIFT
Sbjct: 433 SGGNIFT 439

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  428 bits (1100), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 250/505 (49%), Positives = 334/505 (66%), Gaps = 13/505 (2%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           KFVK+ F KL GD+ ++          L KRADG E ++I NQQ+FYSVEL VGSP QNV
Sbjct: 33  KFVKVSFDKLRGDTAEDATAGAVAHGVLAKRADGSETVVIKNQQTFYSVELGVGSPAQNV 92

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRV----IDKRDDSSSS---GALVNDINPF 152
           T+L+DTGSSD+W+MGSNNPYC   +  NS+  +    +D RD+  +      L + +   
Sbjct: 93  TLLIDTGSSDMWVMGSNNPYCEGGSSGNSKHVLLGDHVDSRDEEVNRDWFSTLRSFLTAT 152

Query: 153 GWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSI 212
              T T       +  SGG++ + T SV +  AT+ C  YG                F I
Sbjct: 153 ATATATATATATGSADSGGNAPSRT-SVNSQYATLTCSSYGTFATDSSSSFQSNNTAFYI 211

Query: 213 SYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASR 272
            YGD T+A GT+G D + L D+ ++G+S AVANE+NST GVLGIGL  LEVT  G+ A+R
Sbjct: 212 EYGDSTYALGTWGRDNVTLQDITLSGISMAVANESNSTFGVLGIGLAALEVTNVGTLATR 271

Query: 273 GRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVN 332
           G   + Y+N P  + + G I  NAYSL+L+  DA+ G++LFGAVDHSKYTG+LYT+P+ N
Sbjct: 272 GN-SYTYENLPAKMVSEGIIHKNAYSLFLDSLDAKEGSVLFGAVDHSKYTGSLYTLPLSN 330

Query: 333 TLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIAD 392
           +  + G+S PIQ +VT+ G G++ +     T TTT + ALLDSGTTLTYLP T+V  +A 
Sbjct: 331 SYKSMGYSDPIQLEVTLQGFGMTANNT-NSTFTTTPLTALLDSGTTLTYLPTTLVRQVAA 389

Query: 393 EIGAQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFIL-STGSTCLLGIIPTSD 450
           + GA+Y    GYY+L C    D+ ++VFDFGGFHIN+ + +F++ +T + C LG+IP S 
Sbjct: 390 KYGARYDSSYGYYLLSCSDVKDTDELVFDFGGFHINSKVENFLIRATSNICALGLIPQSS 449

Query: 451 NTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWS 510
           ++  ILGD+FLT AYVVYDLDNLEIS+AQA Y+  + NIEVISSS+PSAVK P Y++TWS
Sbjct: 450 SS-LILGDNFLTAAYVVYDLDNLEISLAQANYDGGSSNIEVISSSVPSAVKGPSYSSTWS 508

Query: 511 TSATIVTGGNIFTVDSSQTASFSGN 535
           TS  I TGGNIFTV  S + + +GN
Sbjct: 509 TSVPISTGGNIFTVSGSNSTTTAGN 533

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  424 bits (1089), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 243/526 (46%), Positives = 310/526 (58%), Gaps = 92/526 (17%)

Query: 4   ATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRDKKP 63
           A V  AVL++L     L  I+P              K+VK+PF K   D   NV      
Sbjct: 7   AAVSLAVLNTL----ALGSILP------------REKYVKIPFVK-NQDGAGNV------ 43

Query: 64  EAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSD 123
              L KR++G+E+ ++ N+QSFYSVEL +G+P Q++TVL+DTGS+DLW+    NPYC S 
Sbjct: 44  ---LGKRSNGHEKFVLANEQSFYSVELAIGTPSQSLTVLLDTGSADLWVPSKGNPYCGSV 100

Query: 124 TRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPAS 183
              + +  V DK   + SS    N  +PF    G G                        
Sbjct: 101 MDCD-QYGVFDK---TKSSTFKANKSSPFYAAYGDG------------------------ 132

Query: 184 EATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAV 243
                                        ++  G F     G D L  + L+++GLSFAV
Sbjct: 133 -----------------------------TFAQGAF-----GQDRLKYNGLDLSGLSFAV 158

Query: 244 ANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLND 303
           ANE+NST GVLGIGLP LEVTYSG  A   ++ ++YDNFP+ LK SGAI   AYSL+LND
Sbjct: 159 ANESNSTFGVLGIGLPALEVTYSGKVAVVDKKSYEYDNFPLFLKRSGAIDATAYSLFLND 218

Query: 304 SDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKT 363
                G+ILFGAVDHSKY G LYT+P+VN   + G+  P+ FDVT++GIG+   ++   T
Sbjct: 219 ESQSSGSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFDVTLHGIGLQTDRH-NTT 277

Query: 364 LTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFG 422
           LT TKIPALLDSGTTLTYLP   VAL+A  + A YS  LGYY   CP SD+ T + FDFG
Sbjct: 278 LTATKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYYEYACPSSDNDTSVAFDFG 337

Query: 423 GFHINASLSSFILST--GSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA 480
           GFHINA +S F + T  G TC+L +IP + N   ILGDSFL NAYVVYDLDN E+S+AQA
Sbjct: 338 GFHINAPVSDFTMQTSVGGTCVLAVIPQAGNATAILGDSFLRNAYVVYDLDNYEVSLAQA 397

Query: 481 QYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDS 526
           +Y T  E+IE I S++PSA +APGY +TWS  A++ +GGNIFT  S
Sbjct: 398 KYGTGAEDIEAIKSTVPSATRAPGYNSTWSNYASVTSGGNIFTTAS 443

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  423 bits (1087), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 249/529 (47%), Positives = 342/529 (64%), Gaps = 42/529 (7%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           K VKL F K +G++ +     K+      KR DG  E+ + N+Q+FYSV+L+VGSP Q +
Sbjct: 31  KIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKI 90

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDD-------SSSSGALVNDINPF 152
           TVL+DTGSSDLWI GS+NPYC S++ S+ +R + D   D       +  SGA+      +
Sbjct: 91  TVLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNSLDDIFSDITAGGSGAI------Y 144

Query: 153 GWLTGTGGLIGPTATGSGGSSETATQSVPASE---------------------ATMDCKE 191
             LT TGG + P++ GS GS + +T  +  +E                      ++DC  
Sbjct: 145 KTLTLTGGSM-PSSFGSFGSIDVSTGGIEPTETISGGGGGSGGSPTGSSSSGGQSIDCSR 203

Query: 192 YGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM 251
           YG                F ISYGDG+FASG +G D ++L  LN++ +S AVAN+TNST+
Sbjct: 204 YGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTV 263

Query: 252 GVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTI 311
           GVLGIGLP LE TYS   +        Y NFP+VLK  G  K N YSLYLN  DA +G+I
Sbjct: 264 GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSI 323

Query: 312 LFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPA 371
           LFGAVD SK+ G+LYTIPI+N   + G S PIQFDVT+ G+G+S+ +    TL+TTKIPA
Sbjct: 324 LFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSN-QTSTTTLSTTKIPA 382

Query: 372 LLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSD-DSTQIVFDFGGFHINASL 430
           LLDSG+TL YLPE ++ ++AD +GA++S  L YY++DCPS  D T+IVF+FGGF+I  +L
Sbjct: 383 LLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNL 442

Query: 431 SSFILSTGS-TCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENI 489
           +++     S TC+L I+P+ D++  ILGD+FL +AYVVYDL++ EISMAQA ++   E+I
Sbjct: 443 TTYTTPISSDTCVLRILPSGDSSA-ILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDI 501

Query: 490 EVISSSIPSAVKAPGYTNTWSTSATIVTGGNIF---TVDSSQTASFSGN 535
           EV+SSSIP A  A GY++T+S+S +I +GGNIF   T+  S + + SGN
Sbjct: 502 EVVSSSIPQATAAAGYSSTYSSSKSITSGGNIFSSGTLSGSASNTASGN 550

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  419 bits (1077), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 244/501 (48%), Positives = 319/501 (63%), Gaps = 70/501 (13%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           +V L F K YGDS +         + L KR  GYE + + N+Q+FYSV+LD+G+P Q +T
Sbjct: 34  YVNLKFKKTYGDSFEG----STTWSALAKRTRGYELVDLVNRQNFYSVDLDIGTPSQTIT 89

Query: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGG 160
           VLVDTGSSDLW+ GS+NPYC S  +SN                 LV+  N F        
Sbjct: 90  VLVDTGSSDLWVTGSDNPYCVS-VKSN-----------------LVSSTNKF-------- 123

Query: 161 LIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFA 220
                                      DC  YG                FSI+YGD +FA
Sbjct: 124 ---------------------------DCNTYGTFDKNQSSTWSSNDTLFSITYGDTSFA 156

Query: 221 SGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYD 280
            GT+G D L L DL+V+GLSFAVAN TNST+GVLGIGLP LEVTY    A R R  ++YD
Sbjct: 157 RGTWGQDKLHLDDLDVSGLSFAVANVTNSTVGVLGIGLPGLEVTYIN--APRNR--YQYD 212

Query: 281 NFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFS 340
           NFP++LKNSGA  +N YSL+L+  +AEHGT+LFGAVDHSKYTG+LYTIP+VNTL   GFS
Sbjct: 213 NFPMILKNSGATHSNLYSLHLDHPEAEHGTVLFGAVDHSKYTGSLYTIPLVNTLKTHGFS 272

Query: 341 SPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSY 400
            P +F+VT+ G+G+  + N + TLT TKI ALLDSGTTLTYLP+ +V +IAD IGA++S 
Sbjct: 273 DPAKFEVTLQGVGIV-ANNTQTTLTNTKIAALLDSGTTLTYLPQALVQVIADSIGARWSS 331

Query: 401 RLGYYVLDCPS--DDSTQIVFDFGGFHINASLSSFILST-GSTCLLGIIPTSDNTGTILG 457
           R GYY++ C +  +  T +VFDFGGFHIN  L+ FI+ T G+ CLL II  + +   ILG
Sbjct: 332 RYGYYIVSCRAVENSDTTLVFDFGGFHINGKLTDFIVETFGNVCLLTIIEETGSNSAILG 391

Query: 458 DSFLTNAYVVYDLDNLEISMAQAQYNT-TTENIEVISSS--IPSAVKAPGYTNTWSTSAT 514
           D+FL NAYVV+DL+N EISMAQA +N    ++IE+++S+  + SAV A GY++TW+   +
Sbjct: 392 DNFLINAYVVFDLENNEISMAQALHNVDDDQDIEIVTSNAGVASAVTALGYSSTWTAEPS 451

Query: 515 IVT--GGNIFTVDSSQTASFS 533
            +    G+IFTV +  TA+++
Sbjct: 452 TIETFAGDIFTVSAGATANYT 472

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  420 bits (1079), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 235/503 (46%), Positives = 320/503 (63%), Gaps = 47/503 (9%)

Query: 67  LFKR--ADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDT 124
           L KR   DGY  + + NQ SFYSV+L++G+PPQ VTVLVDTGSSDLW+MG++NP C+S  
Sbjct: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64

Query: 125 RS--------NSRRRV-IDKRDDSSSSGAL---VNDINP-------------FGWLTGTG 159
           R         ++R  +   ++D+  ++G +   + D+ P              GW   TG
Sbjct: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWTMMTG 124

Query: 160 GLIGPTATGSGGSSETATQSVPA------SEATMDCKEYGXXXXXXXXXXXXXXXYFSIS 213
                  TG+G  +  AT  VPA      +EAT+ C  YG                F+IS
Sbjct: 125 AENTMMMTGTGTETAVAT-GVPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAIS 183

Query: 214 YGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRG 273
           YGD ++ASG++G D + ++ LNV+G+SFAVAN +NS+MGVLGIGLP LEVT   S  + G
Sbjct: 184 YGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASG 243

Query: 274 RRP--------FKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTL 325
           ++         ++Y NFP+VLKN G I   AYSL+LND   + G++LFGAVDHSKYTGTL
Sbjct: 244 KKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTL 303

Query: 326 YTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPET 385
           YT+P+V+    S  S P++FD+T+ G+GV D    + T+ TT IPALLDSGTT++Y P  
Sbjct: 304 YTVPLVDIYHDSASSKPVEFDITLYGLGV-DKDGSQSTIATTTIPALLDSGTTISYFPAQ 362

Query: 386 VVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGS-TCLL 443
           +   IA +  A Y  R G+Y + C  D S T +VFDFGGFHI A L  F++   S TC+L
Sbjct: 363 LANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVL 422

Query: 444 GIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTT-ENIEVISSSIPSAVKA 502
            I P  +N   +LGD FL+NAYVVYDL+NLE+SMAQA ++++  E++EVISS++PSAVKA
Sbjct: 423 AIGPQQEN-WVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKA 481

Query: 503 PGYTNTWSTSATIVTGGNIFTVD 525
             Y+N WS++  + TGGNIFTV+
Sbjct: 482 ASYSNPWSSAVMMSTGGNIFTVE 504

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  417 bits (1073), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 235/507 (46%), Positives = 331/507 (65%), Gaps = 31/507 (6%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
            VKL F+K +G + +    +++    L  R +     I+ NQQ+FYSV+L VG+P QN+T
Sbjct: 29  MVKLSFNKWHGPTYEESSLERR---SLETRNNKEFNFIVENQQNFYSVDLLVGTPGQNIT 85

Query: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGG 160
           VL+DTGSSDLW+   NNPYC S+  SN ++   D R +   + ++V+ +   G  TGT  
Sbjct: 86  VLLDTGSSDLWLTAKNNPYCKSNAGSNDKKE--DYRLEDGDNQSIVSMLTASG--TGTNP 141

Query: 161 LIG---PTATGSGGSSE---------TATQSVPASEATMDCKEYGXXXXXXXXXXXXXXX 208
           + G   PTA    GS++             S  + E TMDC +YG               
Sbjct: 142 IGGSGIPTAIS--GSAQLTGTYTSGTGTGPSGSSPEPTMDCSQYGTFDVNKSKSFRSNKT 199

Query: 209 YFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGS 268
            F ISYGDG+FASG +GTD ++ +++N+ G+SFAVANETNST+GV GIGLPE E TY+  
Sbjct: 200 EFYISYGDGSFASGYWGTDSVNFANMNLEGVSFAVANETNSTVGVFGIGLPENEATYTPD 259

Query: 269 TASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTI 328
            +     P++Y NFP VLK+ GAI   AYSL+LN  DA  G ILFGAVD SKY G LYT+
Sbjct: 260 PSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFLNSLDASSGDILFGAVDRSKYKGDLYTL 319

Query: 329 PIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVA 388
           P++N+   + + +P++FDVT+ G+G ++  + + T TTTKIPALLDSGT+L YLP+ +  
Sbjct: 320 PLLNS-DPTKYKNPMEFDVTLQGVGFTNGSS-KTTFTTTKIPALLDSGTSLIYLPDALAK 377

Query: 389 LIADEIGAQYSYRLGYYVLDCPSD-DSTQIVFDFGGFHINASLSSFILST-----GSTCL 442
            IA ++G  Y+  +GYYV+ CPS+ D +Q+VFDFGGF I  +LS+++L +      S C+
Sbjct: 378 GIAHKLGGSYNEDIGYYVIGCPSENDDSQLVFDFGGFTIKNNLSNYLLGSPDDGDDSQCV 437

Query: 443 LGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKA 502
           LGI+P+  +   ILGD FL +AYVVYDLD+ E+S+AQA ++ + E+I++IS SIP A +A
Sbjct: 438 LGILPS--DVQAILGDVFLADAYVVYDLDDYEVSLAQASFDNSKEDIQIISDSIPGAKRA 495

Query: 503 PGYTNTWSTSATIVTGGNIFTVDSSQT 529
           PGY+ TWST A+I +GGNIFT  + +T
Sbjct: 496 PGYSKTWSTPASIKSGGNIFTSSNKKT 522

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  407 bits (1045), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 240/512 (46%), Positives = 314/512 (61%), Gaps = 36/512 (7%)

Query: 40  KFVKLPFHKLYGDSLDNVGRD-----KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGS 94
           K ++L  +K YGDS  N+G +       P A L KR DG+E I I NQQ+FYSV+L +G+
Sbjct: 28  KVLRLDINKFYGDSKFNLGSEIDEDISTPSARLVKREDGHEIIEIQNQQAFYSVDLMLGT 87

Query: 95  PPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSS-------GALVN 147
           PPQ VTVLVDTGSSDLW+ G+NNPYC   T S +    I+  DDS +        G  +N
Sbjct: 88  PPQKVTVLVDTGSSDLWVTGNNNPYCIDGTSSKAVSSNIE--DDSQTKNPISKVVGTTIN 145

Query: 148 DINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXX 207
            I  + +      L     +GSG  + +  + V   +A +DC  YG              
Sbjct: 146 KIRKY-FSHNLPDLSFLEDSGSGKYNSSQLKDVTPQDAHIDCSTYGTFDPSKSSTFVSND 204

Query: 208 XYFSISYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTYS 266
             F I YGD TFASGT+G D ++ SD LN+T  SF VA+ TNST+ VLG+GLP LEVTYS
Sbjct: 205 TNFMIRYGDRTFASGTWGRDSIEFSDHLNLTDFSFGVADLTNSTISVLGMGLPRLEVTYS 264

Query: 267 GSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLY 326
           G   S  R P+ Y NFP+ LK SG I    YSLYLN + A  G++LFGAVDHSKY G+L 
Sbjct: 265 G--LSLDRSPYTYANFPMALKQSGLIDRMVYSLYLNKAGASTGSVLFGAVDHSKYHGSLN 322

Query: 327 TIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETV 386
           TIP++ +LS SG   PI F+V + G+G+S    G +T  +T +PALLDSGTT+TYLP+ +
Sbjct: 323 TIPLI-SLSGSGI--PIAFNVALQGLGMSSDSQGTQTFLSTPLPALLDSGTTMTYLPDAL 379

Query: 387 VALIADEIGAQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFILST-GSTCLLG 444
           VA +A  +GA +    G Y+LDCPS  D  +  FDFGGF I+  LS+FIL      C+L 
Sbjct: 380 VATVASTLGASFDEAQGLYLLDCPSGSDDREFNFDFGGFQISVPLSNFILEALPDVCVLT 439

Query: 445 IIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTEN------------IEVI 492
           +   S     ILGDSFLT AYVVYDL+NLEISMAQA+Y+   ++            +EV+
Sbjct: 440 LF-ESHAERAILGDSFLTEAYVVYDLENLEISMAQARYDDDNDSDIEKYNADNKVLLEVV 498

Query: 493 SSSIPSAVKAPGYTNTWSTSATIVTGGNIFTV 524
           +S+IPSA +APGY++T    +TI   GN++ V
Sbjct: 499 TSNIPSANQAPGYSSTLINRSTIQPSGNMYAV 530

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score =  404 bits (1039), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 220/380 (57%), Positives = 287/380 (75%), Gaps = 17/380 (4%)

Query: 148 DINPFGWLTGTGGLIGPTATGS-GGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXX 206
           D NPFGW        G TAT + GG+S   T S+  S+AT++C  YG             
Sbjct: 229 DWNPFGW--------GSTATATTGGNSGYQTMSLDPSQATINCDTYGTFDIEDSSTFQSN 280

Query: 207 XXYFSISYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVANETNSTMGVLGIGLPELEVTY 265
              F+I Y D ++A+G +G DVL  SD LNVTGLSFAVAN+TNST+GVLGIGLP+LEVTY
Sbjct: 281 KTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTY 340

Query: 266 SGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTG-T 324
           SG    +  +P+ YDNFP+VLKNSGAI  + YSLYLN  +A++G +LFGAVDHS+Y G T
Sbjct: 341 SG--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDT 398

Query: 325 LYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPE 384
           LYT+P+VN  S+SG+S+PI+FD+T+ G+GV+       T+TTT+I ALLDSGTTLTY P+
Sbjct: 399 LYTVPLVNGDSSSGYSTPIEFDITLQGLGVT-DNTNNYTVTTTQIVALLDSGTTLTYFPK 457

Query: 385 TVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILSTGS-TCL 442
            ++ L+A  I A YS  LGYYV++CP SDD+TQIVFDFGGFHINA+L++F+LS+ S  C+
Sbjct: 458 DMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGGFHINANLTNFVLSSASGKCV 517

Query: 443 LGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKA 502
           LG++P + N+  ILGD FLT+AYVVY+LD+LEISMAQA Y+ + E+IEVI+S++P+AVKA
Sbjct: 518 LGLLPYNGNSA-ILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKA 576

Query: 503 PGYTNTWSTSATIVTGGNIF 522
           PGY+ T+STS +IV+GGNIF
Sbjct: 577 PGYSYTYSTSKSIVSGGNIF 596

 Score =  105 bits (262), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 67/105 (63%), Gaps = 21/105 (20%)

Query: 41  FVKLPFHKLYGDSLDNVG---------------------RDKKPEAHLFKRADGYEEIII 79
           F+KL F K Y DS++++                      ++ KP  +L KR DGYEEI I
Sbjct: 41  FLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYEEIQI 100

Query: 80  TNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDT 124
            NQQSFYSV L +G+P Q++TVLVDTGSSDLW+ GS+NPYC S++
Sbjct: 101 INQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKSNS 145

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score =  400 bits (1027), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 238/517 (46%), Positives = 317/517 (61%), Gaps = 46/517 (8%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           KFVKL F KL GD ++N    + P     KR DG     I NQ +FYSV + VGSP Q+V
Sbjct: 33  KFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDV 92

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRD----DSSSSGALVNDINPFGWL 155
           T+L+DTGSSD+W+MGSNNPYC  +  S   + V+   D    D ++     +D+    +L
Sbjct: 93  TLLIDTGSSDIWVMGSNNPYC--EGSSGKSKHVLLHEDSGFEDDTNGKDFYSDL--LSYL 148

Query: 156 TGTGGLIGPTATGSGGSSETATQ-------------------SVPASEATMDCKEYGXXX 196
           T TG     TA  SG    TAT                    S+ + +AT+ C EYG   
Sbjct: 149 TATG-----TAEYSGSYWATATDVTVETTSYWPDDTDVPTATSMDSYQATISCSEYGTFA 203

Query: 197 XXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGI 256
                        F I YGD ++A G +G D + L D+ V+ +S AVAN +NST GVLGI
Sbjct: 204 TDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGI 263

Query: 257 GLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAV 316
           GLP LEVT   + A      + Y NFP +L + G I+ +AYSL++ND +A HG++LFGAV
Sbjct: 264 GLPGLEVT--NALAESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAV 321

Query: 317 DHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSG 376
           DHSKYTGTL TIP+VN++ ++    PIQFDVT++G+G++   +   T+TTT  PALLDSG
Sbjct: 322 DHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLHGLGIT-LNDTNTTITTTPFPALLDSG 380

Query: 377 TTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFIL 435
           TT T+LP  +V+ IA ++ A+Y    G+Y   C    DS ++VFDFGGFHI + L +F L
Sbjct: 381 TTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFAL 440

Query: 436 ST-------GSTCLLGIIPTSDNTGT-ILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTE 487
           +T          C L +IP   N G  ILGD+FLT AYVVYDL+NLEISMAQA  +  +E
Sbjct: 441 ATYDDDDNETDVCALALIPY--NRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGGSE 498

Query: 488 NIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTV 524
           +IE I S++PSAVKAPGY++TW+++  I TGGNIFT+
Sbjct: 499 DIEEIVSTVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  392 bits (1006), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 204/341 (59%), Positives = 264/341 (77%), Gaps = 8/341 (2%)

Query: 187 MDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSD-LNVTGLSFAVAN 245
           ++C  YG                F+I Y D +FASG +G DVL  SD LNVTGLSFAVAN
Sbjct: 282 INCDAYGTFDIENSSTYQSNQTGFAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVAN 341

Query: 246 ETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSD 305
           +TNST+GVLGIGLP+LEVTY+G    +  +P+ YDNFP+VLKNSGAI  +AYSLYLN   
Sbjct: 342 QTNSTVGVLGIGLPQLEVTYAG--VYQTTKPYTYDNFPLVLKNSGAIHKSAYSLYLNKQS 399

Query: 306 AEHGTILFGAVDHSKYTG-TLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTL 364
           A++G +LFGA+DHS+Y G TLYTIP+VN+ ++SG+S PI+FDVT+ G+GVSD++NG  T+
Sbjct: 400 AKNGNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYSKPIEFDVTLQGLGVSDNRNGNFTV 459

Query: 365 TTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGG 423
           TTT+I ALLDSGTTLTY P+ ++ L+A  I A YS  LGYYV++CP S D+TQ+VFDFGG
Sbjct: 460 TTTQIVALLDSGTTLTYFPKDMLNLLAKRINASYSEALGYYVMNCPDSRDNTQLVFDFGG 519

Query: 424 FHINASLSSFILSTGS-TCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQY 482
           FHI  +L++F+LS+ S  C+LG++P + N+  ILGD FLT+AYVVY+LD+LEISMAQA +
Sbjct: 520 FHIKTNLTNFVLSSASGKCVLGLLPYNGNSA-ILGDIFLTHAYVVYNLDDLEISMAQANF 578

Query: 483 NT-TTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIF 522
           N    E+IEVISS+IP+AVKAPGY+ T+S S +IV GG+IF
Sbjct: 579 NNGNDEDIEVISSTIPNAVKAPGYSYTYSVSKSIVPGGDIF 619

 Score =  108 bits (270), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 66/100 (66%), Gaps = 15/100 (15%)

Query: 40  KFVKLPFHKLYGDSLDNVG---------------RDKKPEAHLFKRADGYEEIIITNQQS 84
           KF+KL F K Y DS++++                ++ KP   L KR DGYE+I I NQQS
Sbjct: 39  KFLKLEFQKFYADSVNDIPPRDYSFNKRDSVLDLKNSKPYIKLIKRHDGYEKIQIINQQS 98

Query: 85  FYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDT 124
           FYSV L +G+P Q++TVLVDTGSSDLW+ GSNNPYC  ++
Sbjct: 99  FYSVNLQIGTPAQSITVLVDTGSSDLWVTGSNNPYCKGNS 138

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  377 bits (969), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 228/500 (45%), Positives = 312/500 (62%), Gaps = 76/500 (15%)

Query: 41  FVKLPFHKLYGDSLD--------NVGRDKK--PEAHLFKRADG-YEEIIITNQQSFYSVE 89
           F+ L F+KLYG S D        N+G+      ++ L+KRA   Y+E+ I NQQSFYS++
Sbjct: 36  FLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEIKNQQSFYSLD 95

Query: 90  LDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDI 149
           L +G+P QNVTV +DTGSSDL                                       
Sbjct: 96  LFIGTPGQNVTVQIDTGSSDL--------------------------------------- 116

Query: 150 NPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXY 209
               W+TG+     P   GS     T + +VP+ E   +C +YG                
Sbjct: 117 ----WVTGSNN---PYCNGS-----TFSDTVPSREL-FNCSQYGTFNTNKSSTWSSNNSR 163

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F I YGD TFASGT+G DV+ ++ LNVTGL+FAVAN +NS+  VLGIGL +LE TY+GS 
Sbjct: 164 FFIQYGDTTFASGTWGRDVMSINGLNVTGLTFAVANASNSSNSVLGIGLTQLETTYNGSN 223

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIP 329
           +S     + Y NFP+VLKN+G  ++ +YSL+LN+ DAE G+ILFGAVDHSKY+G LYT+P
Sbjct: 224 SSHS---YTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLP 280

Query: 330 IVNTLSASGFSSPIQFDVTINGIG-VSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVA 388
           +VNT    GF +PI+F VT+ GIG VS SK  + T+T TK+ A+LDSGT+LT LP T++ 
Sbjct: 281 LVNTYKDRGFPNPIEFAVTLQGIGIVSGSK--KTTITQTKLAAILDSGTSLTVLPGTIIH 338

Query: 389 LIADEIGAQYSYRLGYYVLDCPSDDS--TQIVFDFGGFHINASLSSFILS-TGSTCLLGI 445
            IA  +  +YS  +  Y++ C   +S  T +VFDFGGF I  +LS+FIL      C+LG+
Sbjct: 339 SIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFILEIEDDICILGL 398

Query: 446 IPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVI--SSSIPSAVKAP 503
               +N+  ILGD+FL +AYVVYDL+NL+ISMAQA+++ +T +I+VI  +S +PSA+KAP
Sbjct: 399 SSVDENS-VILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKAP 457

Query: 504 GYTNTW-STSATIVTGGNIF 522
           GY++TW +T ++I TGGNIF
Sbjct: 458 GYSSTWTATPSSISTGGNIF 477

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  377 bits (968), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 210/486 (43%), Positives = 306/486 (62%), Gaps = 38/486 (7%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           K VK  F+K       + GR       L KR D      + N+Q+FYS++L VG+P Q V
Sbjct: 36  KLVKFSFNK-------HQGRTFTASEELSKR-DKDVTFDLKNEQNFYSIKLSVGTPGQEV 87

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159
            VL+DTGSSDLWI GS+NPYC    + +S   + ++  ++ + G       PF  L G  
Sbjct: 88  VVLLDTGSSDLWIPGSDNPYC----KESSSFSISNQGKENGAEG-------PFQTLPG-- 134

Query: 160 GLIGPTATG-SGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGT 218
              G TAT  SGGS+         + AT+DCKE+G                FS+SYGD +
Sbjct: 135 ---GVTATNMSGGST---------ASATLDCKEFGTFNREDSKTFHSNDTEFSVSYGDTS 182

Query: 219 FASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFK 278
           +A GT+G D ++++D+N+T +S  VAN+TNS++G++GIGL  LE TY+G    + R   K
Sbjct: 183 YAIGTWGYDSININDVNLTNVSIGVANKTNSSVGIMGIGLSNLENTYTGVENVKNRNTHK 242

Query: 279 YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 338
           Y NFP++LK  G I+ N YSL+LN  +A  G+ILFGAVDHSKY+G LYT+P++N     G
Sbjct: 243 YLNFPMLLKEQGFIEKNVYSLFLNRREAFEGSILFGAVDHSKYSGQLYTVPMLNLYQQQG 302

Query: 339 FSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQY 398
              P+Q  VT+ G+G+ ++ N   T +TT +PALLDSGTTL YLP+ ++A++A+++ A +
Sbjct: 303 LKDPLQLQVTLQGVGI-EANNMTNTTSTTPVPALLDSGTTLVYLPDKMLAMLAEQLNAHW 361

Query: 399 SYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILSTG--STCLLGIIPTSDNTGTIL 456
              +GYYV DC   D+T + F+FGGF+I +++S++++S    ++C+LG+ P       IL
Sbjct: 362 DRGIGYYVTDCSRVDNTNLYFNFGGFNIVSNMSTYVVSRSNENSCVLGLQPGGPE-AAIL 420

Query: 457 GDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIV 516
           GD F+ +AY+V+DLD+ EISMAQA Y      +E ++  +PSA+KAPGY++T+S S  I 
Sbjct: 421 GDMFMQHAYIVFDLDDFEISMAQANYAGGKNQLEAVTQQVPSAMKAPGYSHTFSGSQGIT 480

Query: 517 TGGNIF 522
            GGNIF
Sbjct: 481 GGGNIF 486

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  377 bits (967), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 240/348 (68%), Gaps = 6/348 (1%)

Query: 181 PASEATMDCKEYGXXXXXXXXXXXXXXXY-FSISYGDGTFASGTFGTDVLDLSD-LNVTG 238
           P   + M+C +YG                 F  SYGDGTFA G FG D L  S  L+++G
Sbjct: 96  PYCGSAMNCDQYGVFDKANSSTFTANHSAPFYASYGDGTFAEGVFGQDKLHYSGGLDLSG 155

Query: 239 LSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYS 298
           LSFAVAN++NST+GVLGIGLP LEVTYSG  A   +R ++YDNFP+ LK SGAI   AYS
Sbjct: 156 LSFAVANKSNSTVGVLGIGLPMLEVTYSGKVAVADKRSYQYDNFPLFLKRSGAIDATAYS 215

Query: 299 LYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSK 358
           L+LND     G++LFGAVDHSKY G LYTIP+VN   A G+  P+ FDVT+ G+G+  ++
Sbjct: 216 LFLNDETQTSGSVLFGAVDHSKYLGQLYTIPLVNLYKAQGYQRPVAFDVTLQGLGL-QTR 274

Query: 359 NGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPS--DDSTQ 416
               TLTTT+IPALLDSGTTLTYLP   VAL+A  + A +S  LGYY   CP+  D++T 
Sbjct: 275 AHNTTLTTTRIPALLDSGTTLTYLPADAVALMAKSLNATFSKELGYYEYACPTSGDNATS 334

Query: 417 IVFDFGGFHINASLSSFILSTG-STCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEI 475
           +VFD GGFHINA LS F + T   TC+L I+P + N   ILGDSFL +AYVVYDLDN E+
Sbjct: 335 VVFDLGGFHINAPLSDFTMQTNVGTCVLAIVPQAGNATAILGDSFLRSAYVVYDLDNYEV 394

Query: 476 SMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFT 523
           S+AQA+Y +  E+IE I SS+P A +APGY +TW   A++ +GGNIFT
Sbjct: 395 SLAQAKYGSGKEDIEAIRSSVPGATRAPGYNSTWVNYASVTSGGNIFT 442

 Score = 92.8 bits (229), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 78/140 (55%), Gaps = 23/140 (16%)

Query: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRD 60
           M++ +  +AV  +L    V+  ++P              K+V++PF K          R 
Sbjct: 1   MKILSATTAVSLALLNSLVVGSVLP------------NVKYVRIPFAK----------RQ 38

Query: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120
             P + L KRA G E  +++N+QSFYSVEL +G+P QNVTVL+DTGS+DLW+  + NPYC
Sbjct: 39  NGPGSELGKRAGGDENFVLSNEQSFYSVELALGTPSQNVTVLLDTGSADLWVPSNANPYC 98

Query: 121 SSDTRSNSRRRVIDKRDDSS 140
            S    + +  V DK + S+
Sbjct: 99  GSAMNCD-QYGVFDKANSST 117

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  370 bits (949), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 228/503 (45%), Positives = 297/503 (59%), Gaps = 34/503 (6%)

Query: 26  VASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRA------DGYEEIII 79
           V +K          KF++L F + YG+S ++    K    HL KR         YE++I+
Sbjct: 31  VEAKEAKNIQPIKPKFLELKFDRHYGESYEDSTLGKDGAVHLEKRTFDSAYNGSYEDVIL 90

Query: 80  TNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDS 139
           TNQ +FYSVELD+G+P Q VTV+VDTGSSDLWI  ++NP+CS+           D  +DS
Sbjct: 91  TNQLTFYSVELDIGTPAQKVTVVVDTGSSDLWITETSNPFCSTGD---------DDTEDS 141

Query: 140 SSSGALVND-INPFGWLTGTGGL---IGPTATGSGGSSETATQ-----SVPASEATMDCK 190
             S  L+ D I+P   L   G     I  TAT + GS   +       ++P  E  ++C 
Sbjct: 142 VWSPFLLKDKIDP-RVLKHKGKRTTSIDVTATATTGSINISIDLGSNFTLPP-EFLINCT 199

Query: 191 EYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNST 250
           E+G                F ISYGD TFASG +G DVL   D+NVTGLSF VAN TNST
Sbjct: 200 EFGTFNTKKSSTFKNNHTDFFISYGDNTFASGYWGRDVLSFQDINVTGLSFGVANVTNST 259

Query: 251 MGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGT 310
           +GVLGIGLPELE TY G+  S     + Y+NFP VLKNSG I   AYSL+LN SD+  G+
Sbjct: 260 VGVLGIGLPELESTYFGTVNSVNESSYIYNNFPQVLKNSGIINKTAYSLFLNKSDSTQGS 319

Query: 311 ILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLT-TTKI 369
           +L GAVD SK+   LYT+P++N   + G++ P  F V +  +  +  K G+  L  +++I
Sbjct: 320 LLLGAVDTSKFADKLYTVPMLNINPSKGYTDPSAFLVLMQKM--TRYKYGQGHLVPSSRI 377

Query: 370 PALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPS---DDSTQIVFDFGGFHI 426
           P LLDSGTT+ YLP ++V  I     AQY   L  Y + CPS    + T   FDFGGF I
Sbjct: 378 PVLLDSGTTMVYLPRSIVEQIMRHEEAQYVEELDLYQIKCPSPNKKNQTSFSFDFGGFQI 437

Query: 427 NASLSSFILSTGS-TCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTT 485
            ASLS FI+ T +  C+ G+IP   N G ILGDSFLT+AYVVYDL++ EISMAQA Y+  
Sbjct: 438 KASLSDFIVPTDNGQCIFGMIPQDMNVG-ILGDSFLTHAYVVYDLEDYEISMAQAVYDGG 496

Query: 486 TENIEVISSSIPSAVKAPGYTNT 508
             N   I S++PSAV+A  Y+ T
Sbjct: 497 EPNYIPIVSTVPSAVRAKYYSAT 519

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  362 bits (929), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 207/461 (44%), Positives = 278/461 (60%), Gaps = 57/461 (12%)

Query: 80  TNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDS 139
           TN+  FYSVEL VG+P Q ++VL+DTGSSDLW+ G++N +C +   S+S     DK    
Sbjct: 64  TNRYIFYSVELSVGTPAQKLSVLLDTGSSDLWVPGADNLFCENHAVSDSNS--TDKP--- 118

Query: 140 SSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXX 199
                                L  PT              +P+ + T+DC +YG      
Sbjct: 119 ---------------------LKSPT--------------LPSPQPTIDCNQYGTFDYSK 143

Query: 200 XXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLP 259
                       I YGD ++A G FG D ++++ L++  +S  VA++ N T GVLGIGL 
Sbjct: 144 SSSFKANDSSLLIRYGDQSYALGRFGQDTVEMNSLSIPNVSLGVAHQANVTQGVLGIGLA 203

Query: 260 ELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHS 319
            LE T +G +++   + + Y+NFP VLK+ G I  NAYSL+LN   A  G ILFG VDHS
Sbjct: 204 GLETTNTGFSSTLNSKSYTYENFPQVLKSQGIIDANAYSLFLNSPGASQGGILFGGVDHS 263

Query: 320 KYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVS-DSKNGEK----------TLTTTK 368
           KYTG LYT+PI+NT  A G  +PIQF VT+ G+G+S D  NG            TLT +K
Sbjct: 264 KYTGPLYTVPIINT-GAPG--NPIQFQVTLQGVGISLDKSNGTNTNAADSTSNVTLTASK 320

Query: 369 IPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHIN 427
            P LLDSGTTL  LP  V   +A ++GA Y+    YY L CPS +D+T+++ DFGGF +N
Sbjct: 321 FPVLLDSGTTLMTLPRPVTDQMAKQLGATYNSETSYYQLKCPSQNDNTRLILDFGGFQVN 380

Query: 428 ASLSSFIL-STGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTT 486
           A +++ I  S    CLLGI P+  ++GT LGD FL +AYVVYDLDN EIS+AQA ++ + 
Sbjct: 381 AKITNHITRSQNGECLLGITPSDTDSGT-LGDVFLVDAYVVYDLDNYEISLAQADFSDSA 439

Query: 487 ENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSS 527
           ++IE ISSS+PSA KAPGY+NTW+ S +I TGGNIFT  +S
Sbjct: 440 QSIEPISSSVPSATKAPGYSNTWTGSESIKTGGNIFTAQTS 480

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  362 bits (928), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 212/501 (42%), Positives = 280/501 (55%), Gaps = 70/501 (13%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           +V+    K  G+   +  +   P   L KR D Y ++ I N+Q+FYSV L +G+P Q VT
Sbjct: 31  YVRFDLDKTRGNDFRSSEKGVMPFGELKKRDDEYVDVKIHNEQTFYSVNLSIGTPAQEVT 90

Query: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGG 160
           VLVDTGSSDL                                           W+ G   
Sbjct: 91  VLVDTGSSDL-------------------------------------------WIIGADV 107

Query: 161 LIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFA 220
             GP  + S                 +DC EYG                F ISYGD +FA
Sbjct: 108 DCGPDNSDS--------------TEPLDCFEYGAFDKSKSSSWKNNHTEFYISYGDTSFA 153

Query: 221 SGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYD 280
           SG +GTD LDL DLN  GL+FAVA  +NS++ VLGIGL  +EVT      + G   ++YD
Sbjct: 154 SGEWGTDKLDLGDLNADGLTFAVATASNSSVAVLGIGLTGIEVT-----RASGDNGYEYD 208

Query: 281 NFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFS 340
           N PIVLK +G I   AYSLYLND DA  G++LFGAVDHSKYTGTL T+P+VN  +  GF 
Sbjct: 209 NLPIVLKRNGVIDKTAYSLYLNDLDATSGSVLFGAVDHSKYTGTLATVPLVNVNARYGFP 268

Query: 341 SPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSY 400
            PI+  +T+NG+G S  K    T++ TK+PALLDSGTTL+Y P  + A IA  +GA ++ 
Sbjct: 269 KPIELHITLNGLGFSSGKK-RGTISATKVPALLDSGTTLSYFPTELAAAIASNVGAVWNA 327

Query: 401 RLGYYVLDC--PSDDSTQIVFDFGGFHINASLSSFILSTG--STCLLGIIPTSDNTGTIL 456
           RL  +++ C     ++  ++++FGG  I + L +++  T     CLLGI+PTS N   IL
Sbjct: 328 RLRKFLIPCSQAKRNNIDLIYNFGGVEITSPLVNYLSETNVEDVCLLGIVPTSSND-IIL 386

Query: 457 GDSFLTNAYVVYDLDNLEISMAQAQYNTTT--ENIEVISSSIPSAVKAPGYTNTWSTSAT 514
           GD FLT+ Y VYDL+ LE+S+AQA Y  +   ENIEVI S++P A KAPGY+NTWST A 
Sbjct: 387 GDVFLTSVYTVYDLEALEVSIAQAAYGASAEKENIEVIKSTVPGATKAPGYSNTWSTYAP 446

Query: 515 IVTGGNIFTVDSSQTASFSGN 535
           I TGGN+F   ++ +    G 
Sbjct: 447 ISTGGNMFNAAANHSEESQGQ 467

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  355 bits (912), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 210/472 (44%), Positives = 284/472 (60%), Gaps = 52/472 (11%)

Query: 43  KLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVL 102
           KL F+KL G++ +               ++G+    I NQQ+FYSVEL VG+P QNV VL
Sbjct: 27  KLSFNKLRGETFEKA----------VGNSNGHANFDIKNQQNFYSVELKVGTPAQNVLVL 76

Query: 103 VDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLI 162
           +DTGSSDLWI GS NPYCS  TR++                                G  
Sbjct: 77  LDTGSSDLWITGSGNPYCSPSTRNSHL------------------------------GSA 106

Query: 163 GPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASG 222
           G  ++ + G S TA  + P+S AT+DC +YG                F ++YGDG+FA G
Sbjct: 107 GSNSSTNNGPSSTA--NFPSSSATIDCSQYGTFNLDGSETFKSNDSTFYLTYGDGSFAKG 164

Query: 223 TFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNF 282
            +G D + L  LNV+ +SFAVANE+NST+GV G+GLP  E T    T       ++Y NF
Sbjct: 165 LWGMDHVYLDGLNVSDVSFAVANESNSTVGVFGVGLPGEEATV---TPGVNGNHYQYKNF 221

Query: 283 PIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSP 342
           P VLK++G ++ NAYSLYLN  D+  G ILFGAVDHSKY+G LYT+PIVNT +  G  +P
Sbjct: 222 PQVLKDNGVVQKNAYSLYLNSPDSNSGNILFGAVDHSKYSGNLYTLPIVNTYADQGV-AP 280

Query: 343 IQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRL 402
            +FDVT+ GI V +S +   T+++ K  ALLDSGTTL YLP  +   +A  +G ++S   
Sbjct: 281 REFDVTVQGITVGNSSS-NSTVSSDKTLALLDSGTTLMYLPTALADELAKSLGGKFSPST 339

Query: 403 GYYVLDCPSD-DSTQIVFDFGGFHINASLSSFILSTGS---TCLLGIIPTSDNTGTILGD 458
           GYY++  PS+ D T+I FDFGGFHI   LS++IL         +LGI+ T  +   I GD
Sbjct: 340 GYYLIPKPSENDDTKITFDFGGFHIETKLSNYILQGSGPQDVAILGILRTEGDR-AIFGD 398

Query: 459 SFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWS 510
            FL +AYVVYDL++ EIS+AQA +N+ + +IE IS S+P A +APGY+ T++
Sbjct: 399 VFLVDAYVVYDLEDYEISLAQANFNSGSSDIEAISGSVPGASRAPGYSQTYT 450

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  348 bits (893), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/493 (41%), Positives = 286/493 (58%), Gaps = 42/493 (8%)

Query: 40  KFVKLPFHKLY-----GDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGS 94
           K+V++ FHK       GDSL              +RAD Y  + + NQQ +YSVEL VG+
Sbjct: 26  KYVQMGFHKSRSFSSGGDSLA-------------RRADDYLSVDVENQQLYYSVELYVGT 72

Query: 95  PPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGW 154
           PPQNV+VL+DTGSSDLW+   +NPYC    +  S +  +++++ ++++     +      
Sbjct: 73  PPQNVSVLIDTGSSDLWLTSPDNPYCIGFKQPGSAKFALEEKEAANATVLTAQNAE---- 128

Query: 155 LTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISY 214
                   GPT       S  A ++        DC   G                F   Y
Sbjct: 129 --------GPT------RSSKAAKATGGHLDQFDCALLGTFNNSESSSFKSNNTDFLTGY 174

Query: 215 GDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGR 274
            D TFASG +GTDV+ + D++V+ +S AV N TNST  VLGIG+P LE + +G  A+   
Sbjct: 175 ADNTFASGFWGTDVVRIGDVDVSDVSLAVVNLTNSTSPVLGIGMPVLESSNAGRLAAETN 234

Query: 275 RPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTL 334
             ++YDNFP+ LKN G I+  AYSL+LNDSDA  G++LFGAVDHSKY   L+T+P+VNT 
Sbjct: 235 SSYEYDNFPVQLKNKGVIEKIAYSLFLNDSDATEGSVLFGAVDHSKYENGLFTVPMVNTY 294

Query: 335 SASGFSSPIQFDVTINGIGVSDSKNG-EKTLTTTKIPALLDSGTTLTYLPETVVALIADE 393
              G   PI+F VT+ G+G    K+G   T+TTT  P LLDSG+T +YLP+T+V+++A  
Sbjct: 295 KDQGVQHPIEFYVTMYGLGF--KKDGFLNTITTTNFPVLLDSGSTTSYLPDTLVSMLASA 352

Query: 394 IGAQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFILST-GSTCLLGIIPTSDN 451
           + A +S ++  Y L CPS +D+T + FD GGF I+  LS  +     + C+L +    + 
Sbjct: 353 LNATFSEKINGYTLKCPSEEDATFLSFDLGGFLIDVPLSDLVAKRHKNQCVLMVKGQGEG 412

Query: 452 T-GTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWS 510
             G ILGD+FL++AYVVYDL++ EIS+ QA      E+IEVI S++P AV+AP Y   W+
Sbjct: 413 EGGYILGDTFLSSAYVVYDLESYEISIGQASTGDAAEDIEVIKSTVPGAVRAPFYDRPWT 472

Query: 511 TSATIVTGGNIFT 523
               I   GNI T
Sbjct: 473 GGTVISMSGNIST 485

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  346 bits (888), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 228/549 (41%), Positives = 313/549 (57%), Gaps = 51/549 (9%)

Query: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRD 60
           MRL +V + +L  L AL V + I P  SK            V +PF K  G +       
Sbjct: 1   MRLESVFAVLL--LPALGVGSVIEPETSKH-----------VSIPFKKAKGKTFSGSADS 47

Query: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120
            K    L KR D YE + +   +  Y VEL +G+P Q   V +DTGSSDLW+  S+NPYC
Sbjct: 48  NKWRNRLSKRGDDYENLGLKTDKLAYYVELSLGTPGQKFEVQLDTGSSDLWVYDSHNPYC 107

Query: 121 -SSDTRSNSRRRVIDKRDDSSSSGALVND---INPFGWLTGTGGLIGPTATGSGGSSETA 176
             S+T  N      +K    ++ G    D   ++ F  L  +     P        S T 
Sbjct: 108 MPSETTHN------EKVYGEAAYGETAFDQTALDQFETLLASATEDDP--------SYTQ 153

Query: 177 TQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNV 236
           T++VP+SEAT+DC  +G                F ISY D T A G +  DVL L DL +
Sbjct: 154 TEAVPSSEATIDCASFGTFNYTLSSSFSANDTEFYISYLDSTAAYGIWAQDVLKLGDLEI 213

Query: 237 TGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNA 296
           + + FAVA   +    V G+G P  E T +GS+    + P++Y NFP++LK+ G +K   
Sbjct: 214 SDMPFAVAVVGDVQTPVFGVGFPGTEST-AGSSV---KEPYEYANFPVLLKSQGYVKKVV 269

Query: 297 YSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIV------NTLSASGFSSPIQFDVTIN 350
           YSL+L+  D+  G+ L GAVDHSKY+G LYT+P+       +TLS    S+P +F +T+ 
Sbjct: 270 YSLFLDAQDSSSGSFLLGAVDHSKYSGGLYTLPMYSGTDGDDTLS----STPSRFIITLQ 325

Query: 351 GIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP 410
           G+G+SD K   KT+ TT+    LDSG+T T  P     LIAD +GA YS     YV+ CP
Sbjct: 326 GLGISD-KGENKTVATTRSLVYLDSGSTGTVFPSEYAELIADSLGASYSGDYEAYVMKCP 384

Query: 411 S-DDSTQIVFDFGGFHINASLSSFILSTG--STCLLGIIPTSDNTGTILGDSFLTNAYVV 467
           S DD T  V+DFGGF I++ LS+++ +TG  S C+L I  T D    +LGD+FL +AYVV
Sbjct: 385 SKDDDTNFVYDFGGFTISSPLSNYMEATGDDSVCVLDI-DTDDIPYIVLGDAFLVSAYVV 443

Query: 468 YDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFT-VDS 526
           YDL++ EIS+AQA Y+  +ENIEV+S SIPSAVKAP Y++TWST  T  +GGNIFT V +
Sbjct: 444 YDLEDYEISIAQANYDGGSENIEVVSDSIPSAVKAPFYSSTWSTYVTATSGGNIFTAVAN 503

Query: 527 SQTASFSGN 535
           ++TAS + +
Sbjct: 504 AKTASHTAS 512

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  341 bits (875), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 215/487 (44%), Positives = 290/487 (59%), Gaps = 60/487 (12%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           FV + F K YG S+ +    K    +L KR+ G +E+ + N+  FY++++++G+P Q+VT
Sbjct: 27  FVGVQFSKRYGKSISDSSLAK---GNLVKRSSGTDEVELINESVFYAIDMEIGTPKQSVT 83

Query: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGG 160
           VLVDTGSSD                                            W+     
Sbjct: 84  VLVDTGSSDF-------------------------------------------WV----- 95

Query: 161 LIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFA 220
              P++T     S++AT ++ +S+  +DC  YG                F   Y DG+ A
Sbjct: 96  ---PSSTNPYCESKSATSTIASSD-LIDCTTYGTFSVSDSSSFVYNNTDFQTQYADGSSA 151

Query: 221 SGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRP-FKY 279
           +G +G DV+D     ++ +S AVA++T+S+ GVLGIGL  LE TYSGS A+      ++Y
Sbjct: 152 TGFWGHDVVDFGGQELSDISIAVADQTDSSFGVLGIGLTGLESTYSGSAAASSSTGRYQY 211

Query: 280 DNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGF 339
           DNFPI L     I+ NAYSLYL+ +    GTILFG VDH+KY+G L TIP++NTL A+G+
Sbjct: 212 DNFPIRLVQENVIQANAYSLYLDPATGSSGTILFGGVDHNKYSGDLNTIPLINTLEANGY 271

Query: 340 SSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYS 399
           +SPI+  VT+NG+GVSD  +   T+TTT+IPALLDSGTTLTYLP  +  L+A++IGA YS
Sbjct: 272 TSPIKLQVTLNGLGVSDGSS-TSTVTTTQIPALLDSGTTLTYLPTAMFDLLAEQIGATYS 330

Query: 400 YRLGYYVLDCPS-DDSTQIVFDFGGFHINASLS-SFILSTGSTCLLGIIPTSDNTGTILG 457
                YVL C + D+ + IV+DFGGF I   L+ S    +   C L I  TS +  T LG
Sbjct: 331 STSNGYVLSCANVDEDSMIVYDFGGFQIQTPLAGSLYQLSDDQCELAIGSTSSSYAT-LG 389

Query: 458 DSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVT 517
           D FLT+AYVVYDLDN EISMAQ  YN TTE+IE+IS S+P A KA GY NTW+TS +I  
Sbjct: 390 DLFLTHAYVVYDLDNKEISMAQINYNATTEDIEIISDSVPGATKAAGYYNTWTTSESITA 449

Query: 518 GGNIFTV 524
           GGNIFT+
Sbjct: 450 GGNIFTL 456

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  340 bits (871), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/478 (42%), Positives = 276/478 (57%), Gaps = 49/478 (10%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEI---IITNQQSFYSVELDVGSPPQ 97
           +V   F K  G S        +P   L +R  G  +    ++ N++ FYSV+L++G+PPQ
Sbjct: 28  YVSFNFGKSLGSSFHGARGGSRP-GKLHRRDSGSSDSALSVLKNEEVFYSVKLNIGTPPQ 86

Query: 98  NVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTG 157
           ++TVL DTGSSDLW+  ++NP+C +D         +++R D  SS               
Sbjct: 87  DITVLFDTGSSDLWVSSNSNPFCEADG--------VNRRADLKSSSTYS----------- 127

Query: 158 TGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXX-XXYFSISYGD 216
               + P+ T  G       +  P    T+DC E+G                 F I YGD
Sbjct: 128 ----VAPSTTIDG------FEVAP----TVDCAEFGTFNPNKSSTFRPQGNDTFMIMYGD 173

Query: 217 GTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRP 276
           GTFA+G +  D L L   +++ L FAVAN ++S +GVLG+GL  LE     S       P
Sbjct: 174 GTFANGLWAKDTLSLDGHDISNLQFAVANMSDSDVGVLGVGLTGLE----SSADPFDDEP 229

Query: 277 FKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSA 336
            +Y NFP+VLK +  I   AYSLY+N  DAE G++LFGAVDHSKYTG LYTIP+VN L+ 
Sbjct: 230 SQYPNFPVVLKQNNVISKMAYSLYINSLDAEAGSVLFGAVDHSKYTGGLYTIPLVNALAQ 289

Query: 337 SGFSSPIQFDVTINGIGVSDSKNG-EKTLTTTKIPALLDSGTTLTYLPETVVALIADEIG 395
                 ++FDVT+ G+G+   KN  +KTLTT + PAL+DSGTTL Y+   +   IAD +G
Sbjct: 290 YFVDEILEFDVTVQGLGIESKKNCFQKTLTTAQFPALMDSGTTLIYIDPDLADAIADSLG 349

Query: 396 AQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFILSTG--STCLLGIIPTSDNT 452
           A  S     Y  +CP+ DD TQ+VFDFGGF I   LS+++L T     C LG++P+  N 
Sbjct: 350 ATMSDDYELYTFECPAKDDDTQLVFDFGGFQITNPLSNYVLETDDEKVCGLGVVPSYSN- 408

Query: 453 GTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWS 510
             ILGD FL +AYVV+DL+NLE+S+ QA  N   E+IE I S++P A KAPGY++TW+
Sbjct: 409 --ILGDEFLASAYVVFDLENLELSIGQANLNPGPEDIEPIISTVPGAQKAPGYSSTWT 464

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  338 bits (868), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 213/479 (44%), Positives = 272/479 (56%), Gaps = 46/479 (9%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEII---ITNQQSFYSVELDVGSPPQ 97
           +V + F K  G S  +     +P A L KRA    E +   + N   FYSV LD+G+PPQ
Sbjct: 35  YVAIDFAKAKGISYQDARVGARP-AKLQKRALSQGETLNSELVNNNVFYSVGLDIGTPPQ 93

Query: 98  NVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTG 157
            VTVL DTGSSDLW+  ++NPYCS+    +S     + R D  SS AL            
Sbjct: 94  QVTVLFDTGSSDLWVSSNDNPYCSN---GDSTESYANYRADLKSSSALT----------- 139

Query: 158 TGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXY-FSISYGD 216
                 PT T SG +             T+DC +YG                 F +SY D
Sbjct: 140 ----AAPTTTISGITIA----------PTIDCAQYGTFNADRSTSLFANYSKPFFVSYND 185

Query: 217 GTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELE--VTYSGSTASRGR 274
            ++A G +  D L +   +++ L FAVA  +NST+GVLG+GL  LE  V Y     S   
Sbjct: 186 DSYALGYWARDKLVVDGDDISSLEFAVAEISNSTVGVLGVGLQGLESTVHYRSPNISS-- 243

Query: 275 RPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTL 334
               Y NFP+VLK +GAI   AYSLYLN  DA  G++LFG VDHSKYTG LYT+P+VNT 
Sbjct: 244 ---IYPNFPMVLKENGAIDKIAYSLYLNSLDAPSGSVLFGGVDHSKYTGGLYTLPLVNTY 300

Query: 335 SASGFSSPIQFDVTINGIGVSDSKNG-EKTLTTTKIPALLDSGTTLTYLPETVVALIADE 393
              G  +P+QFDVT+ GIG+   K   ++T TTTKI AL+DSGTTL Y    +V  IA  
Sbjct: 301 KDYGVKTPVQFDVTVQGIGIESEKACRQETFTTTKIAALMDSGTTLMYTAPEIVNKIALY 360

Query: 394 IGAQYSYRLGYYVLDCPSD-DSTQIVFDFGGFHINASLSSFILSTG--STCLLGIIPTSD 450
           + A +S   G ++  CPSD D TQ +FDFGGF I + LS++IL T   + C LG+I  S 
Sbjct: 361 VNASFSPGYGLFMFRCPSDGDDTQFIFDFGGFQIKSPLSNYILRTDDENICGLGLI--SS 418

Query: 451 NTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTW 509
           N GTI GD FL +AYVVYDL+NLE+S+AQA +N  +  IE I S IP A +A  Y NTW
Sbjct: 419 NQGTIFGDEFLASAYVVYDLENLELSLAQANWNPGSPEIEKIVSEIPRAQRASQYWNTW 477

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  325 bits (832), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/488 (38%), Positives = 260/488 (53%), Gaps = 70/488 (14%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           +FV++ F K  G S       +     L KR D + +I I NQQ FYSV L +G+PPQ V
Sbjct: 29  QFVRMDFDKKRGPSFSEAWSGRAAVPRLAKRND-WVDIEIDNQQMFYSVNLSIGTPPQEV 87

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159
            VL+DTGSSDL                                           W+ G G
Sbjct: 88  RVLMDTGSSDL-------------------------------------------WVVGAG 104

Query: 160 GLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTF 219
              GP              + P +   ++C E+G                F I YGD T+
Sbjct: 105 VRCGP-------------NNYP-NPNQLNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTY 150

Query: 220 ASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKY 279
           A GT+GTD LDL   NV GL+FAVA+ +NS++ VLGIGLP +E T S          ++Y
Sbjct: 151 AHGTWGTDRLDLGQANVDGLTFAVAHASNSSVAVLGIGLPAMETTMSSQQFG-----YQY 205

Query: 280 DNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGF 339
           DN P+VLK +  IK   YS+++N+ +A+ G++LFGAVDHSKY GTL T+P+VN       
Sbjct: 206 DNLPMVLKRNNVIKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRV 265

Query: 340 SSPIQFDVTINGIGVSDSKNGEK--TLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQ 397
           + P++  VT+  IG+   ++ +K  TL  +K+PALLDSGTTLTY P  +   +A   GA+
Sbjct: 266 NKPVELHVTLAAIGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQLADRLARAAGAR 325

Query: 398 YSYRLGYYVLDCPSD--DSTQIVFDFGGFHINASLSSFILSTG--STCLLGIIPTSDNTG 453
           +      Y++DC S     T  ++DFGGF I + LS + + T    TC  GI+P S +  
Sbjct: 326 WHSEEVGYIVDCNSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDY- 384

Query: 454 TILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSA 513
            ILGD FLT AYVV+DL+ LE+SMAQA Y    E IEVI+ ++P AV+APGY + W    
Sbjct: 385 VILGDVFLTRAYVVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYT 444

Query: 514 TIVTGGNI 521
            +V  G +
Sbjct: 445 PLVFNGEL 452

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  324 bits (830), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 193/508 (37%), Positives = 295/508 (58%), Gaps = 30/508 (5%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRA-DGYEEIIITNQQSFYSVELDVGSPPQN 98
           K++KL F K   D  + +         L KRA D      +  Q+++YS+ L+VG+PPQN
Sbjct: 20  KYLKLDFEKHRADIDEELPLTHSAARQLRKRASDDSVAFPLVAQENYYSINLEVGTPPQN 79

Query: 99  VTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGT 158
           V++L+DTGSSD+W++GSNN YC +   S+++ R +D    +  +    +  +        
Sbjct: 80  VSLLLDTGSSDMWVIGSNNGYCKN---SDNKSRNLDALGSNRFAKRASSVASASPSSATD 136

Query: 159 GGLIGPTATGSGGSS--ETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGD 216
                             TA   +PA+  T+DC+                   F  SYGD
Sbjct: 137 SDGGDDGDDSGDAEQFYPTAASEIPAAAKTLDCQSLSLFDLEKSSSFKSNSTPFFTSYGD 196

Query: 217 GTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELE-------------- 262
            ++ASG +GTD + L +L++  + FAVAN +NS+ GVLG+GLP LE              
Sbjct: 197 NSYASGLWGTDDVRLGNLSIADVFFAVANFSNSSTGVLGVGLPALESYNPALSDNFNVSD 256

Query: 263 ---VTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHS 319
              V  S +      +P  Y NFP +LK    I+  AYSL+LND++A +G ILFGAVDHS
Sbjct: 257 YLPVNASDADIDNISKP-TYANFPQILKQKNVIEKVAYSLFLNDTNATNGQILFGAVDHS 315

Query: 320 KYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTL 379
           KYTG+L T+P+VN+L   G +   Q ++T++G+G+ +S+ G+ T+   K+PALLDSGTT+
Sbjct: 316 KYTGSLSTLPLVNSLYVEGINDTTQLEITLDGMGLKNSQ-GQFTIYNQKMPALLDSGTTV 374

Query: 380 TYLPETVVALIADEIGAQYSYRLGYYVL-DCPS-DDSTQIVFDFGGFHINASLSSFI-LS 436
           +YLP  + +L+A ++      + G+  L +CP+ +D+TQ+VF+FGG  I+   + FI  S
Sbjct: 375 SYLPIDLHSLVAKQLKGIVDPQTGFIELKNCPAKNDNTQLVFNFGGAFISIKYTEFIEKS 434

Query: 437 TGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSI 496
               C +  +P  +  G +LGD+FL NAY+VYDL+++EIS+AQA +N   ENIE I  ++
Sbjct: 435 DDDNCYVTFMPQGE-PGILLGDNFLRNAYIVYDLEDMEISIAQANFNGGAENIEAIVKNV 493

Query: 497 PSAVKAPGYTNTWST-SATIVTGGNIFT 523
           PSAVKAPGY+ +++   ++  T GNIF+
Sbjct: 494 PSAVKAPGYSASFTEFPSSYATTGNIFS 521

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  312 bits (800), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 200/528 (37%), Positives = 296/528 (56%), Gaps = 35/528 (6%)

Query: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRD 60
           M+   +R+ + +S+ A    A I+    K          K++KL F         +   +
Sbjct: 1   MKALNLRAILATSVIASLTSALIV---DKNVEQLSSNENKYLKLDFA--------SETFE 49

Query: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120
           K     L KR D Y  + I+  + +Y V+L VG+P QNVT+LVDT SSD+W+   +NP C
Sbjct: 50  KSSRLPLQKR-DTYATVNIS-AEFYYVVQLSVGTPGQNVTLLVDTCSSDIWVTSPDNPLC 107

Query: 121 SSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSV 180
             D   ++  +       +++  + V+D +  G L G      P +T    SS      +
Sbjct: 108 DGDIFYDNVEKTAKHVVVAAAEESTVSDGDSNGLLDGE-----PVSTTPFESS-----VI 157

Query: 181 PASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLS 240
             +E  +DC  +G                F I+Y D + A G +G DVL +  L+++G+ 
Sbjct: 158 YPAEGLVDCGFFGTFNPNDSSTWSTNHTDFVITYSDNSTAEGVWGQDVLSIGGLDISGVP 217

Query: 241 FAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLY 300
           FAVAN TNS++GVLGIGLP  E TY  ++       + YDN P+VLK SG I + AYSL 
Sbjct: 218 FAVANYTNSSLGVLGIGLPGSETTYLTNS-------YMYDNLPMVLKKSGVIDSAAYSLL 270

Query: 301 LNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNG 360
           L   +     +LFGAVDHSKY+G+LYTIP++N   + G+ SP++FDVTI G+G+S S + 
Sbjct: 271 LAAYNNYTSGLLFGAVDHSKYSGSLYTIPMINIYESRGYESPVEFDVTIYGLGIS-STDS 329

Query: 361 EKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFD 420
             T+ T K PALLDSG+T  + P T++ L A+++ A YS   G Y +   S  +   VFD
Sbjct: 330 NTTIATMKTPALLDSGSTAIFFPTTLLNLAAEQLNATYSEEKGLYTIPY-SPANISFVFD 388

Query: 421 FGGFHINASLSSFI-LSTGS-TCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMA 478
           FGGFHIN  +     +S G    +L I+  ++N   +LG++FL  AYVV+D +N EISM 
Sbjct: 389 FGGFHINLPIRELCSVSYGEPEYILNIVAHNENR-IVLGEAFLARAYVVFDFENYEISMG 447

Query: 479 QAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDS 526
           Q+ Y+   E+IE I S++P AVK   Y+N+WS+  +I +GG+IFT+ S
Sbjct: 448 QSSYDYAEEDIEAIISTVPGAVKVASYSNSWSSFGSITSGGDIFTISS 495

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  306 bits (785), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 200/503 (39%), Positives = 284/503 (56%), Gaps = 50/503 (9%)

Query: 43  KLPFHKLYGDSLDNVGRDKKPEAHLFKRADG--YEEIIITNQQSFYSVELDVGSPPQNVT 100
           K+PF K YG S D     +  +    ++  G   +EI I+NQ  +YS  + +G+P Q +T
Sbjct: 31  KIPFSKRYGKSFD-----ESRQISFSEKGTGGDDQEIDISNQNVYYSASIYLGTPGQELT 85

Query: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGG 160
           +L+DTGSSDLWI      +C SD+   ++ +          S  + + +  F   +  GG
Sbjct: 86  LLLDTGSSDLWIPQKGGYHCQSDSDDATKGK----------SSGIASQL--FSIASAEGG 133

Query: 161 --------LIGPTATGSGGSSETATQSV-PASEATMDCKEYGXXXXXXXXXXXXXXXY-- 209
                   LIG +        E   ++V P +  T    E                 +  
Sbjct: 134 PSPSLTTTLIGSSGGSHPDPLEPTNRNVQPPAAITASALEESCQSSSGNFDPNSSSSFNK 193

Query: 210 ------FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEV 263
                 F I YGD ++ASG + TD L + D++V  ++ AVA++TNS++ V GI    LE 
Sbjct: 194 NDTVDGFFIEYGDNSYASGYWATDDLTVGDISVKDMTIAVADDTNSSVAVFGISYRGLES 253

Query: 264 TYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTG 323
           +  G      + P +Y+NFP +LK+ G +K NAYSLYLN + A  G ILFG VDH+KY+G
Sbjct: 254 SVFGDNL---QDPHEYENFPYLLKDQGIVKRNAYSLYLNSAGASDGNILFGGVDHNKYSG 310

Query: 324 TLYTIPIVNTLSASGFSSPIQ-FDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYL 382
            LYT+P+   L     S P + F VT+ GIG+  S+  + TLTTT    LLDSGTT  YL
Sbjct: 311 DLYTLPV---LKGQEDSDPWERFVVTVQGIGIKGSET-QNTLTTTPFIGLLDSGTTAVYL 366

Query: 383 PETVVALIADEIGAQY--SYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILSTGS- 439
           PE V  ++A+  G  +     +  YV+ CPSDD  +IVF+FGGF+I  SLS++I   G+ 
Sbjct: 367 PEPVADMVANAYGGSFDDDPEVQSYVISCPSDDE-KIVFNFGGFNIETSLSNYITDNGNG 425

Query: 440 TCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSA 499
            C+L I PTSD  G ILGDSFL ++YVVYD+DN EIS+AQA ++ +TE++E I+  +P A
Sbjct: 426 QCILNISPTSDYMG-ILGDSFLRDSYVVYDMDNNEISLAQANFD-STEDVEAITGPVPGA 483

Query: 500 VKAPGYTNTWSTSATIVTGGNIF 522
            KAPGY++T+S   T  TGGNIF
Sbjct: 484 TKAPGYSSTYSGPQTFQTGGNIF 506

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  301 bits (772), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 181/456 (39%), Positives = 244/456 (53%), Gaps = 65/456 (14%)

Query: 67  LFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRS 126
           L+KR      + + N+Q FY+ +L+VG+PPQN+TVL+DTGSSDLW+ GS+NPYC S+  +
Sbjct: 41  LWKRNQNSLALNLKNEQIFYAADLNVGTPPQNLTVLLDTGSSDLWVTGSDNPYCLSNETT 100

Query: 127 NSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEAT 186
               + I                                           T+SV      
Sbjct: 101 TEPSKNI-------------------------------------------TKSV------ 111

Query: 187 MDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANE 246
           +DC  YG                F I+Y D TFA+G +  DV+   D  +  + FAVANE
Sbjct: 112 VDCSRYGTFEKDNSLTFSQSDSRFQINYADNTFANGYWAKDVVSFGDNFIADMQFAVANE 171

Query: 247 TNSTMGVLGIGLPELEVT--YSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDS 304
           TNST+GVLGIG   LE    Y G+  +       Y NFP+ LKN+G I   AYSLYLN  
Sbjct: 172 TNSTVGVLGIGFERLESVKGYEGAPNTY------YQNFPLALKNNGVIDKTAYSLYLNSL 225

Query: 305 DAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTL 364
           D+  G+ILFG +D +KYTG LYT P+VN +  S  + P +F VT+ GIGV  S + +  L
Sbjct: 226 DSSSGSILFGGIDSNKYTGDLYTFPLVN-IHPSVVNKPAKFHVTVQGIGVQSSGSEQSIL 284

Query: 365 TTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDC-PSDDSTQIVFDFGG 423
            +TK PALLDSGTTL   P+     +A+ + A Y+   G Y + C P +D T+ +FDFG 
Sbjct: 285 MSTKYPALLDSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPENDDTEFLFDFGD 344

Query: 424 FHINASLSSFILST--GSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQ 481
             I   L +FIL+      C  G++PT D    ILGD FL+ AYVVYDL++ E+S+AQA 
Sbjct: 345 LKIKVPLKNFILAPEDNEYCGFGVLPTVDT--MILGDMFLSAAYVVYDLESYEVSLAQAN 402

Query: 482 YNTTTENIEVISSSIPSAVKAPGYTNTWSTSATIVT 517
           +N+    I+ I  ++P A KA     TWS   T  T
Sbjct: 403 WNSDESEIQAIRHTVPGATKATA--ATWSPYETTAT 436

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  299 bits (766), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 176/485 (36%), Positives = 270/485 (55%), Gaps = 53/485 (10%)

Query: 60  DKKPEA--HLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNN 117
           +K P+A   L KR D Y  + + N    Y V+L VG+PPQN+TV +DTGSSDLW   ++N
Sbjct: 22  EKSPKASSDLVKRDDEYVNVPLKNDGDLYLVQLAVGTPPQNITVQLDTGSSDLWFPSADN 81

Query: 118 PYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETAT 177
           P+C  + +   + + +   DDS             G+                    +A+
Sbjct: 82  PFCKENKKYAPKGKDVQPLDDS-------------GY-------------------PSAS 109

Query: 178 QSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVT 237
             VP S  T++CK+YG                F +SY D +FA+G +G+DV+  ++LN++
Sbjct: 110 NQVPKSSRTLNCKKYGVFNSSESSTFKRNDSEFLLSYADMSFATGNWGSDVVSFNELNIS 169

Query: 238 GLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRR---PFKYDNFPIVLKNSGAIKT 294
            ++FA+ +  NS+ GVLG+GLP++E TY G  A   +      +Y NFPI LK +G I  
Sbjct: 170 NVNFALGSFANSSNGVLGVGLPDVESTYDGPYAGSRKNISDSHQYANFPITLKQNGVIDK 229

Query: 295 NAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGV 354
            AYSLYLN S ++ G++LFGAVDH++Y G LYT+P+ N+L    F+ P Q ++T+NG+G+
Sbjct: 230 IAYSLYLNSSKSKFGSVLFGAVDHNRYNGPLYTLPLANSL-FQNFTDPFQLEITMNGLGL 288

Query: 355 SDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEI-----GAQYSYRLGYYVLDC 409
               +   TL   K  ALLDSGTTLT + + +  LIA ++     G     RL      C
Sbjct: 289 Q-GNDANITLYDKKSAALLDSGTTLTVVSKHIGDLIAAQVNGTIAGKDQCIRLP----KC 343

Query: 410 PS-DDSTQIVFDFGGFHINASLSSFILSTGSTCLLGIIPTSD--NTGTILGDSFLTNAYV 466
           PS  ++ +++F+F G  +   ++  +      C L      D  N   I GD+FL + Y+
Sbjct: 344 PSKKENKKLIFNFSGAEVAVDINQMMNKHKGKCYLQFAVHEDTSNDAIIFGDNFLRSVYL 403

Query: 467 VYDLDNLEISMAQAQYNTT-TENIEVISSSIPSAVKAPGYTNTWSTSAT-IVTGGNIFTV 524
           VY+L++ EIS+A A +N++  ENIE I S++PSA++AP Y NT+S  AT     G+IF  
Sbjct: 404 VYNLEDKEISIAPANFNSSLPENIEPIKSTVPSAIRAPQYYNTYSEHATATAVTGDIFAP 463

Query: 525 DSSQT 529
           +++ +
Sbjct: 464 EATMS 468

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  294 bits (753), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 178/480 (37%), Positives = 264/480 (55%), Gaps = 43/480 (8%)

Query: 60  DKKPEAHLF--KRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNN 117
           +K PE +L   KR D   ++ + N    Y+V+L VG+PPQN+TV +DTGSSDLW     N
Sbjct: 22  EKVPEQNLALNKRDDKGLQLELENGGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEAN 81

Query: 118 PYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETAT 177
           PYC ++ + + ++  I+  +D+                                   T+ 
Sbjct: 82  PYCKNNRKHSPKKSQIEPLNDADYP--------------------------------TSP 109

Query: 178 QSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVT 237
             +P S   +DCK +G                F++SY D TFASG +G D L  + + V 
Sbjct: 110 NQIPKSLRDIDCKAFGFFNTSKSSTYKNNGTNFTLSYADTTFASGPWGVDTLSFNGVKVD 169

Query: 238 GLSFAVANETNSTMGVLGIGLPELEVTYS-GSTASR-GRRPFKYDNFPIVLKNSGAIKTN 295
            ++F +A  +NST  V GI LP  E T    +  SR G   ++Y NFP++LK  G +K  
Sbjct: 170 NVTFGLAAFSNSTTPVFGISLPARETTNQLAANGSRIGPNSYEYSNFPMLLKEQGIVKKI 229

Query: 296 AYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVS 355
           AYS+YLND+ +++G+ILFGAVD SKY GTLYT+P+VN+L     S P QF++T+NGIG+ 
Sbjct: 230 AYSVYLNDTRSKYGSILFGAVDQSKYIGTLYTLPLVNSLYKQ-VSKPFQFEITLNGIGLQ 288

Query: 356 DSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLD-CPSDDS 414
            + +   TL   K+  LLD+G T + LP  V AL+A ++        G+  LD CP+   
Sbjct: 289 -TADKNYTLYDQKLATLLDTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLDKCPNKKE 347

Query: 415 TQ-IVFDFGGFHINASLSSFILSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNL 473
            + +VF+FGG  I+  +          C L +    D     LGD FL + YVVY+L++ 
Sbjct: 348 KRTVVFNFGGAEISIDIRDLTRKIKGKCYLQMQARDDIEFAALGDIFLRHVYVVYNLEDE 407

Query: 474 EISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWST--SATIVTGGNIFTVDSSQTAS 531
           EIS+A A +N +T +I+ I S++P AVKAP Y NT+S   +AT VT G++FT +++ + S
Sbjct: 408 EISIANANFNYSTPDIQEIVSTVPGAVKAPQYYNTYSVYPTATAVT-GDVFTPEATMSMS 466

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  293 bits (751), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 184/503 (36%), Positives = 267/503 (53%), Gaps = 62/503 (12%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQS--FYSVELDVGSPPQN 98
           +V L F K +GD L  V RD              +++ + N Q    Y+++L VG+PPQN
Sbjct: 14  YVALDFEKSHGDDL--VKRD-------------VQDVKLINSQKAMLYNIQLSVGTPPQN 58

Query: 99  VTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGT 158
           +T  +DTGSSDLW   S NPYC ++ +   +                             
Sbjct: 59  ITAQLDTGSSDLWFPDSTNPYCKANKKQAPKS---------------------------- 90

Query: 159 GGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGT 218
                  A+   G+  T+   VP S   +DC E+G                F ISY D +
Sbjct: 91  ------IASLDAGTRPTSPAQVPKSLRNLDCAEFGLFNSSASTTFNSNKTEFFISYLDSS 144

Query: 219 FASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFK 278
           +A G + TD L L+ LN++GL+F +A  +NS+  VLG+GL  LE +Y           F+
Sbjct: 145 YAEGVWATDNLYLNGLNISGLNFGLAYFSNSSNSVLGVGLTPLEASYDTDIKQDDSPRFQ 204

Query: 279 YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 338
           Y NFP +LK  GAI    YSLYLND+ +++G ILFG VDHSKY G LYTIP+VN+     
Sbjct: 205 YPNFPQILKQKGAISKVTYSLYLNDTKSKYGQILFGGVDHSKYVGQLYTIPLVNSKYQKS 264

Query: 339 FSSPIQFDVTINGIGVSD-SKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQ 397
                  +VT+NG+G+ D + N   TL T K+PAL DSGT+ +Y+P T+  +IA ++   
Sbjct: 265 PGVIADLEVTLNGLGIRDNTTNTNTTLYTQKLPALFDSGTSYSYVPYTMAQVIASQVNGT 324

Query: 398 YSYRLGYYVL-DCPS-DDSTQIVFDFGGFHINASLSSFILSTGSTCLLGII--PTSDNTG 453
              +     L  CPS  D+ ++VF+F G  I   L  F       C L ++  P ++  G
Sbjct: 325 IDNKTEAIRLPKCPSKKDTREVVFNFNGVEIAIPLKQFYQKKSGKCYLDLMVAPPNNGPG 384

Query: 454 TILGDSFLTNAYVVYDLDNLEISMAQAQYNTT-TENIEVISSSIPSAVKAPGYTNTWST- 511
            +LGD+FL   Y V+DL+  E+S+A+A +N++   ++E I S++PSA+KAP Y NT+S  
Sbjct: 385 LLLGDTFLRQVYTVFDLEAQELSIARANFNSSLPADVEEIKSTVPSAIKAPQYYNTFSAY 444

Query: 512 -SATIVTGGNIFTVDSSQTASFS 533
            +AT V  GNIF  D++ TAS +
Sbjct: 445 DNATQVV-GNIF--DATATASMA 464

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  288 bits (737), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 174/462 (37%), Positives = 259/462 (56%), Gaps = 40/462 (8%)

Query: 67  LFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRS 126
           L KRAD    + + N    Y V+L VG+PPQ V+V +DTGS+DLW  G++NPYC ++ + 
Sbjct: 30  LEKRADDLSPVPLRNDVDQYIVQLAVGTPPQMVSVQLDTGSADLWFSGADNPYCKTNKKK 89

Query: 127 NSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEAT 186
             + + +   D+S                   G    P   G    +             
Sbjct: 90  APKSKDLQPVDNS-------------------GFPTNPDQIGKKARN------------- 117

Query: 187 MDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANE 246
           +DCK+YG                  + Y D +F  GT+GTDV+ L  LN++G++FAVA  
Sbjct: 118 LDCKKYGFFNMSSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVSLGGLNISGVNFAVAEI 177

Query: 247 TNSTMGVLGIGLPELEVTYS-GSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSD 305
           +NS+ GVLG+ LP  E TYS  S  +     ++Y N P+ LK  G I    YS+YLND+ 
Sbjct: 178 SNSSSGVLGVSLPSEESTYSINSNGTTNATNYQYSNLPLQLKEQGIIDKVTYSIYLNDTK 237

Query: 306 AEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLT 365
           +++G+ILFGAVDHSKYTGTLYT+P+VN+      + P + D+T+NGIG   S +   TL 
Sbjct: 238 SKYGSILFGAVDHSKYTGTLYTLPLVNS-EYDVVNKPYELDITLNGIGYQ-SMSSNMTLY 295

Query: 366 TTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYR-LGYYVLDCPS-DDSTQIVFDFGG 423
             K+ AL+DSGTT++  P+ +V ++A ++ A       G  +  CPS  D+ +++F+ GG
Sbjct: 296 DQKVAALIDSGTTISEFPDEIVEVVAKQMNATVDPNGNGIRLAKCPSKKDNAKLLFNLGG 355

Query: 424 FHINASLSSFILSTGSTCLLGIIPT-SDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQY 482
             I   +  F       C L IIP+ +++   ILGD+F+ + Y V+DL+  E+S+AQA +
Sbjct: 356 ALIYVDIKEFTTKVKGKCYLEIIPSGAESDLVILGDNFMRSVYTVFDLEANEVSIAQANF 415

Query: 483 NTT-TENIEVISSSIPSAVKAPGYTNTWSTSATIVT-GGNIF 522
           N++    IE I S++PSAVKAP Y NT+S  A+I +  G+IF
Sbjct: 416 NSSLPAQIEEIKSTVPSAVKAPQYYNTFSAIASISSVTGDIF 457

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  286 bits (731), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 178/476 (37%), Positives = 267/476 (56%), Gaps = 41/476 (8%)

Query: 60  DKKPEA--HLFKRADGYEEII-ITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSN 116
           +K P+    L KRAD    I  + N    Y+V++ VG+PPQN+TV +DTGSSDLW + ++
Sbjct: 22  EKTPKISDELTKRADNDSFIAPLLNGGELYTVQIAVGTPPQNLTVQLDTGSSDLWFVSAS 81

Query: 117 NPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETA 176
           NPYC ++ +   +++                D+ P   +T   G              T+
Sbjct: 82  NPYCKNNKKFAPKKQ----------------DLMP---ITSDDGF------------PTS 110

Query: 177 TQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNV 236
              VP +   ++C +YG                FS+SYGD TFASG +GTD + L+ + V
Sbjct: 111 PNQVPKALRNINCNKYGFFNASGSSTYSRNDTNFSLSYGDETFASGPWGTDTISLNGVKV 170

Query: 237 TGLSFAVANETNSTMGVLGIGLPELEVTYSG-STASRGRRPFKYDNFPIVLKNSGAIKTN 295
             ++F +A+ +NST  V GIGLP  E TY+  S  + G    +Y NFP+ LK  G I   
Sbjct: 171 ENVTFGLASFSNSTNPVFGIGLPGDESTYAMFSEDTNGTTNTQYSNFPLQLKQQGKIDKV 230

Query: 296 AYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVS 355
           AYS+YLN + ++ G+ILFGAVDHSKY+G LYT+PIVN        +P + +VT++G+G+ 
Sbjct: 231 AYSIYLNSTKSKQGSILFGAVDHSKYSGPLYTLPIVNRF-GHLVENPYELEVTLSGLGLQ 289

Query: 356 DSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVL-DCPSDDS 414
            + +   TL    +PALLD+GTT TY+P +V   +A++       +     L  CPS  S
Sbjct: 290 RATSN-ITLFDQLLPALLDTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIKLAKCPSKKS 348

Query: 415 TQ-IVFDFGGFHINASLSSFILSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNL 473
              IVF+F G  I   +  F+      C L  + + +++  +LGDSF+ + Y V+DLD+ 
Sbjct: 349 NDTIVFNFSGAQIKIKMVDFVEKHKGKCYLPCV-SQESSFFLLGDSFMRHVYTVFDLDDK 407

Query: 474 EISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWSTSAT-IVTGGNIFTVDSSQ 528
           EIS+AQA +N+T E+IE ISS++PSAVKAP Y +++    T I   G+IF   +++
Sbjct: 408 EISIAQANFNSTKEDIEEISSTVPSAVKAPQYYSSYVDFPTEISVTGDIFAPQATE 463

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  283 bits (724), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 187/497 (37%), Positives = 274/497 (55%), Gaps = 41/497 (8%)

Query: 42  VKLPFHKLYGDSLDNVGRDKKPEAHLFKR---ADGYEEIIITNQ-QSFYSVELDVGSPPQ 97
            K+ F+K+YG S      D+K   +LF+    +D  +E+ + N   ++YSV + +G+P Q
Sbjct: 32  AKIGFNKVYGKSFSEATADRK-YVNLFRNKNISDDNDEVALQNNANTYYSVNISLGTPGQ 90

Query: 98  NVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTG 157
           N+T+ +DTGSSDLW++      C+ D  +N  ++  +  +D+ +  + ++ +  +     
Sbjct: 91  NMTIQLDTGSSDLWVIKPGGLQCT-DNDTNLFKKRSENDNDNDAISSFISQLESYEGSFS 149

Query: 158 TGGLIGPTATGSGGSSETATQSVPASEATM-------------DCKE--YGXXXXXXXXX 202
           T  L GP     G  + T + S+PA                  +C    +          
Sbjct: 150 T--LFGPGPGSVGTPTGTISSSMPAPTGNGSYDGGDSDSDGSNNCNATAFFEADNSKTFH 207

Query: 203 XXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELE 262
                 Y+ I Y D ++ASG +GTD L L DL V  +SFAVAN+TNST  V GIG P  E
Sbjct: 208 RNRTDPYY-IQYEDLSYASGYWGTDDLQLGDLQVHNVSFAVANDTNSTTPVFGIGFPGGE 266

Query: 263 VTYSG-STASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKY 321
            +++      R   P +Y NFP  LKN G I+  AYSLYLN  ++ +G +LFG VDHS+Y
Sbjct: 267 SSFASVGPEYRAAHPHEYANFPQTLKNQGIIQRVAYSLYLNSPNSTYGNVLFGGVDHSQY 326

Query: 322 TGTLYTIPIVNTLSASGFSSPIQ-FDVTINGIGVSDSKNGEKTLTTTK-IPALLDSGTTL 379
            G LYT+PI+   + +    P     +T+ G+ V  ++ G K    TK IP +LDSGTT 
Sbjct: 327 QGQLYTLPILQLGNLTSDGDPYNTLAITLQGVSV--TRRGSKHKVKTKPIPVVLDSGTTA 384

Query: 380 TYLPETVVALIADEIGAQYSYRLGY----YVLDCP-SDDSTQIVFDFGGFHINASLSSFI 434
            YLP      +A  I ++Y   LG     Y++DCP S D+  I FDFGG  I   + ++I
Sbjct: 385 MYLPYK----LAKSIASRYHGILGPEDQGYIIDCPKSGDNDYITFDFGGVTIKTDIRNYI 440

Query: 435 L-STGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVIS 493
              + + CLLGIIP SD    + GD FLT+AYVVYDL+  EIS+AQA +N+++E IE I+
Sbjct: 441 FEQSENKCLLGIIPNSD-ILAVFGDVFLTDAYVVYDLEGKEISLAQASFNSSSEQIEAIT 499

Query: 494 SS-IPSAVKAPGYTNTW 509
           SS +P A +APGY+ TW
Sbjct: 500 SSGVPGAKRAPGYSKTW 516

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  278 bits (711), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 178/501 (35%), Positives = 270/501 (53%), Gaps = 55/501 (10%)

Query: 41  FVKLPFHKLYGDSLDNVGRDK-KPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           +VKL F K  G  L    RD   PEA             +T  +  Y VE+ VG+PPQ V
Sbjct: 17  YVKLDFTKTPGSDL--AKRDVVDPEAAQ-----------LTFDKDQYIVEVAVGTPPQKV 63

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159
            + +DTGSSDL+++  +NPYC ++     +++ ++                         
Sbjct: 64  LLQIDTGSSDLFVIEESNPYCKNNKNKAPKKKDLE------------------------- 98

Query: 160 GLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTF 219
                     G         VP S+ T+DCK+YG                  I+YGD  F
Sbjct: 99  --------SPGDDYPRTPNQVPKSDRTLDCKKYGFYNRNESSTFNSNGTDLFITYGDNGF 150

Query: 220 ASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKY 279
             GT+GTD + + +LN++ LS  V+  TN++ G+LG+GLP  E T++ S+   G   ++Y
Sbjct: 151 VRGTWGTDSVSVGNLNLSNLSIGVSPMTNTSTGILGVGLPGEESTFNYSSNVTGPSNYQY 210

Query: 280 DNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGF 339
            NFPI LK  G I+  AYS+YLN++ +++G+ILFGAVDHSKY G LYT P+VN+    G 
Sbjct: 211 SNFPIRLKEEGLIEKIAYSIYLNETGSKYGSILFGAVDHSKYQGPLYTFPLVNSKYKEG- 269

Query: 340 SSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYS 399
           S P QF++T+NG+G+   K    TL   K+P LLDSG+T++ LP  V  L+A ++     
Sbjct: 270 SDPFQFEITMNGVGLV-GKTDNITLYDQKLPTLLDSGSTISLLPRDVADLVAQQVNGTVD 328

Query: 400 YRLGYYVL-DCPS-DDSTQIVFDFGGFHINASLSSFILSTGSTCLLGIIPTSDNTGTILG 457
            +     L  CPS  D+ +++F+F G   + +++ F+      C L           +LG
Sbjct: 329 GKGNCIKLPKCPSKKDNQKLIFNFSGAEFSVNVTDFMEKHKGKCYLQFSALDGINFALLG 388

Query: 458 DSFLTNAYVVYDLDNLEISMAQAQYNTTTE-NIEVISSSIPSAVKAPGYTNTWST--SAT 514
           D+F+ N Y V++LD+ E+S+AQA YN++ + +IE I  ++PSAV AP Y NT+S   +AT
Sbjct: 389 DNFMNNVYTVFNLDDKELSLAQANYNSSLKPDIEEIKDTVPSAVLAPQYYNTFSADPTAT 448

Query: 515 IVTGGNIFTVDSSQTASFSGN 535
            VT GNIF  +++ + +   N
Sbjct: 449 AVT-GNIFAPEATMSMAAPAN 468

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  276 bits (705), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 175/486 (36%), Positives = 264/486 (54%), Gaps = 57/486 (11%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIIT--NQQSFYSVELDVGSPPQN 98
           +VKLP  KL               + + KR++ +   +I   +    Y VE+++G+PPQ 
Sbjct: 27  YVKLPVQKL--------ANIPNSASGISKRSEAFNSTLINMFSSAHIYVVEMEIGTPPQA 78

Query: 99  VTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGT 158
               +DTGSSD+    +++ YC S T         D+ +  +S+  L          T T
Sbjct: 79  AYFQLDTGSSDMCANEADSSYCESFT---------DESNIWTSNYEL----------TAT 119

Query: 159 GGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGT 218
              I  TAT S         + P       C  +G                F+ISY D  
Sbjct: 120 ASEISSTATSSKA------YNTP-------CSYWGTFSPNVSSTFKYNETIFNISYADNM 166

Query: 219 FASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTA-SRGRRPF 277
           + +GT+GTDV+ L ++ ++  +F V+N+T  + G+LG+ LP +E T     A S    PF
Sbjct: 167 YYAGTYGTDVVSLGNITLSNFTFGVSNDTKMSYGILGVSLPSVEETDDIEDALSSNTTPF 226

Query: 278 KYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIV---NTL 334
            Y+NFP+ LK+ G I+  AYSL+LN+  A  G+ILFGAVD SKY+G LYT+P++   NTL
Sbjct: 227 VYENFPMALKSQGKIEKIAYSLFLNEPSARFGSILFGAVDKSKYSGQLYTLPMLQAYNTL 286

Query: 335 SA--SGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIAD 392
            A  SG        VT     + DSK+G KT++  + P L DSGT+ + LP  +   I  
Sbjct: 287 DALYSGMF------VTAQSAAIIDSKSGNKTVSEVQFPVLFDSGTSTSVLPTEIADAIGR 340

Query: 393 EIGAQYSYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILS-TGSTCLLGIIPTSDN 451
               +YS     Y+ DC   ++TQ+  DFGGF+I+A++S+F+   T   C+L I+P+  +
Sbjct: 341 SFDGKYSSDDEGYIFDCSKVNNTQLSIDFGGFNISANISNFVTPLTKDHCVLQILPS--D 398

Query: 452 TGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWST 511
           T ++LGD+FL + YVVYDL+N E+S+AQA +N   E+IE+IS S+P A  APGY++TW  
Sbjct: 399 TVSVLGDAFLVDTYVVYDLENHEVSVAQASFNNEEEDIEIISDSVPGATPAPGYSSTWRY 458

Query: 512 SATIVT 517
           +  I++
Sbjct: 459 NGYIIS 464

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  277 bits (709), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 178/472 (37%), Positives = 264/472 (55%), Gaps = 44/472 (9%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           +VK P  KL  D ++   +D    + +FKR +     +I N    Y V++++G+PPQ + 
Sbjct: 27  YVKFPVQKL-ADIINICTQDV---STVFKRNEVLNTTVI-NGIGVYVVKMEIGTPPQTLY 81

Query: 101 VLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGG 160
           + +DTGSSD+ +  ++  YC S         + D  D +S+    +              
Sbjct: 82  LQLDTGSSDMIVNNADIAYCKS---------MSDGSDYASTDNYEL-------------- 118

Query: 161 LIGPTATGSGGSSETATQSVPASEA-TMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTF 219
               TAT +G  S T      +SEA    C  +G               +F+ +YGDGT+
Sbjct: 119 ----TATFNGLPSTTI-----SSEAYNTLCSYWGTFDASNSSTFENNATFFNNTYGDGTY 169

Query: 220 ASGTFGTDVLDLSDLNVTGLSFAVANET-NSTMGVLGIGLPELEVTYSGSTA-SRGRRPF 277
            +GT+GTDV+   ++ +   +F V+N+T  +  G+LGI LP  E T     A +  R PF
Sbjct: 170 YAGTYGTDVVSFENITLNDFTFGVSNDTIGNPSGILGISLPIAEFTDGIEYALALNRTPF 229

Query: 278 KYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSAS 337
            YDNFP+ LKN G I   AYSL+LN  DA  G+ILFGAVD SKYTG LYT+P++   +  
Sbjct: 230 IYDNFPMELKNQGKINKIAYSLFLNGPDAHFGSILFGAVDKSKYTGQLYTLPMLQAFNTL 289

Query: 338 GFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQ 397
           G S+P    +T   + + DS++G KT++  + P +LDSGTT +YLP  +   I      +
Sbjct: 290 G-SNPGMI-ITAQSVAILDSESGNKTVSDIQFPVMLDSGTTFSYLPTEIAEAIGKSFDGE 347

Query: 398 YSYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILSTGSTCLLGIIPTSDNTGTILG 457
           YS     Y+ DC   + T +  DFGGF+I+A++S+F+ S    C+L  +  S++T  +LG
Sbjct: 348 YSSDDQGYIFDCSKVNDTLLSVDFGGFNISANISNFVTSAKDRCVLN-VKQSEST-YMLG 405

Query: 458 DSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTW 509
           D+FL +AYVVYDL+N EIS+AQA +N   E+IEVIS ++P A  APGY +TW
Sbjct: 406 DAFLVDAYVVYDLENYEISIAQASFNNQEEDIEVISDTVPGATPAPGYFSTW 457

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  276 bits (707), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 168/468 (35%), Positives = 244/468 (52%), Gaps = 24/468 (5%)

Query: 67  LFKRADG-YEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTR 125
           +F + DG Y  + + N++  Y+V+L VG+PPQN+TV ++ GS+D W+   +NPYC     
Sbjct: 51  VFAKRDGDYVLVDLINEKILYTVQLAVGTPPQNITVSINIGSADPWMTSPDNPYCEIKKH 110

Query: 126 SNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEA 185
           S   ++V       S   +L ND             +  + T + G+S +  Q +     
Sbjct: 111 SGYEKQV-GANTSVSLLSSLSND------------RVTMSGTVTTGTSSSMVQPI----- 152

Query: 186 TMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN 245
            +DC  YG                F++ Y D T AS  +GTDV+ +  L +  +SF VAN
Sbjct: 153 -IDCTNYGTFNHSSSSSFKNNGTNFTMFYADKTGASRFWGTDVVRVELLEILDMSFGVAN 211

Query: 246 ETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSD 305
             N+T GV GIG P LE T   +        ++Y NFP  L N G++   AYSL+LNDS 
Sbjct: 212 VFNATEGVFGIGFPSLETTNMFNARIDPYSSYEYANFPQALNNQGSVDKVAYSLFLNDSH 271

Query: 306 AEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLT 365
           A  G++LFGAVDHSKY   L+T+P+VN     G   P  F+V  N      +K   +   
Sbjct: 272 AMKGSVLFGAVDHSKYRNDLFTVPLVNDFRDKGMDHPHYFNV-FNARRGCPNKRRPQNRR 330

Query: 366 TTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQIV-FDFGGF 424
             +   +LDSG T++ LP  +V  +   + A +   L  Y L CPS   T +  FD G F
Sbjct: 331 HDEFIVVLDSGATVSSLPTKLVDQLVQSLNATFDEELNSYTLKCPSKKDTSVASFDIGRF 390

Query: 425 HINASLSSFILS-TGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYN 483
           HI+  LS+F+     + C+L + P +DN   IL D+FL+ AYVV+DL++ EISM QA   
Sbjct: 391 HIDGPLSNFVRKYEKNKCILRLDP-ADNQPYILCDNFLSRAYVVHDLESYEISMGQANTE 449

Query: 484 TTTENIEVISSSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSSQTAS 531
              E IE I S +P  V+AP Y  TW     +   GNI+TV ++ T++
Sbjct: 450 YAPEQIEAIKSKVPGTVRAPSYDKTWGNGTDVSPSGNIYTVSTNGTST 497

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  275 bits (703), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 166/472 (35%), Positives = 263/472 (55%), Gaps = 45/472 (9%)

Query: 69  KRADGYEEIIITNQQS--FYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRS 126
           KR++ +   +I    S   Y V++++G+PPQ   + +DTGSSD+ I  ++  YC S    
Sbjct: 51  KRSEAFNSTLINMFSSAGMYVVKMEIGTPPQTAYLQLDTGSSDMCINEADAAYCES---- 106

Query: 127 NSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEAT 186
                + D+ + S+S+  L                   TAT    + E  + + P++   
Sbjct: 107 -----LADENNISTSNYEL-------------------TAT----AIEILSTAAPSAAYN 138

Query: 187 MDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANE 246
             C  +G                F+++YGD ++ +GT+GTDV+ L ++ ++  +F V+N+
Sbjct: 139 APCSYWGTFSPNSSSTFKYNETIFNLTYGDNSYYAGTYGTDVVSLGNITLSNFTFGVSND 198

Query: 247 TNSTMGVLGIGLPELEVTYSGSTA-SRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSD 305
           T +  G+LG+ LP  EVT     A S    PF Y+NFP+ LK+ G IK  AYSL+LN+  
Sbjct: 199 TTNNGGILGVSLPSAEVTDDTEDALSSNTTPFIYNNFPMALKSQGKIKKIAYSLFLNEPS 258

Query: 306 AEHGTILFGAVDHSKYTGTLYTIPIV---NTLSASGFSSPIQFDVTINGIGVSDSKNGEK 362
           A  G+ILFGAVD S+Y+G LYT+P++   NTL A+         VT   + + DSK+G K
Sbjct: 259 ARFGSILFGAVDKSEYSGQLYTLPMLQAYNTLDATD----AGMFVTAQSVAILDSKSGNK 314

Query: 363 TLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFDFG 422
           T++  + P L DSGT+ + LP  +   I      +YS     Y+ DC   ++T + FDFG
Sbjct: 315 TVSEVQFPVLFDSGTSTSVLPTKIADAIGRSFDGKYSSDDQGYIFDCAKVNNTLLSFDFG 374

Query: 423 GFHINASLSSFILSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQY 482
           GF+I+A++S+F+      C+L I+P+  +T  +LGD+FL + YVVYDL+N E+S+AQA +
Sbjct: 375 GFNISANISNFVTPAKDHCILQILPS--DTIFVLGDAFLVDTYVVYDLENHEVSVAQASF 432

Query: 483 NTTTENIEVISSSIPSAVKAPGYTNTWS-TSATIVTGGNIFTVDSSQTASFS 533
           +   E+I +IS S+P A  APGY++TW  T  + +  G+   V  +  + FS
Sbjct: 433 DNKEEDIGIISDSVPGATPAPGYSSTWRYTPGSPIGSGDFLNVSWTSYSEFS 484

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  272 bits (696), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 163/435 (37%), Positives = 237/435 (54%), Gaps = 42/435 (9%)

Query: 85  FYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGA 144
            Y+V+L VG+PPQNVTV +DTGSSDLW   ++NPYC  + +   ++              
Sbjct: 52  MYTVQLHVGTPPQNVTVQLDTGSSDLWFPVASNPYCKRNAKLAPKK-------------- 97

Query: 145 LVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXX 204
                           +    ATG      T    V     T DC  +G           
Sbjct: 98  ----------------VKALPATGFA----TENDQVAKKLRTFDCDAFGLFNSSMSSSFK 137

Query: 205 XXXXY-FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEV 263
                 F + Y DGT+ASG +GTD   L+  NV+ ++FA+AN  N++MGVLG+G P  E 
Sbjct: 138 SNDSSEFFVKYEDGTYASGMWGTDTFKLNHHNVSNITFALANIANASMGVLGVGFPAEET 197

Query: 264 TYSGSTASR-GRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYT 322
           T   S  S   +  ++YDNFPI LK +  IK  +YS++LND++++ G ILFG VDHSKY 
Sbjct: 198 TDDPSPGSLIDKEHYQYDNFPIALKRTRTIKKVSYSIFLNDTNSKKGVILFGGVDHSKYQ 257

Query: 323 GTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYL 382
           GTL+T+P+VN L     ++  + ++T+NG+G  D K    TL   KIP LLD+GTTL Y 
Sbjct: 258 GTLWTVPMVNNLLTLNQTTTSRPEITLNGLGFRDDKKN-VTLWGEKIPVLLDTGTTLAYA 316

Query: 383 PETVVALIADEIGAQYSYRLGYYVL-DCP-SDDSTQIVFDFGGFHINASLSSFILSTGST 440
           P+ VV +IA  +      + G   L  CP + D+++++F+F G  I  SL + +      
Sbjct: 317 PKQVVDVIAKRVNGTIDSKTGGIKLKKCPNAKDNSELIFNFAGAEIPVSLLNMVEKRKGK 376

Query: 441 CLLGIIPTSD--NTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTE-NIEVISSSIP 497
           C L I    +   TG +LGD F+ + Y V++++++E+S A A  N +    IE I S +P
Sbjct: 377 CYLEIRYHEELSKTGMLLGDIFMRHVYSVFNMEDMEVSFAVANGNDSAPLQIEAIISDVP 436

Query: 498 SAVKAPGYTNTWSTS 512
           SAVKAP Y NT+++S
Sbjct: 437 SAVKAPQYYNTFASS 451

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  281 bits (719), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 179/490 (36%), Positives = 257/490 (52%), Gaps = 76/490 (15%)

Query: 40  KFVKLPFHKLYGDSLDNVGRDKK-PEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQN 98
           K   +PF K Y DSL+ +  +    E  L KR DG E+I++TN+ +FYS E++VG+P Q 
Sbjct: 28  KAAVIPFRKYYADSLEELDYNTSTSETKLVKR-DG-EDIVLTNRNTFYSAEIEVGTPAQT 85

Query: 99  VTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGT 158
           + V+VDTGSSDL                                           W+ G 
Sbjct: 86  MNVIVDTGSSDL-------------------------------------------WVIGH 102

Query: 159 GGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGT 218
             L  P A                S+ + +C+ +G                F+I+Y  G 
Sbjct: 103 DNLTCPLA----------------SDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGN 146

Query: 219 FASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFK 278
              G +G D L +  +N TGLSF V + T S+ G+LGIGLP+ E T  G         +K
Sbjct: 147 NCIGVWGQDNLIIGGVNATGLSFGVVHTTTSSAGILGIGLPDTETTAVGQYGH-----YK 201

Query: 279 YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASG 338
           YDNFP+VLKN G I    YS+YL+ S + +G  L G VD SKYTGTLY +P+VN  + + 
Sbjct: 202 YDNFPMVLKNKGIISHQGYSIYLDSSSSTYGEFLLGGVDTSKYTGTLYKLPLVNWYN-TY 260

Query: 339 FSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQY 398
           FSSP  F VT+ G+G+  +     TLT TK+  +LD+G+T+T +P T+   +   +G  Y
Sbjct: 261 FSSPGDFHVTLQGLGLITNSGSAVTLTETKMAVILDTGSTVTGIPATLYNALLSSLGGYY 320

Query: 399 SYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILSTG-STCLLGIIPTSDNTGTILG 457
           S   G YV  CP++ S ++VF+FGG +    +SSFI + G + C L +   SD +  ILG
Sbjct: 321 SSTHGAYVFTCPTETS-KLVFNFGGINYKLPMSSFINTLGDNVCSLKVSSRSD-SNFILG 378

Query: 458 DSFLTNAYVVYDLDNLEISMAQAQYNTTTEN-----IEVISSSIPSAVKAPGYTNTWSTS 512
           D FL N Y  +DL+N EI +A A +++++ N     +  + S IP AV+AP Y+ TW T 
Sbjct: 379 DDFLRNVYAAFDLENKEIGLAMADFDSSSNNKREDTVIAMESGIPDAVQAPEYSATWVTY 438

Query: 513 ATIVTGGNIF 522
             +VTGG++F
Sbjct: 439 EAVVTGGSMF 448

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  271 bits (694), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 171/494 (34%), Positives = 257/494 (52%), Gaps = 91/494 (18%)

Query: 42  VKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTV 101
           V LPF ++            +    L +R DG + + +  Q  FYS++L +G+P Q VTV
Sbjct: 20  VNLPFKRV------------RQSPQLVRREDG-DSVHLGKQTGFYSIDLAIGTPSQKVTV 66

Query: 102 LVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGL 161
           L+DTGSSDL                                           W+TG    
Sbjct: 67  LLDTGSSDL-------------------------------------------WVTGANNP 83

Query: 162 IGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFAS 221
              T+  S                  +CKEYG                  I+Y DGT   
Sbjct: 84  YCQTSLSS------------------ECKEYGTFDYGQSSTFQDRNSALKINYQDGTKVD 125

Query: 222 GTFGTDVLDLSD--LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKY 279
           G +G D L+L++  + +      VA+ ++S  GV+G+G P LE T   +        + Y
Sbjct: 126 GRWGVDTLELNNGAIQLQNTMIGVADSSDSVAGVIGLGFPGLETT---NNVQANGESYTY 182

Query: 280 DNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGF 339
            NFP+ LK  G      +++ L++S    G ILFGAVD  KY G LYT+P+VN   + G 
Sbjct: 183 ANFPMQLKQQGVTDATVFAIALDNSYG--GDILFGAVDEGKYIGGLYTLPVVN---SRGT 237

Query: 340 SSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYS 399
           ++PI+ +VT+ GIGV      ++T ++T + AL+DSG+T+ YLPE +   I +++GA+Y 
Sbjct: 238 ATPIRMEVTLQGIGVDSDGGDQETFSSTPMLALVDSGSTMVYLPELIATAIYNKVGARYD 297

Query: 400 YRLGYYVLDCPSD-DSTQIVFDFGGFHINASLSSFIL----STGSTCLLGIIPTSDNTGT 454
                Y +DC ++ ++  ++FDFGGFHI+  +S++I+    S+   CL GI+  S NT  
Sbjct: 298 GSSEMYTIDCGTNVENDNLIFDFGGFHISTPVSNYIITDQRSSNGQCLFGILSQSGNT-V 356

Query: 455 ILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENI-EVISSSIPSAVKAPGYTNTWSTSA 513
           +LGD+FL++AYVV+DLD+ EISMAQ   N    N+ +V S +IP+A KAP Y+ TWST+A
Sbjct: 357 VLGDTFLSSAYVVFDLDHYEISMAQGNSNNGDGNVKDVTSGTIPNARKAPMYSQTWSTNA 416

Query: 514 TIVTGGNIFTVDSS 527
            + +GGNIFT+ S+
Sbjct: 417 PVTSGGNIFTLGST 430

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  257 bits (656), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 138/305 (45%), Positives = 200/305 (65%), Gaps = 11/305 (3%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F+I+Y D ++ +GTFGTD++ L D+ ++  +F V+N+T    G+LGI LP  E+T SG  
Sbjct: 8   FNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAEITDSGQG 67

Query: 270 A-SRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTI 328
           A S    PF YDNFP+ LKN G I+  AYSL+LN+ +A  G+ILFGAVD SKYTG LYT+
Sbjct: 68  ALSSNTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKYTGQLYTL 127

Query: 329 PIV---NTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPET 385
           P++   NTL A G        VT   + + DS +G KT++  + P L DSGT+ + LP  
Sbjct: 128 PMLQAYNTLDALGGG----MLVTAQSVAILDSISGNKTVSEVQFPVLFDSGTSTSVLPTE 183

Query: 386 VVALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILS-TGSTCLLG 444
           +   I      +YS     Y+ DC   ++TQ+  DFGGF+I+A++S+F+   T   C+L 
Sbjct: 184 IADAIGRSFDGKYSSDDEGYIFDCSKVNNTQLSIDFGGFNISANISNFVTPLTKDHCVLQ 243

Query: 445 IIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPG 504
           I+P+  +T ++LGD+FL + YVVYDL++ E+S+AQA +N   E+IE+IS S+P A  APG
Sbjct: 244 ILPS--DTVSVLGDAFLVDTYVVYDLESHEVSVAQASFNNEEEDIEIISDSVPGATPAPG 301

Query: 505 YTNTW 509
           Y++TW
Sbjct: 302 YSSTW 306

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  259 bits (662), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 172/482 (35%), Positives = 256/482 (53%), Gaps = 57/482 (11%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADG-YEEIIITNQQSFYSVELDVGSPPQNV 99
           +++LPF K+  +SL              KRAD  Y  + + N+Q FY VE+ +GS  QN+
Sbjct: 15  YLRLPFTKITDNSLA-------------KRADDDYLNVQLDNEQIFYGVEVSIGSDKQNM 61

Query: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159
           T+LVDTGSSD W++G+ NPYC S+     R +   K+D  SS       ++P     G  
Sbjct: 62  TLLVDTGSSDFWVLGAQNPYCKSN-----RGKKPKKKDQPSS-------VDP-----GRN 104

Query: 160 GLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTF 219
           G              T  +++P +E T DC ++                 F I+YGDG++
Sbjct: 105 GY------------PTKAEAIPYAERTFDCSDFKTFNSSSSNTFKSNDTDFFITYGDGSY 152

Query: 220 ASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTA------SRG 273
             GT+GTD + L+   +  ++FAVA  TN++ G+LGIGLPELE + +  TA      S  
Sbjct: 153 VEGTWGTDQVALAGQTLENVTFAVAELTNNSYGLLGIGLPELESSITIDTAQLTNTSSVK 212

Query: 274 RRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNT 333
           + P  Y NFP  LK +  I    YS+YLN ++ + G+ILFGAVDH++Y G L T+P+V +
Sbjct: 213 KNP--YMNFPESLKLNKLINKVVYSIYLNRTNDKFGSILFGAVDHNRYDGNLTTVPLVFS 270

Query: 334 LSASGFSSPIQFDVTINGIG--VSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIA 391
               G   P +  VT+NG+    +D    +    T+K PALLD+G+T T+LP  V   +A
Sbjct: 271 NRDFGTPRPNELMVTLNGMSFEATDGNVTQILNATSKFPALLDTGSTDTHLPVDVYNALA 330

Query: 392 DEIGAQYSY-RLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFILSTGSTCLLGIIPTS 449
           +     Y   +    +  C S  D T + F  GG +I       +      C + + PT 
Sbjct: 331 ESTNGTYDQTQNKIRIPKCLSKKDKTILNFSLGGVNIGVPYKEMVKKIKGKCYINVAPTG 390

Query: 450 DNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYN-TTTENIEVISSSIPSAVKAPGYTNT 508
            +   ILGD  +  AY+V+DL++ EIS+AQA +N T  E+IEV+ S+IP A +A  Y+ T
Sbjct: 391 SDFA-ILGDDVIRYAYMVFDLEDREISLAQASFNDTLPEDIEVVVSTIPGATRASAYSET 449

Query: 509 WS 510
           +S
Sbjct: 450 YS 451

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  249 bits (636), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 188/300 (62%), Gaps = 4/300 (1%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F  +YGDGT+  GT+GTDV+ L ++ +   SF VAN T +  G+LGI LP  E T+S   
Sbjct: 5   FDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTHSLGG 64

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIP 329
           A     PF+Y+NFP+ LK+ G I+  AYSL+LN+  A  G+ILFGAVD SKY+G LYT+P
Sbjct: 65  A-YNTTPFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLP 123

Query: 330 IVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVAL 389
           ++         SP  F VT   + V +  +G KT++  + P L DSGTT + LP  V   
Sbjct: 124 MLQAYDTLDSVSPGMF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHA 182

Query: 390 IADEIGAQYSYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILSTGSTCLLGIIPTS 449
           I      +YS     Y  DC     T +  DFGGF+I+A++S+F+  T   CLL I   +
Sbjct: 183 IGKSFDGKYSSGDQGYTFDCSKVKDTLLSIDFGGFNISANISNFVTRTKDHCLLNI--EA 240

Query: 450 DNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTW 509
            ++G +LGD+FL +AYVV+DL++ E+S+AQA ++   E IEVIS  +P A++APGY++TW
Sbjct: 241 ADSGFVLGDAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRAPGYSSTW 300

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  249 bits (636), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 211/316 (66%), Gaps = 11/316 (3%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           FS  Y DGT A G +  D + L D  V+ ++FAV N+T+S  GVLG+GL  LE TY+ + 
Sbjct: 127 FSTQYADGTTAYGEWCYDTVALGDTTVSNVTFAVVNDTDSNFGVLGLGLTGLEATYTNAL 186

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIP 329
           +S    P++YDNFP+ L   G I+ NAYSLYLN +DA  G +LFGAVDH+KYTGTL+TIP
Sbjct: 187 SS----PYQYDNFPVKLVRQGLIQANAYSLYLNKADASSGNVLFGAVDHAKYTGTLHTIP 242

Query: 330 IVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVAL 389
            VNTL + G++S I+F VT++G+ +S + +G+ TLTT+K P L+DSG T +YLP+ ++  
Sbjct: 243 FVNTLESLGYNSVIEFHVTLDGMDLS-TNDGQTTLTTSKFPVLVDSGNTFSYLPDNLLQQ 301

Query: 390 IADEIGAQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFILSTG---STCLLGI 445
           IA +IGA YS     YVL CPS DD T I ++FGGF+I+  LS  +   G   +TC+L I
Sbjct: 302 IASQIGATYSNEYVGYVLTCPSEDDDTVISYNFGGFNIDTPLSGSVTELGDDSNTCILMI 361

Query: 446 IPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGY 505
            P+    G  LGD+FL N Y         +S+AQAQY T  E IE+ISSSIP A+KA GY
Sbjct: 362 APSGSEFGQ-LGDTFLENVYASSTWTIESLSLAQAQY-TDEEEIEIISSSIPGAIKAAGY 419

Query: 506 TNTWSTSATIVTGGNI 521
           ++ WS SA   T GN+
Sbjct: 420 SDIWSASAKNSTSGNV 435

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 53/74 (71%), Gaps = 2/74 (2%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           FV + F++LYG S D     K+  +H+ KR++ YE++ + N+  FYS++L +GS  QNVT
Sbjct: 31  FVSMNFNRLYGASPD-TAVSKRSMSHI-KRSENYEQVRLKNEACFYSMDLAIGSNHQNVT 88

Query: 101 VLVDTGSSDLWIMG 114
           VLVDTGSSDLW+ G
Sbjct: 89  VLVDTGSSDLWVPG 102

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  236 bits (602), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 171/480 (35%), Positives = 245/480 (51%), Gaps = 69/480 (14%)

Query: 59  RDKKPEAHLFKRADGYEEIIITN-QQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNN 117
           R  K +        G+ EI + + +Q++Y+  L++G+PPQN+TVL D+GSSDLW+M ++N
Sbjct: 34  RSSKNQYAKRNSGSGHLEIELQHIEQTYYATTLEIGTPPQNLTVLFDSGSSDLWVMDASN 93

Query: 118 PYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETAT 177
           PYC S                              G  T  G  I   +T    S  T  
Sbjct: 94  PYCESQYT---------------------------GSQTYNGSSINQASTIDCSSFMTFN 126

Query: 178 QSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVT 237
           +S+ +S  T                       F   Y D TFA G++ T+ L ++ ++V+
Sbjct: 127 KSLSSSFKTKGTSR------------------FYAYYSDKTFADGSWATEKLTMNGVDVS 168

Query: 238 GLSFAVAN-ETNSTMGVLGIGLPELEVTYSGSTASRGRRPFK-YDNFPIVLKNSGAIKTN 295
            L F + N  T    GVLGIG P  E     S       P + Y NFP VLKN G I   
Sbjct: 169 SLQFGLGNCVTTPVSGVLGIGFPRRE-----SVKGYDNAPNEFYPNFPQVLKNQGIIDVV 223

Query: 296 AYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVS 355
           AYS++LN  +++ G+ILFGA+D SKYTG L T P++N +       P    V + G+G  
Sbjct: 224 AYSMFLNKLESDTGSILFGAIDTSKYTGDLVTFPMLN-IYPDVTDKPATLMVILQGLGAQ 282

Query: 356 DSKNGE-KTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS 414
           D+ N + +T  T+KIP LLDSGTTL   P+ +  ++AD + A +S   G Y+++CP+ ++
Sbjct: 283 DNANCKAETFVTSKIPVLLDSGTTLMGAPKEIADMMADFMNATFSEDEGIYIMECPTKET 342

Query: 415 ---TQIVFDFGGFHINASLSSFILST---GSTCLLGIIPTSDNTGTILGDSFLTNAYVVY 468
              T  +FDFGG  I   LS+FILS    G  C   ++P   NT  +LGD FL++AYVV+
Sbjct: 343 LANTDYIFDFGGVQIKVPLSNFILSAQSEGGPCGFAVLPDDSNT-MVLGDIFLSSAYVVF 401

Query: 469 DLDNLEISMAQAQY--NTTTEN--IEVISS-SIPSAVKAPGYTNTWSTSATIVTGGNIFT 523
           DLDN +IS+A A    N + E+  I + S  +IP+A  A    + WST  T      I T
Sbjct: 402 DLDNYQISLAAANLDNNVSLEDSIINIPSDGNIPNAKMAT--VDPWSTYETFTVTSAIAT 459

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  233 bits (595), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 159/463 (34%), Positives = 226/463 (48%), Gaps = 68/463 (14%)

Query: 61  KKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120
           K  +  L KR+  +E  +   Q  FY+VEL VG+P Q +  + DTGSSDLW+   +NP+C
Sbjct: 36  KPADRSLQKRSKSFESKL-NPQDYFYTVELGVGTPSQKINCIFDTGSSDLWVPAKSNPFC 94

Query: 121 SSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSV 180
                                                    +G     +G +    T+  
Sbjct: 95  -----------------------------------------LGNKLDTNGTNEFHGTEIT 113

Query: 181 PASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLS 240
           P     +DC + G                FS  Y DG+++ G +  D + ++D  V  L 
Sbjct: 114 P----ILDCDKIGVFDPGSSYSLSATGYNFSTQYFDGSYSDGFWVVDDISIADQQVPDLQ 169

Query: 241 FAVANETNSTMGVLGIGLPELEVT--YSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYS 298
           FAVAN +++  GVLG+GLP LE    Y G+  +       YDNFP  LK++  I    YS
Sbjct: 170 FAVANISSAPSGVLGVGLPRLEAVRGYDGAPNAN------YDNFPQTLKSNRLINRVLYS 223

Query: 299 LYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSK 358
           LY +  D E GT+LFG +D  KY G LYT+P+VN         P  FD+T+ G+G+    
Sbjct: 224 LYFDSGDLESGTVLFGGIDEKKYDGVLYTLPLVNIYEQ--IDEPAAFDITLQGLGIRSES 281

Query: 359 NGEKT-LTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQ 416
           N + T +   K PALLDSG+T+   P+  +  IA E+GA +S   G YVLDCP S+D   
Sbjct: 282 NCKDTVIAHKKAPALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDCPASNDDRT 341

Query: 417 IVFDFGGFHINASLSSFIL---STGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNL 473
             FDFG   +   +   +    S  + C L II + +    ILGD  L +AYVVYDLDNL
Sbjct: 342 FYFDFGELKLKVPIHDLLYLPESGQNYCGLAIIASGEE--WILGDLVLKSAYVVYDLDNL 399

Query: 474 EISMAQAQYNTTTENIEVISS--SIPSAVKAPGYTNTWSTSAT 514
           EIS+AQ +  T+   I+ +S+  S+P   K+   +  WS S +
Sbjct: 400 EISIAQVK-TTSGSRIQTVSATGSLPQTRKS--NSTPWSLSGS 439

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  232 bits (592), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 154/420 (36%), Positives = 225/420 (53%), Gaps = 61/420 (14%)

Query: 73  GYEEIIITNQQS-FYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRR 131
           G+ E ++ +++  +Y+  LD+G+P Q++TVL DTGS+D W+M S+NP+C           
Sbjct: 31  GHLEFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFC----------- 79

Query: 132 VIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKE 191
            +   + SS S A  N           G  + P+      S+    +S     +T    E
Sbjct: 80  -LPNSNTSSYSNATYN-----------GEEVKPSIDCRSMSTYNEHRS-----STYQYLE 122

Query: 192 YGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN-ETNST 250
            G                F I+Y DGTFA G++GT+ + ++ +++  + F VA   T   
Sbjct: 123 NGR---------------FYITYADGTFADGSWGTETVSINGIDIPNIQFGVAKYATTPV 167

Query: 251 MGVLGIGLPELEVT--YSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEH 308
            GVLGIG P  E    Y G+          Y NFP +LK+   I   AYSL+LN  D+  
Sbjct: 168 SGVLGIGFPRRESVKGYEGAPNEY------YPNFPQILKSEKIIDVVAYSLFLNSPDSGT 221

Query: 309 GTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGE-KTLTTT 367
           G+I+FGA+D SK++G L+T P+VN    +   +P    +TI G+G  +  + E +T TTT
Sbjct: 222 GSIVFGAIDESKFSGDLFTFPMVNEY-PTIVDAPATLAMTIQGLGAQNKSSCEHETFTTT 280

Query: 368 KIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHI 426
           K P LLDSGT+L   P+ +   +A  + A YS   G Y+LDCP S    +  FDFG   I
Sbjct: 281 KYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDCPVSVGDVEYNFDFGDLQI 340

Query: 427 NASLSSFILS---TGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYN 483
           +  LSS ILS    GS C   + PT+D+   +LGD FL++AYVV+DLDN +IS+AQA +N
Sbjct: 341 SVPLSSLILSPETEGSYCGFAVQPTNDS--MVLGDVFLSSAYVVFDLDNYKISLAQANWN 398

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  226 bits (577), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 163/473 (34%), Positives = 241/473 (50%), Gaps = 69/473 (14%)

Query: 65  AHLFKRADGYEEIIIT-NQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSD 123
           A L     G+ E+ +   +Q +Y+  LD+G+P Q +TVL DTGS+D W+M S+NP+CS  
Sbjct: 23  AALTNDGSGHLELSLQREEQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCSP- 81

Query: 124 TRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPAS 183
                      K + S    A  N           G  I P+   S  S  T  ++  ++
Sbjct: 82  -----------KSNPSLYQNATYN-----------GSKITPSVDCS--SMSTYNENSSST 117

Query: 184 EATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAV 243
              +D   +                   I Y D TF+ G++G + + ++ +++  + F +
Sbjct: 118 YQDLDNGRF------------------YIIYADETFSDGSWGKETVSVNGIDIPDIQFGL 159

Query: 244 AN-ETNSTMGVLGIGLPELEVT--YSGSTASRGRRPFK-YDNFPIVLKNSGAIKTNAYSL 299
           A   T    GVLGIG P  E    Y G+       P K Y NFP +LK+   I   AYSL
Sbjct: 160 AKYATTPVSGVLGIGFPRRESVKGYEGA-------PDKYYPNFPQLLKSEQIIDVVAYSL 212

Query: 300 YLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKN 359
           +LN  D+  G+I+FGA+D SK+ G L T P+VN    +   +P    +TI G+G  +   
Sbjct: 213 FLNSPDSGMGSIVFGAIDESKFYGDLLTFPMVNEY-PTIVDAPATLAMTIQGLGAQNKSG 271

Query: 360 GEK-TLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQI 417
            E+ T  TTK P LLDSGT+L   P+T+   +A  + A YS   G Y+L+CP S D  + 
Sbjct: 272 CERETFMTTKYPVLLDSGTSLLNAPKTIADKMASFVNASYSADEGIYILNCPDSADDIEY 331

Query: 418 VFDFGGFHINASLSSFILS---TGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLE 474
            FDFG   IN  L+S ILS    G  C   + PT+D+   +LGD FL++AYVV+DLDN +
Sbjct: 332 TFDFGDLQINVPLTSLILSPEVEGGYCGFAVQPTNDS--MVLGDVFLSSAYVVFDLDNYK 389

Query: 475 ISMAQAQYNTTTENIEVISSSIPSAVKAPG----YTNTWSTSATIVTGGNIFT 523
           IS+AQA +N + ++ +VI  +IP+    PG        WST+       +I++
Sbjct: 390 ISLAQANWNASEDSKQVI--NIPTDGSIPGGKSATAEPWSTNEPFTVTSDIYS 440

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  223 bits (569), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 166/467 (35%), Positives = 232/467 (49%), Gaps = 72/467 (15%)

Query: 85  FYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGA 144
           FYS  L++GSP Q + ++VD+GS+D W+M S NP+CSS+ +S                  
Sbjct: 46  FYSTTLEIGSPAQKLDLVVDSGSADTWVMASTNPFCSSNAKS------------------ 87

Query: 145 LVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEY-GXXXXXXXXXX 203
                                     G+S+  T +  A   T+DC+              
Sbjct: 88  --------------------------GASKNYTYNGKAITETIDCQGLTALDVNSSSQFR 121

Query: 204 XXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-GVLGIGLPELE 262
                 F I+Y DG+F  G + TD +  +  +++GL F VA   +  + G+LG+G P  E
Sbjct: 122 DLNVGRFYINYTDGSFDDGYWATDEVSAAGAHISGLQFGVAQYASEEIPGILGLGFPRRE 181

Query: 263 VT--YSGSTASRGRRPFK-YDNFPIVLKNSGAIKTNAYSLYLNDSDAEHG-TILFGAVDH 318
               Y G+       P K YDNFP +LK  G I   AYS+YLND +   G ++LFG VD 
Sbjct: 182 SVRGYPGA-------PNKFYDNFPQMLKKDGIIDVVAYSMYLNDPNGSGGGSVLFGGVDP 234

Query: 319 SKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNG-EKTLTTTKIPALLDSGT 377
           SKY+G LYT P+ N    +  S P    VT+ G G      G ++T  T     LLDSGT
Sbjct: 235 SKYSGDLYTFPMANQY-PNIVSKPATLAVTLQGFGAQKKSEGRQETFDTNNYAVLLDSGT 293

Query: 378 TLTYLPETVVALIADEIG--AQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFI 434
           +L   PE VV+ +A  I   A++S   G YV+DCP  DD T+ VFDFG   I   +S+ I
Sbjct: 294 SLMGAPEEVVSKMAHFINKNARFSEDDGIYVMDCPPKDDDTEFVFDFGDLQIAVPVSTLI 353

Query: 435 L--STGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVI 492
           L  S  S C LG++P  D T T LGD FL+ AY+V+DLDN ++SMA+A+++   +    I
Sbjct: 354 LPPSGESYCGLGVLP-KDGTWT-LGDVFLSYAYLVFDLDNYKVSMAKAKFSGDGDQSPQI 411

Query: 493 S----SSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSSQTASFSGN 535
                 +IP A  A      WS+S      G+IFT  S+ +   S N
Sbjct: 412 KIQTDGTIPGAKSASA--KPWSSSEPSTVSGSIFTKSSNVSLPHSSN 456

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  217 bits (552), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 155/470 (32%), Positives = 225/470 (47%), Gaps = 71/470 (15%)

Query: 82  QQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSS 141
           QQ++Y+  L VG+PPQN+TVL+D+GSSD W+M S NP+C            ++   +S+ 
Sbjct: 52  QQTYYATTLQVGTPPQNITVLLDSGSSDFWLMDSKNPFC------------MENYCNSTE 99

Query: 142 SGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDC---KEYGXXXXX 198
                ND+                           TQ++     T+DC    +Y      
Sbjct: 100 IPKYNNDL--------------------------ITQNL-----TIDCSYFNKYNPEISS 128

Query: 199 XXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN-ETNSTMGVLGIG 257
                      F + Y DG+F  G +  + + + + N+T L  AVAN  T    G+LGI 
Sbjct: 129 TYQKLPNDNSRFYLQYTDGSFEDGIWSKETVQIDNYNITSLQLAVANYATTPVGGLLGIS 188

Query: 258 LPELEVT--YSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGA 315
            P  E    Y G+          Y NFP VLKN   I    YS+YLND + + G++LFGA
Sbjct: 189 FPRRESVKGYDGALNEY------YPNFPQVLKNENIIDIVLYSMYLNDLN-QDGSLLFGA 241

Query: 316 VDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKN--GEKTLTTTKIPALL 373
           +D SK+ G + T P+VN +  +    P    +TI G+   ++ +    +T  T+K P LL
Sbjct: 242 IDTSKFEGDMITYPMVN-VYPNVVDKPATLALTIQGVAAQNTNDCTQNETFMTSKFPVLL 300

Query: 374 DSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDD---STQIVFDFGGFHINASL 430
           DSGTTL   P+ +   +AD + A YS     Y+L+CPS +     + +FDFGG  +   L
Sbjct: 301 DSGTTLMSAPKELADKMADFVNATYSEDDRIYILNCPSQEVLNDIEYIFDFGGLQVKIPL 360

Query: 431 SSFILST--GS-TCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTE 487
             FIL +  GS  C  G++P +     +LGD FL+  Y V+DLD+ +IS+A    N  +E
Sbjct: 361 EKFILPSDDGSGPCAFGVLPETTTDRMVLGDIFLSFVYAVFDLDHYQISLANINKNANSE 420

Query: 488 NIEVISSSIPSAVKAPGY----TNTWSTSATIVTGGNIFTVDSSQTASFS 533
           + E    +IPS    PG        WST   I    NI  V S +  S S
Sbjct: 421 SNEDSIINIPSNGAIPGAKVATVKPWSTHEPITVTTNI--VSSCKAPSHS 468

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  205 bits (522), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 152/456 (33%), Positives = 220/456 (48%), Gaps = 67/456 (14%)

Query: 83  QSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC--SSDTRSNSRRRVIDKRDDSS 140
           +SFY+  L +G PPQ +TV+ D+GS+D W+M   NP+C  SS+  +N  + + D      
Sbjct: 54  ESFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFCLSSSNITANGLKTLYD------ 107

Query: 141 SSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXX 200
                             G  I P    S   +  A +S    E                
Sbjct: 108 ------------------GKAIIPKVDCSQIKTYNANRSTSFQELN-------------- 135

Query: 201 XXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMG-VLGIGLP 259
                    F I YGD TFA G +GT+  +   + +  + F +A+   + +G VLGIG  
Sbjct: 136 ------NGRFYIIYGDKTFADGIWGTETFEFGGVKIPNVQFGLADYATTPIGGVLGIGFQ 189

Query: 260 ELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHS 319
             E     + A        Y NFP VLKN G I T AYSL L  S      I+FGA+D +
Sbjct: 190 RRESVKGYTNAPE----VFYPNFPQVLKNEGIIDTVAYSLSLGQSSH----IMFGAIDRN 241

Query: 320 KYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGE-KTLTTTKIPALLDSGTT 378
            Y G + T P++N    +  S P    +TI G+G  + +  + +T +TTK PALLDSG+T
Sbjct: 242 SYIGDMVTFPMINMF-PNAVSKPATLSITIQGLGAQNKQECKFQTFSTTKYPALLDSGST 300

Query: 379 LTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQI--VFDFGGFHINASLSSFIL- 435
           L   P  +   +A  IGAQ+S   G Y L+CP +D+T I  +FDFG       LS+ IL 
Sbjct: 301 LISAPVEIADKMAAFIGAQWSESDGIYTLECP-NDTTNIDYIFDFGDMKFTLPLSNLILP 359

Query: 436 STGSTCLLGI-IPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISS 494
           S G + + G  +  SDN   +LGD FL +  VV+DLD+ +IS+A++   ++ E+I  I S
Sbjct: 360 SQGGSNVCGFGLQRSDNE-IVLGDVFLCSTLVVFDLDHYQISLAKSNQKSSAEDIVNIPS 418

Query: 495 --SIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSSQ 528
              IP A+ A      W+T   I    ++F  + S 
Sbjct: 419 DGKIPGAIIAKA--EAWTTYEPITATTDMFETERSH 452

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  203 bits (517), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 128/318 (40%), Positives = 187/318 (58%), Gaps = 29/318 (9%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F   + D TFASGT+  D +++  + +   +F VA ETN+T+G LG+GL   E+T     
Sbjct: 187 FFTQFYDYTFASGTWYQDTIEVGSIIIEKFNFGVAQETNATIGSLGLGLEGNEIT----- 241

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTG-TLYTI 328
            + G   + Y+NFP  LKNSG IK   YS+Y    D E G++LFGAV+HS+Y G TLYT+
Sbjct: 242 -NEGDYTYTYENFPTKLKNSGMIKRVIYSIYAGKIDTEDGSLLFGAVEHSRYVGDTLYTL 300

Query: 329 PIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVA 388
           P+VN  +AS  S P++F VT+  + VS +K    T+ + +  ALL++G  +TYLP  + +
Sbjct: 301 PLVNVNNAS--SDPVEFHVTLQNLVVSVNKTN-TTIMSDRYAALLNTGAIVTYLPTHLFS 357

Query: 389 LIADEIGAQYSYR-LGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILST------GSTC 441
               + G   S +  G YV DC S+ S    +DFGGF I +SL+ ++         G+ C
Sbjct: 358 DFIKKTGLSESQKYYGMYVTDCSSEIS--FSYDFGGFKIESSLNDYLFEIDESEIPGAKC 415

Query: 442 LLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQY---NTTTENI------EVI 492
            +  I + D    +LG  F ++AYVV+DL+ LE+S+AQA +   N T  NI      E++
Sbjct: 416 AV-TINSHDEKYLVLGSGFFSSAYVVFDLERLEVSIAQAAHVYDNFTYSNIEDNPDVEIV 474

Query: 493 SSSIPSAVKAPGYTNTWS 510
             SIPSA KA  Y+NTW+
Sbjct: 475 IDSIPSATKAASYSNTWT 492

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  187 bits (476), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 141/226 (62%), Gaps = 3/226 (1%)

Query: 284 IVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPI 343
           + LK+ G I+  AYSL+LN+  A  G+ILFGAVD SKY+G LYT+P++         SP 
Sbjct: 1   MALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAYDTLDSVSPG 60

Query: 344 QFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLG 403
            F VT   + V +  +G KT++  + P L DSGTT + LP  V   I      +YS    
Sbjct: 61  MF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQ 119

Query: 404 YYVLDCPSDDSTQIVFDFGGFHINASLSSFILSTGSTCLLGIIPTSDNTGTILGDSFLTN 463
            Y  DC     T +  DFGGF+I+A++S+F+  T   CLL I   + ++G +LGD+FL +
Sbjct: 120 GYTFDCSKVKDTLLSIDFGGFNISANISNFVTRTKDHCLLNI--EAADSGFVLGDAFLVD 177

Query: 464 AYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTW 509
           AYVV+DL++ E+S+AQA ++   E IEVIS  +P A++APGY++TW
Sbjct: 178 AYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRAPGYSSTW 223

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  194 bits (494), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 128/327 (39%), Positives = 183/327 (55%), Gaps = 25/327 (7%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN-ETNSTMGVLGIGLPELEVT--YS 266
           F I Y DGTFA GT+GT+ + +  + +  + F +A   T    GVLGIG P  E    Y 
Sbjct: 126 FYIIYADGTFADGTWGTETVSIDGIVIPNIQFGLAKYATTPVSGVLGIGFPRRESVKGYE 185

Query: 267 GSTASRGRRPFKY-DNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTL 325
           G+       P KY  NFP +LK+   I   AYSL+LN  ++  G+I+FGA+D SK++G L
Sbjct: 186 GA-------PNKYYPNFPQILKSEQIIDVVAYSLFLNSPESGTGSIIFGAIDESKFSGDL 238

Query: 326 YTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGE-KTLTTTKIPALLDSGTTLTYLPE 384
           +T P+VN    +   +P    +TI G+G  +  + E +T  TTK P LLDSGT+L   P+
Sbjct: 239 FTFPMVNEY-PNIVDTPATLAMTIQGLGAQNKNSCEYETFMTTKYPVLLDSGTSLLNAPK 297

Query: 385 TVVALIADEIGAQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFILS---TGST 440
            +   +A  + A YS   G Y+LDCP+  D  +  FDFG   I+  L+S ILS    G  
Sbjct: 298 VIADKMASFVNATYSAEEGIYILDCPAFADEIEYTFDFGDLKISVPLTSLILSPEAEGGY 357

Query: 441 CLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNT---TTENIEVISS-SI 496
           C   + PT+D+   +LGD FL++AYVV+DLDN +IS+AQA ++    TT+ + V +  SI
Sbjct: 358 CGFAVQPTNDS--MVLGDVFLSSAYVVFDLDNYKISLAQANWDVSEITTKLVNVRADGSI 415

Query: 497 PSAVKAPGYTNTWSTSATIVTGGNIFT 523
           P    A      W+ +       NIF+
Sbjct: 416 PGGKTATA--EPWTANEPFTVTSNIFS 440

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 30/39 (76%)

Query: 82  QQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC 120
           +  +Y+  LD+G+P Q +TVL DTGS+D WIM S+NP+C
Sbjct: 41  EDMYYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFC 79

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  188 bits (478), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 136/405 (33%), Positives = 200/405 (49%), Gaps = 76/405 (18%)

Query: 85  FYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGA 144
           +Y   L+ G+PPQ++ +++DTGSSDLW+    NP C +       + +ID       SG 
Sbjct: 52  YYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYNKGSGKPPKCLID------CSGL 105

Query: 145 LVNDINP---FGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXX 201
           +  D++    F +L      IG                                      
Sbjct: 106 VFYDMDKSQTFDYLKNVTFKIG-------------------------------------- 127

Query: 202 XXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-GVLGIGLPE 260
                  Y   +Y  G +       D++ L + ++  L F +A  TN+T  GVLGIG P 
Sbjct: 128 -------YADTTYTSGIWI-----VDIITLPEGHLKDLQFGMAFATNATFSGVLGIGFPA 175

Query: 261 LEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSK 320
           +E + +G   + G+    Y NFP+ LKN+G     AYS+  ND +++ G+ILFG++D S+
Sbjct: 176 ME-SVNGYEFAPGKF---YPNFPLALKNAGFTNIAAYSIEYND-ESKKGSILFGSIDTSR 230

Query: 321 YTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLT 380
           + G LYT P++N         P    +T++GIG+ D    +  ++ TK+PALLD+G+TL 
Sbjct: 231 FIGPLYTFPMINEFPGIA-DEPSTLSLTLDGIGI-DGSCEQWVISNTKLPALLDTGSTLI 288

Query: 381 YLPETVVALIADEIGAQYSYRLGYYVLDCPSDD---STQIVFDFGGFHINASLSSFIL-- 435
            LP  +   IA  + A +S   G +VL CPSDD   +T + F FG  H+   L SFIL  
Sbjct: 289 ELPHPITQSIASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTFGELHMKIPLRSFILLP 348

Query: 436 --STGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMA 478
              +   C LGI  TS     ILGDSFLT+ Y V+DLDN  IS+A
Sbjct: 349 DEESNGLCGLGI--TSSKGRVILGDSFLTHVYTVFDLDNYMISLA 391

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  184 bits (466), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 137/453 (30%), Positives = 210/453 (46%), Gaps = 82/453 (18%)

Query: 68  FKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYC--SSDTR 125
           F   DG+  + + +    Y +E++VG+PPQ +  ++DTGS+DLW+   NNP+C  + D +
Sbjct: 28  FNTGDGFLAMPLHHNDDHYDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFCVGAKDEK 87

Query: 126 SNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEA 185
              R                                 G T T S                
Sbjct: 88  QEVR---------------------------------GVTVTPS---------------- 98

Query: 186 TMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN 245
            +DC+                   F I Y D TF  G++ TD L +   +V+G+ F V  
Sbjct: 99  -IDCRGIKTFCNESSTTLRILPNPFYIDYAD-TFVDGSWATDRLVIGGHDVSGMKFGVGR 156

Query: 246 ETNSTM-GVLGIGLPELEVT--YSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLN 302
            +N+ + GVLG+G   LE    Y+G+  +       Y N P  LK  G+++  AYS+ L 
Sbjct: 157 TSNTELSGVLGVGHANLESVRGYAGAPNA------TYPNLPRQLKLDGSVQKLAYSVSLQ 210

Query: 303 DSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGE- 361
            +    G ILFGA+D SKY G L+T PI+N       +SP  F + + GI +   ++   
Sbjct: 211 KTSERDGEILFGAIDTSKYVGKLHTFPILNI--DPHLNSPSNFYIALQGIDIQGGRSSTG 268

Query: 362 KTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQ----YSYRLGYYVLDCPS-DDSTQ 416
           + L  +   ALLD+GT        VV+ +A++IGA     Y      +V+ CP+ DD+ Q
Sbjct: 269 RPLINSSFHALLDTGTG-----GMVVSSLAEDIGAALNATYDTEQCVFVIQCPTEDDTRQ 323

Query: 417 IVFDFGGFHINASLSSFI-----LSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLD 471
             F+FG   I   +S+F+     L TG  C L I+P +  T   LG  FL   Y V++L+
Sbjct: 324 FNFNFGELQIAVPISNFVVPASGLETGQ-CALAIMPGTSET-FALGIPFLKEVYTVFNLE 381

Query: 472 NLEISMAQAQYNTTTENIEVISSSIPSAVKAPG 504
           + EISMA+A  N    +I  I + +P+A++  G
Sbjct: 382 DNEISMARANTNPQEPDIRPIPAGVPAAIRDSG 414

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  185 bits (469), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 159/462 (34%), Positives = 217/462 (46%), Gaps = 75/462 (16%)

Query: 85  FYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGA 144
           +YS  L++G+  Q + VL D+GSSD+W+  S+NPYC                        
Sbjct: 67  YYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNPYCLE---------------------- 104

Query: 145 LVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXX 204
                        + G +  T  G     ET T  +       DCK  G           
Sbjct: 105 -------------SEGYVNQTYNG-----ETVTPFI-------DCKALGTFDYNGSSSFE 139

Query: 205 XXXX-YFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN-ETNSTMGVLGIGLPELE 262
                 F I Y D +FA G +  + L L+ ++++ L F VA+  T    GVLGIG P  E
Sbjct: 140 RLDIGRFYIKYSDESFADGFWAKEKLRLNGIDISTLQFGVADYATVPVGGVLGIGFPRRE 199

Query: 263 VTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYT 322
                  A     P    NFP VLKN G I   AYS++LN+  ++ G+ILFGAVD +KYT
Sbjct: 200 SVKGYDDAPNEFYP----NFPQVLKNEGVIGVAAYSMFLNEVSSDAGSILFGAVDPTKYT 255

Query: 323 GTLYTIPIVNTLSASGFSSPIQFDVTINGIGV-SDSKNGEKTLTTTKIPALLDSGTTLTY 381
           G+LYT P+VN    +    P    +T+  +G  SDS    KT TTTK   LLDSGTTL  
Sbjct: 256 GSLYTFPMVNEY-PNVVDKPATLAMTLQALGAKSDSSCKYKTFTTTKQAVLLDSGTTLMT 314

Query: 382 LPETVVALIADEI-----GAQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFIL 435
            P      IA+E+     G  Y+   G +  DCPS DD T+ +FDFG   I   L+S ++
Sbjct: 315 APPE----IAEEMAFFCWGPTYNESEGIFYFDCPSDDDDTEFIFDFGDLKITLPLASLVI 370

Query: 436 STG--STCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVIS 493
           S+     C  G+ P S      LG  FL++AYVVYDLDN +IS+AQA+++        + 
Sbjct: 371 SSSGDGHCGFGLTPAS--YSMTLGAIFLSSAYVVYDLDNYQISIAQAKWDGNPSQKSRVR 428

Query: 494 ----SSIPSAVKAPGYTNTWSTSATIVTGGNIFTVDSSQTAS 531
                +I  A KA      W+T   +    ++F   SS  AS
Sbjct: 429 IPKDGTIYGATKATA--TPWTTDEPVKVDYDMFEDHSSCIAS 468

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  166 bits (419), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 95/228 (41%), Positives = 140/228 (61%), Gaps = 7/228 (3%)

Query: 258 LPELEVTYS-GSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAV 316
           LP +E T    +  S    P+ YDNFP+ LK  G I+  AYSL+LN+ +A  G+ILFGAV
Sbjct: 1   LPSVEETDEIENVMSPDTTPYVYDNFPMALKRQGKIEKIAYSLFLNEPNARFGSILFGAV 60

Query: 317 DHSKYTGTLYTIPIV---NTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALL 373
           D SKY+G LYT+P++   NTL +S         V I  + + DSK+G KT++  + P L 
Sbjct: 61  DKSKYSGQLYTLPMLKAYNTLDSSAGMEITAQSVAILSVAIIDSKSGNKTVSEVQFPVLF 120

Query: 374 DSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSF 433
           DSGT+ + LP  +   I      +YS     Y+ DC   ++T +  DFGGF+I+A++S+ 
Sbjct: 121 DSGTSTSALPTEIADAIGRSFDGKYSSDNQGYIFDCSKVNNTLLSIDFGGFNISANISNS 180

Query: 434 ILS-TGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA 480
           +   T   CLL I   +D++G +LGD+FL + YVV+DL++ E+S+AQA
Sbjct: 181 VTPITKDHCLLNI--EADDSGYVLGDAFLIDTYVVFDLESHEVSVAQA 226

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  169 bits (428), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 170/301 (56%), Gaps = 17/301 (5%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-GVLGIGLPELEVTYSGS 268
           F I Y + TF+ G +  D L + + +V+GL F V+N +N+T+ G+LG+G   LE +  G 
Sbjct: 131 FFIDYVN-TFSRGIWAKDRLVIGNADVSGLQFGVSNISNTTINGILGVGYERLE-SVKGY 188

Query: 269 TASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTI 328
           + +  R    Y N P++LK SG I   AYS++LN  ++   T+ FG VD  KYTG LY  
Sbjct: 189 SGAPNR---TYPNLPMLLKESGKIDKVAYSVFLNHLNSNVSTVTFGGVDSEKYTGDLYKF 245

Query: 329 PIVNTLSASGFSSPIQFDVTINGIGVSDSKNG-EKTLTTTKIPALLDSGTTLTYLPETVV 387
           P+VN   +     P +F +T+  + V  + +   KT++ T +PAL D+GT    +P  V 
Sbjct: 246 PLVNIYKS--IPRPSKFHITLQALEVHGNYSSLNKTVSNTPLPALFDTGTNGMVVPPNVA 303

Query: 388 ALIADEIGAQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLSSFILSTG----STCL 442
             IA  I A +  +   Y+  CP+ +D T++VFDFG   I A L++FI+         C 
Sbjct: 304 ENIASTIHATFDEKFSLYLFACPAEEDDTKLVFDFGDIQIEAPLANFIVPAAELGTEQCG 363

Query: 443 LGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTE-NIEVISSSIPSAVK 501
           + IIP  D T T LG  FL + YVVY+L++ E+++AQA +    +  I  I S+IP A +
Sbjct: 364 VAIIP-EDGTFT-LGIPFLRSTYVVYNLEDYEVALAQANWKWDGKSKITPIISNIPGATQ 421

Query: 502 A 502
           A
Sbjct: 422 A 422

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 30/44 (68%)

Query: 79  ITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSS 122
           + N    Y  E++VG+PPQ + VL DTGS+DLW   S+N YC++
Sbjct: 45  LINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDNEYCAA 88

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  157 bits (397), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 136/442 (30%), Positives = 209/442 (47%), Gaps = 71/442 (16%)

Query: 92  VGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINP 151
           VG+P Q +  L+DT SSD+W++ SN+ +C S+   N    +     DS+S+  L N    
Sbjct: 84  VGTPSQAIRFLLDTDSSDIWLLNSNSTFCESE---NGTVNI-----DSNSNSTLAN---- 131

Query: 152 FGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFS 211
                                 ETA++S         CK                   F 
Sbjct: 132 ----------------------ETASRS-----DAYQCKLVNVFYPEDSSSFVLNDLDFH 164

Query: 212 ISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTAS 271
           + Y D ++A+GT+  D       +   ++ A+ +ETN T+G LG+GL   + T      +
Sbjct: 165 VQYDDYSYANGTWSQDTFSFGYPSFYNVNIALVSETNLTVGSLGLGLRANQAT------N 218

Query: 272 RGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTG-TLYTIPI 330
           +G  PF Y++    LK  G I+  AYS+Y ++ +   G I FG + H  Y G  LYT+P+
Sbjct: 219 QGDDPFVYNSLLYRLKTQGWIEKIAYSVYTSELNGTGGGIFFGGLYHDLYKGNVLYTLPL 278

Query: 331 VNTLSASGFSSPIQFDVTINGIGVSDSKNGEK-TLTTTKIPALLDSGTTLTYLPETVVAL 389
           VN         P +F +T+  +  + S NG   ++ + K PALL +G+  TYLPE +   
Sbjct: 279 VNV--DPELDEPARFHITLQNL--TTSINGTNFSVLSEKYPALLSTGSMFTYLPEELFDS 334

Query: 390 IADEI----GAQYSYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILSTGST----- 440
             DE+    GA++      YV+ C  D +   ++DFGGF I   LS +     S      
Sbjct: 335 FVDEMDLEKGAKHK---DLYVIPC--DTNATFIYDFGGFEIETPLSGYTFKVESNRTADD 389

Query: 441 -CLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA---QYNTTTENIEVISSSI 496
            C + + P + +  T LG+ F    YV+++L++LEISMA A   +Y     + E I SSI
Sbjct: 390 MCAVMVKPHNKSYLT-LGNGFFAATYVLFNLEDLEISMAPASGIEY-LDAFDYEYIESSI 447

Query: 497 PSAVKAPGYTNTWSTSATIVTG 518
           PSA +A  Y+NTW  + T  T 
Sbjct: 448 PSASRAASYSNTWILNQTFSTN 469

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  135 bits (339), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 112/417 (26%), Positives = 177/417 (42%), Gaps = 63/417 (15%)

Query: 84  SFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSG 143
           S+Y   + +G+PPQN+ VLVDTGSSDLW+   NNP C +     +     +K +  + S 
Sbjct: 29  SYYETNILIGNPPQNIGVLVDTGSSDLWVNSPNNPNCYNGNIDCTGFTFFNKSNSKTFSN 88

Query: 144 ALVNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXX 203
              N I   G+   +         G  G    +  S                        
Sbjct: 89  IYKNSIFQIGYQDASYTF------GKWGVDSISINS------------------------ 118

Query: 204 XXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETN-STMGVLGIGLPELE 262
                    SY D    +G +          N+    FA+A  +N     VLG+G P  E
Sbjct: 119 ---------SYSDSNEDTGLYA---------NIPNAQFAIATNSNVPVQAVLGLGFPRRE 160

Query: 263 VTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYT 322
                  A+    P    N P ++K  G       ++YL  S+  + +I+FGA D ++Y 
Sbjct: 161 AVNGYKLATNKFYP----NLPQLIKQHGYSDNVTIAMYLG-SNETYNSIMFGAYDKTRYI 215

Query: 323 GTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTT---KIPALLDSGTTL 379
           G L+  P+VN         P  F +T++ + +S   N    +  +   K   +LDSGT+L
Sbjct: 216 GDLHNFPMVNQYPNVT-DKPATFAITLDSMYISMDNNQSDNIYISNDEKYSVVLDSGTSL 274

Query: 380 TYLPETVVALIADEIGAQYSYRLGYYVLDCPSD----DSTQIVFDFGGFHINASLSSFIL 435
              P+  V+ IA  + A +      Y+L   +D        I F F  F++  ++  FIL
Sbjct: 275 LSAPDHYVSKIAGLLNATFDNTTHMYLLPSETDLTLYKDMIINFKFMDFNVPINMLEFIL 334

Query: 436 STGSTCLLGIIPTSD-NTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEV 491
               + +  I+PT + NTG +LGD FL + Y +++LDN  IS+  +  N T+   E+
Sbjct: 335 PYDDSYVFAILPTKNVNTGFVLGDIFLPHVYTIFNLDNYTISLGLSNQNITSNEREI 391

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score =  116 bits (291), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 72/185 (38%), Positives = 107/185 (57%), Gaps = 13/185 (7%)

Query: 347 VTINGIGVSDSKNGE-KTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYY 405
           +TI G+G  +  + + +T  TTK P LLDSGT+L   P+++   +A  + A YS   G Y
Sbjct: 1   MTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIY 60

Query: 406 VLDCP-SDDSTQIVFDFGGFHINASLSSFILS---TGSTCLLGIIPTSDNTGTILGDSFL 461
           +LDCP S    +  FDFG   IN  L+S ILS    G  C   + PT+D+   +LGD FL
Sbjct: 61  ILDCPESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTNDS--MVLGDVFL 118

Query: 462 TNAYVVYDLDNLEISMAQAQYNTTTENIEVIS----SSIPSAVKAPGYTNTWSTSATIVT 517
           ++AYVV+DLDN +IS+AQA +N + ++ ++++     SIPS   A      WST+     
Sbjct: 119 SSAYVVFDLDNYKISLAQANWNASNDSKQLVNIPTDGSIPSGKSATA--QPWSTNVPFTV 176

Query: 518 GGNIF 522
             +I+
Sbjct: 177 TSDIY 181

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score =  117 bits (294), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 108/190 (56%), Gaps = 13/190 (6%)

Query: 342 PIQFDVTINGIGVSDSKNGE-KTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSY 400
           P    +TI G+G  +  + + +T  TTK P LLDSGT+L   P+++   +A  + A YS 
Sbjct: 206 PATLAMTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSA 265

Query: 401 RLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILS---TGSTCLLGIIPTSDNTGTIL 456
             G Y+LDCP S    +  FDFG   IN  L+S ILS    G  C   + PT+D+   +L
Sbjct: 266 DEGIYILDCPESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTNDS--MVL 323

Query: 457 GDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVIS----SSIPSAVKAPGYTNTWSTS 512
           GD FL++AYVV+DLDN +IS+AQA +N + ++ ++++     SIPS   A      WST+
Sbjct: 324 GDVFLSSAYVVFDLDNYKISLAQANWNASNDSKQLVNIPTDGSIPSGKSATA--QPWSTN 381

Query: 513 ATIVTGGNIF 522
                  +I+
Sbjct: 382 VPFTVTSDIY 391

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  105 bits (261), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 111/212 (52%), Gaps = 16/212 (7%)

Query: 186 TMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN 245
           +++C ++G                  I YGDG+FA G + TD L +   ++  + F ++N
Sbjct: 111 SINCTKFGTYTRDKSSTSNKLDHRLFIQYGDGSFADGEWITDTLTIGPYDLQSVQFGISN 170

Query: 246 ETNSTM-GVLGIGLPELEVT--YSGSTASRGRRPFK-YDNFPIVLKNSGAIKTNAYSLYL 301
             ++ + GVLG+G    E    Y GS       P K Y N P  LK+     TNA+SL+L
Sbjct: 171 NASTIISGVLGLGFLRTESIDGYDGS-------PNKLYYNLPAYLKDQEITNTNAFSLFL 223

Query: 302 NDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGE 361
           N+S+   GT+LFG +D+SK++G L T P+VN +     + P  F +T+  +      NG 
Sbjct: 224 NNSNDASGTVLFGGIDYSKFSGDLVTFPLVN-IYPKLINEPCTFTITLQQL--YGKINGG 280

Query: 362 KT--LTTTKIPALLDSGTTLTYLPETVVALIA 391
           K+  L   K+PALLDSG++L  +P  +   IA
Sbjct: 281 KSIGLIKEKVPALLDSGSSLISMPIEITDEIA 312

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 67/151 (44%), Gaps = 30/151 (19%)

Query: 2   RLATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRDK 61
           RL+ + + +L   F L  LA  IP+ S                     +  S +NV   +
Sbjct: 4   RLSKIYTLILILAF-LHRLAISIPIISSENN-----------------FRSSNNNVHYSR 45

Query: 62  KPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCS 121
             + H +   D     I  +   FYS  L  G+P QNVTVLVDTGSSDLW+   NN YC 
Sbjct: 46  SYDNHNYLELD-----IQYHYGQFYSTLLSFGNPVQNVTVLVDTGSSDLWVSSPNNIYCY 100

Query: 122 SDTRSNSRRRVID-------KRDDSSSSGAL 145
            D ++ +    I+        RD SS+S  L
Sbjct: 101 EDGKNTNINHSINCTKFGTYTRDKSSTSNKL 131

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 100/354 (28%), Positives = 169/354 (47%), Gaps = 61/354 (17%)

Query: 234 LNVTGLSFAVANETNSTM-GVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAI 292
           L +   SF +ANET S + G LG+  P + V  S S +S       Y  F   LKN+G I
Sbjct: 148 LTINSTSFILANETGSLVHGALGLSGP-ISVPASDSVSSLNFDDSYY--FLTHLKNAGVI 204

Query: 293 KTNAYSLYLNDSD----------AEHGTILFGAVDHSKYTGTLYT---IPIVNTLSASGF 339
           +T++YSL++N++           A  GT+L G+VD   Y G L +   IP  +   +SG+
Sbjct: 205 ETSSYSLWVNNASNHSVDGQINRANAGTLLLGSVDPKYYDGDLISFGSIPFKD--ESSGY 262

Query: 340 SSPIQFDVTINGIGVSDSKNGEKTLTTTKI--PALLDSGTTLTYLPETVVALIADEIGAQ 397
            S     V ++ + +++S+     LT +    P  + S    +YLP +++  ++ +  A 
Sbjct: 263 LSTGYPIVPMSRVSIANSEQEAVNLTDSSFLQPVFIHSRYLYSYLPLSLIIQVSIQTNAV 322

Query: 398 YSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILST--------------GSTCL 442
           Y   L  +++ C   D  + ++F+FG  +I+     F+ +T                 C 
Sbjct: 323 YVESLDRWLVACDIGDMGSNLIFEFGNLNISVPTVDFLGATYNMYSNSSLRFTNGKEACY 382

Query: 443 LGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENI-------EVISSS 495
           L + P    + ++LG SF+ NAY+V+D+DN  I++AQA  +   E         ++ SS+
Sbjct: 383 LKMYPNYATSFSVLGQSFIKNAYIVHDVDNSNIALAQAASDEAVEKAANNSPAKKIESST 442

Query: 496 IPSAVKAP-----GYTNTWST---------SATIVTGGNIFT----VDSSQTAS 531
           IP A+          +N+ +T         +ATI + G IFT     D+S+T S
Sbjct: 443 IPYALPNNFTYDLAMSNSLATISSVLLNRFTATIASDGEIFTGRSFYDTSRTTS 496

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 127/285 (44%), Gaps = 43/285 (15%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 262
           F+I YG G+   G    D L+L DL++T   FA A              G+LG+G   + 
Sbjct: 162 FAIRYGSGSL-EGYISQDTLNLGDLSITKQDFAEATSEPGLQFAFGKFDGILGLGYDTIS 220

Query: 263 VTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYL-NDSDAEHGTIL-FGAVDHSK 320
           V         G  P  Y+ +       G +    ++ YL  D +++ G +  FG VD SK
Sbjct: 221 VD--------GVVPPFYNAW-----KQGLLDEPKFAFYLGRDGESQDGGVATFGGVDDSK 267

Query: 321 YTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLT 380
           Y G +  +PI              ++V  +GIG+     GE+        A +D+GT+L 
Sbjct: 268 YEGEITWLPIRRK---------AYWEVKFDGIGL-----GEEYAELENHGAAIDTGTSLI 313

Query: 381 YLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGS 439
            LP  +  +I  EIGA+ S+  G Y ++C +  S   + F  GG +   +   +IL    
Sbjct: 314 ALPSGLAEIINAEIGAKKSWT-GQYTVECEARSSLPNMTFTLGGHNFELTAYDYILEVSG 372

Query: 440 TCLLGIIPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
            C+  I P    +  G   I+GDSFL   Y +YDL N  + +A A
Sbjct: 373 QCISAIFPMDFPEPVGPLAIIGDSFLRKYYSIYDLGNNAVGLADA 417

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 90.9 bits (224), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 81/288 (28%), Positives = 122/288 (42%), Gaps = 48/288 (16%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 262
           F+I YG G+   G    D L + DL +    FA A              G+LG+G   + 
Sbjct: 160 FAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLGYDTIA 218

Query: 263 VTYSGSTASRGRRPFKYDNFPIVLK--NSGAIKTNAYSLYLN---DSDAEHGTILFGAVD 317
           V                   P V K  N G +    ++ YLN   DS+   G + FG +D
Sbjct: 219 VD---------------KVVPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGID 263

Query: 318 HSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGT 377
            SKY G +  +P+              ++V  +GIG+     G++        A +D+GT
Sbjct: 264 SSKYKGNITWLPV---------RRKAYWEVKFDGIGL-----GDEYAELEGTGAAIDTGT 309

Query: 378 TLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILS 436
           +L  LP  +  ++  EIGA+  +  G Y +DC S D    + F F G +   S   + L 
Sbjct: 310 SLIALPSGLAEVLNAEIGAKKGWS-GQYTVDCESRDQLPDLTFTFNGKNFTISAYDYTLE 368

Query: 437 TGSTCLLGIIPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
              +C+    P    +  G   I+GD+FL   Y VYDL N  + +AQA
Sbjct: 369 VSGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSVYDLGNNAVGLAQA 416

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 22/27 (81%)

Query: 86  YSVELDVGSPPQNVTVLVDTGSSDLWI 112
           Y  E+ +G+PPQ+  V++DTGSS+LW+
Sbjct: 103 YFTEITLGTPPQSFKVILDTGSSNLWV 129

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 121/270 (44%), Gaps = 37/270 (13%)

Query: 221 SGTFGTDVLDLSDLNVTGLSFAVANET-----NSTMGVLGIGLPELEVTYSGSTASRGRR 275
            G   TDVL + D  +    FA A  +      S  GV G+G  EL        A  G+ 
Sbjct: 25  QGYLSTDVLGMGDAVLGEQGFAEATSSVLPFIASYQGVFGLGHREL--------AKGGQV 76

Query: 276 PFKYDNFPIVLKNSGAIKTNAYSLYL--NDSDAEHGTILFGAVDHSKYTGTLYTIPIVNT 333
           P  Y+     +   G +K   + ++L  N +    G I+FG  D +K+ G+L  +PI   
Sbjct: 77  PPIYN-----MMERGQLKDPMFGIFLPKNLAHINEGEIIFGGYDSTKFAGSLEWLPI--- 128

Query: 334 LSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADE 393
            +  GF     ++V  N I       GE T+    + A+LD+G++LT LP  +       
Sbjct: 129 -TKKGF-----WEVEFNSI-----STGESTVQGEGLGAILDTGSSLTLLPTEIFDKFNGA 177

Query: 394 IGAQYSYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILSTGSTCLLGIIPTSDNTG 453
           + A    + G  V     + + +IVF+ GG     + + +I+  GS C++ I P +    
Sbjct: 178 LEAALGSKTGGRVSCSARETAPEIVFELGGKKFAITGNEYIMPAGSECMVTIRPQASGAQ 237

Query: 454 T---ILGDSFLTNAYVVYDLDNLEISMAQA 480
           +   ILG  FL   Y VYDL +  + +A+A
Sbjct: 238 SNVVILGTPFLRKFYSVYDLGSDRVGLAEA 267

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 122/288 (42%), Gaps = 48/288 (16%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTM-------GVLGIGLPELE 262
           F+I YG G+   G    D L + DL +    FA A              G+LG+G   + 
Sbjct: 155 FAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLGYDTIS 213

Query: 263 VTYSGSTASRGRRPFKYDNFPIVLK--NSGAIKTNAYSLYLN---DSDAEHGTILFGAVD 317
           V                   P V K  N G +    ++ YLN   DS+   G + FG +D
Sbjct: 214 VD---------------KVVPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGID 258

Query: 318 HSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGT 377
            SKY G +  +P+              ++V  +GIG+     G++        A +D+GT
Sbjct: 259 SSKYKGDITWLPV---------RRKAYWEVKFDGIGL-----GDEYAELQGTGAAIDTGT 304

Query: 378 TLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILS 436
           +L  LP  +  ++  EIGA+  +  G Y +DC S D    + F F G +   +   + L 
Sbjct: 305 SLIALPSGLAEVLNSEIGAKKGWT-GQYTVDCESRDQLPDLTFTFNGKNFTITAYDYTLE 363

Query: 437 TGSTCLLGIIPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
              +C+    P    +  G   I+GD+FL   Y +YDL N  + +AQA
Sbjct: 364 VSGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSIYDLGNNAVGLAQA 411

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 22/27 (81%)

Query: 86  YSVELDVGSPPQNVTVLVDTGSSDLWI 112
           Y  E+ +G+PPQ+  V++DTGSS+LW+
Sbjct: 98  YFTEISLGTPPQSFKVILDTGSSNLWV 124

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 130/310 (41%), Gaps = 31/310 (10%)

Query: 180 VPASEA-TMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVTG 238
           VP+SE  ++ C  +                 F+I YG G+   G    D L++ DL +  
Sbjct: 118 VPSSECNSLACFLHSKYDHDASSSYKANGTKFAIQYGSGSL-EGYISQDTLNIGDLTIPK 176

Query: 239 LSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYS 298
             FA A          G     L + Y   +  +   PF Y+         G +    ++
Sbjct: 177 QDFAEATSEPGLTFAFGKFDGILGLAYDTISVDKVVPPF-YNAI-----EQGLLDEKKFA 230

Query: 299 LYLNDSDAEH---GTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVS 355
            YL D+  +    G I  G +D SK+ G +  +P+              ++V   GI + 
Sbjct: 231 FYLGDTKKDEKNGGEITIGGIDESKFKGDIEWLPV---------RRKAYWEVKFEGIAL- 280

Query: 356 DSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS- 414
               G++        A +D+GT+L  LP  +  +I  EIGA+  +  G Y LDC + D  
Sbjct: 281 ----GDQYAALENHGAAIDTGTSLITLPSGLAEIINTEIGAKKGWT-GQYTLDCDTRDGL 335

Query: 415 TQIVFDFGGFHINASLSSFILSTGSTCLLGIIPTS--DNTG--TILGDSFLTNAYVVYDL 470
             + F+F G +   S   + L    +C+  I+P    +  G   I+GD+FL   Y +YDL
Sbjct: 336 PDLTFNFNGKNFTISPFDYTLEVSGSCISAIMPMDFPEPMGPMAIVGDAFLRKYYSIYDL 395

Query: 471 DNLEISMAQA 480
           DN  + +A+A
Sbjct: 396 DNHAVGLAEA 405

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 9/97 (9%)

Query: 67  LFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRS 126
            F   DG+   +     + Y  ++ VG+PPQN  V++DTGSS+LW+  S           
Sbjct: 73  FFAEGDGHNVPLTNYLNAQYFADISVGTPPQNFKVILDTGSSNLWVPSS---------EC 123

Query: 127 NSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIG 163
           NS    +  + D  +S +   +   F    G+G L G
Sbjct: 124 NSLACFLHSKYDHDASSSYKANGTKFAIQYGSGSLEG 160

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 87.8 bits (216), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 125/279 (44%), Gaps = 30/279 (10%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           FSI YG G+   G    D L + DL +    FA A          G     L + Y   +
Sbjct: 158 FSIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLAYDTIS 216

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDS--DAEHG-TILFGAVDHSKYTGTLY 326
             +   PF Y+     L     +    ++ YL D+  DAE G   +FG VD SKYTG + 
Sbjct: 217 VDKVVPPF-YNALEQDL-----LDEAKFAFYLGDTNKDAEDGGEAIFGGVDKSKYTGDVT 270

Query: 327 TIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETV 386
            +P+              ++V + G+G+     G++        A +D+GT+L  LP  +
Sbjct: 271 WLPVRRK---------AYWEVKLEGLGL-----GDEYAELESHGAAIDTGTSLITLPSGL 316

Query: 387 VALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGSTCLLGI 445
             +I  EIGA+  +  G Y L+C + D    + F+F G++       + L    +C+  I
Sbjct: 317 AEIINSEIGAKKGWT-GQYTLECNTRDQLPDLTFNFNGYNFTIGPYDYTLEVSGSCISAI 375

Query: 446 IPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
            P    +  G   I+GD+FL   Y +YDL++  + +A+A
Sbjct: 376 TPMDFPEPVGPLAIVGDAFLRKYYSIYDLEHNAVGLAKA 414

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 9/96 (9%)

Query: 68  FKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSN 127
           F+ A G+E  +     + Y  ++ +G+PPQ   V++DTGSS+LW+  S    C S     
Sbjct: 83  FEVAKGHEVPLSNYLNAQYYTDITLGTPPQQFKVILDTGSSNLWVPSSE---CGS----- 134

Query: 128 SRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIG 163
               + +K D S+SS    N  + F    G+G L G
Sbjct: 135 LACFLHEKYDHSASSSYKANGTD-FSIQYGSGSLEG 169

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 121/286 (42%), Gaps = 54/286 (18%)

Query: 1   MRLATVRSAVLSSLFALQVLAKIIPVASKRXXXXXXXXXKFVKLPFHKLYGDSLDNVGRD 60
           MRL  + +  L    +L +L      A             +VK P  KL      N+   
Sbjct: 17  MRLRNIINMQLFPFLSLTLLLTYFQAA------FGSSSNSYVKFPVQKL-----ANIPNT 65

Query: 61  KKPEAH-LFKRADGYEEIIITNQQS--FYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNN 117
              +A  + KR++ +   II    S   Y VE+ +G+PPQ   + +DTGSSD+ +  +++
Sbjct: 66  NLQDASGISKRSEAFNSTIINMFASAGIYVVEMQIGTPPQTAYLELDTGSSDMCVNEADS 125

Query: 118 PYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIGPTATGSGGSSETAT 177
            +C S         + D  +  +S+  L                   TAT +    ET +
Sbjct: 126 AHCKS---------LADDNNIWTSNYEL-------------------TATAT----ETLS 153

Query: 178 QSVPASEATMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSDLNVT 237
             +P+      C  +G                F ++YG       T+GTDV+ L ++ ++
Sbjct: 154 TPLPSVHHITSCSYWGTFNPNISSTFKYNETIFDLTYG-------TYGTDVVSLGNITLS 206

Query: 238 GLSFAVANETNSTMGVLGIGLPELEVTYSGSTA-SRGRRPFKYDNF 282
             +F V+N+T  + G+LGI LP  E+T  G  A S  + PF YDNF
Sbjct: 207 NYTFGVSNDTTMSYGILGISLPSEEITDRGQDALSSNKTPFAYDNF 252

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 121/279 (43%), Gaps = 30/279 (10%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F+I YG G+   G    DV+++ DL +T   FA A          G     L + Y    
Sbjct: 156 FAIQYGSGSL-EGYISQDVMEIGDLKITKQDFAEATSEPGISFAFGKFDGILGLAYDTIA 214

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEH---GTILFGAVDHSKYTGTLY 326
            +R   P  Y+       N G +    ++ YL D+       G  +FG +D +K+ G + 
Sbjct: 215 VNRVVPPV-YNAI-----NQGLLDEPKFAFYLGDASKSKDNGGEAVFGGIDETKFEGDIT 268

Query: 327 TIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETV 386
            +P+              ++V + G+G+     GE+        A +D+GT+L  LP  +
Sbjct: 269 WLPV---------RRKAYWEVKLEGLGL-----GEEYTELENHGAAIDTGTSLITLPSGL 314

Query: 387 VALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGSTCLLGI 445
             +I  EIGA+  +  G Y ++C    S   + F F G++   S   + L    +C+  I
Sbjct: 315 AEIINSEIGAKKGWT-GQYTIECDKRASLPDMTFTFDGYNFTISPYDYTLEVSGSCISAI 373

Query: 446 IPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
            P    +  G   I+GD+FL   Y VYDL N  + +A A
Sbjct: 374 TPMDFPEPVGPMAIIGDAFLRKYYSVYDLGNDAVGLAPA 412

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 30/42 (71%), Gaps = 1/42 (2%)

Query: 72  DGYEEIIITN-QQSFYSVELDVGSPPQNVTVLVDTGSSDLWI 112
           +G  E+ ++N   + Y  ++ +G+PPQ+  V++DTGSS+LW+
Sbjct: 84  NGGHEVPLSNYMNAQYFADIKIGTPPQSFKVVLDTGSSNLWV 125

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 130/286 (45%), Gaps = 44/286 (15%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVA-NETNSTM------GVLGIGLPELE 262
           F+I YG G+   G    D L + DL +    FA A +E   T       G+LG+G     
Sbjct: 148 FAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLG----- 201

Query: 263 VTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDS--DAEHG-TILFGAVDHS 319
             Y   +  +   PF Y+     L     +    ++ YL D+  D+E+G    FG +D S
Sbjct: 202 --YDTISVDKVVPPF-YNAIQQDL-----LDEKKFAFYLGDTSKDSENGGEATFGGIDES 253

Query: 320 KYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTL 379
           K+ G +  +P+              ++V   GIG+     G++        A +D+GT+L
Sbjct: 254 KFKGDITWLPV---------RRKAYWEVKFEGIGL-----GDEYAELESHGAAIDTGTSL 299

Query: 380 TYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTG 438
             LP  +  +I  E+GA+  +  G Y LDC + DS   ++F+F G++       + L   
Sbjct: 300 ITLPSGLAEMINAELGAKKGWT-GQYTLDCNTRDSLPDLIFNFNGYNYTIGPYDYTLEVS 358

Query: 439 STCLLGIIPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
            +C+  I P    +  G   I+GD+FL   Y +YDL N  + +A+A
Sbjct: 359 GSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNNAVGLAKA 404

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 66  HLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWI 112
           H F    G++  +     + Y  ++ +G+PPQN  V++DTGSS+LW+
Sbjct: 71  HPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWV 117

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 123/278 (44%), Gaps = 29/278 (10%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F+I YG G+   G    D+L + DL +    FA A          G     L + Y   +
Sbjct: 153 FAIQYGSGSL-EGYVSRDLLTIGDLVIPDQDFAEATSEPGLAFAFGKFDGILGLAYDSIS 211

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEH--GTILFGAVDHSKYTGTLYT 327
            +R   P  Y+     +KN   +    ++ YL DSD     G   FG +D  KYTG +  
Sbjct: 212 VNRIVPPV-YN----AIKNK-LLDDPVFAFYLGDSDKSEDGGEASFGGIDEEKYTGEITW 265

Query: 328 IPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVV 387
           +P+              ++V   GIG+     GE+  T     A +D+GT+L  LP  + 
Sbjct: 266 LPVRRK---------AYWEVKFEGIGL-----GEEYATLEGHGAAIDTGTSLIALPSGLA 311

Query: 388 ALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGSTCLLGII 446
            ++  EIGA+  +  G Y +DC S DS   +  +F G++   +   + L    +C+    
Sbjct: 312 EILNAEIGAKKGWS-GQYSVDCESRDSLPDLTLNFNGYNFTITAYDYTLEVSGSCISAFT 370

Query: 447 PTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
           P    +  G   I+GD+FL   Y +YD+ +  + +A+A
Sbjct: 371 PMDFPEPVGPLAIIGDAFLRKYYSIYDIGHDAVGLAKA 408

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 62  KPEAHLFKRADGYEEIIITNQ-QSFYSVELDVGSPPQNVTVLVDTGSSDLWI 112
           K    +F   +G   + +TN   + Y  E+ +GSPPQ+  V++DTGSS+LW+
Sbjct: 71  KDNVDVFVAPEGSHSVPLTNYLNAQYFTEITLGSPPQSFKVILDTGSSNLWV 122

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 84.7 bits (208), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 130/286 (45%), Gaps = 44/286 (15%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVA-NETNSTM------GVLGIGLPELE 262
           F+I YG G+   G    D L + DL +    FA A +E   T       G+LG+G     
Sbjct: 148 FAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLG----- 201

Query: 263 VTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDS--DAEHG-TILFGAVDHS 319
             Y   +  +   PF Y+     L     +    ++ YL D+  D+E+G    FG +D S
Sbjct: 202 --YDTISVDKVVPPF-YNAIQQDL-----LDEKKFAFYLGDTSKDSENGGEATFGGIDES 253

Query: 320 KYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTL 379
           K+ G +  +P+              ++V   GIG+     G++        A +D+GT+L
Sbjct: 254 KFKGDITWLPV---------RRKAYWEVKFEGIGL-----GDEYAELEGHGAAIDTGTSL 299

Query: 380 TYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTG 438
             LP  +  +I  E+GA+  +  G Y LDC + DS   ++F+F G++       + L   
Sbjct: 300 ITLPSGLAEMINAELGAKKGWT-GQYTLDCNTRDSLPDLIFNFNGYNFTIGPYDYTLEVS 358

Query: 439 STCLLGIIPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
            +C+  I P    +  G   I+GD+FL   Y +YDL N  + +A+A
Sbjct: 359 GSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNDAVGLAKA 404

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 66  HLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWI 112
           H F    G++  +     + Y  ++ +G+PPQN  V++DTGSS+LW+
Sbjct: 71  HPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWV 117

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 129/286 (45%), Gaps = 44/286 (15%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVA-NETNSTM------GVLGIGLPELE 262
           F+I YG G+   G    D L + DL +    FA A +E   T       G+LG+G     
Sbjct: 148 FAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLG----- 201

Query: 263 VTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDS--DAEHG-TILFGAVDHS 319
             Y   +  +   PF Y+     L     +    ++ YL D+  D E+G    FG +D S
Sbjct: 202 --YDTISVDKVVPPF-YNAIQQDL-----LDEKRFAFYLGDTSKDTENGGEATFGGIDES 253

Query: 320 KYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTL 379
           K+ G +  +P+              ++V   GIG+     G++        A +D+GT+L
Sbjct: 254 KFKGDITWLPV---------RRKAYWEVKFEGIGL-----GDEYAELESHGAAIDTGTSL 299

Query: 380 TYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTG 438
             LP  +  +I  EIGA+  +  G Y LDC + D+   ++F+F G++       + L   
Sbjct: 300 ITLPSGLAEMINAEIGAKKGWT-GQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVS 358

Query: 439 STCLLGIIPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
            +C+  I P    +  G   I+GD+FL   Y +YDL N  + +A+A
Sbjct: 359 GSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKA 404

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 29/47 (61%)

Query: 66  HLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWI 112
           H F    G++  +     + Y  ++ +G+PPQN  V++DTGSS+LW+
Sbjct: 71  HPFFTEGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWV 117

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 134/285 (47%), Gaps = 40/285 (14%)

Query: 234 LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIK 293
           L++   SF  A  +N   G LG+G   L       TA           F  +LKN+  IK
Sbjct: 157 LSIPEFSFFRAEHSNIVDGSLGLGARILS-----GTAEDSSGFDSSFFFLDMLKNANFIK 211

Query: 294 TNAYSLYL-ND---------SDAEHGTILFGAVDHSKYTGTLY---TIPIVNTLSASGFS 340
           + +YS++L ND         + ++ GT+L GAVD + + G  Y    +P  ++ + + F+
Sbjct: 212 STSYSIWLGNDNSTLNASRLASSDVGTLLLGAVDPNYFIGNFYRFKMLPFRDSKTETTFN 271

Query: 341 S-PIQFDVTINGIGVSDSKNGEKTLTTTKI--PALLDSGTTLTYLPETVVALIADEIGAQ 397
           S PI   V +  + + ++K     +T      P LLD   T++YLP  ++  IA +  A 
Sbjct: 272 SLPI---VPLTKVDIVNAKGTAVNVTQPGFMEPVLLDPRYTISYLPIELILQIAMQTNAV 328

Query: 398 YSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILS--------------TGSTCL 442
           Y   L  +++DC  ++   +I F FG   I+  LS F+ S              +  TC 
Sbjct: 329 YVKSLDLWLVDCDVANFDAKIRFQFGDLKIDVPLSHFVSSGYVGSPIASTQLGASNMTCQ 388

Query: 443 LGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTE 487
           L + P   +  +ILG +FL + Y+  DL+   ++MAQA YN   +
Sbjct: 389 LNVYPNYSSGFSILGGTFLRSVYLSVDLEGNSVAMAQA-YNAVKD 432

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 127/286 (44%), Gaps = 44/286 (15%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVA-NETNSTM------GVLGIGLPELE 262
           F+I YG G+   G    D L + DL +    FA A +E   T       G+LG+G     
Sbjct: 149 FAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLG----- 202

Query: 263 VTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDS--DAEHG-TILFGAVDHS 319
             Y   +  +   PF Y+     L     +    ++ YL D+  D+E+G    FG +D S
Sbjct: 203 --YDTISVDKVVPPF-YNAIQQDL-----LDEKKFAFYLGDTSKDSENGGEATFGGIDKS 254

Query: 320 KYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTL 379
           K+ G +  +P+              ++V   GIG+     G +        A +D+GT+L
Sbjct: 255 KFKGDVTWLPVRRK---------AYWEVKFEGIGL-----GHEFAELEGHGAAIDTGTSL 300

Query: 380 TYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTG 438
             LP  +  +I  EIGA+  +  G Y LDC + D    + F+F G++       + L   
Sbjct: 301 ITLPSGLAEMINAEIGAKKGWS-GQYALDCNTRDGLPDLTFNFNGYNFTIGPYDYTLEVS 359

Query: 439 STCLLGIIPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
            +C+  I P    +  G   I+GD+FL   Y +YDL N  + +A+A
Sbjct: 360 GSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNDAVGLAEA 405

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 9/98 (9%)

Query: 66  HLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTR 125
           H F    G++  +     + Y  ++ +G+PPQN  V++DTGSS+LW+           T 
Sbjct: 72  HPFFTEGGHDVPLTNYLNAQYYTDISLGNPPQNFKVILDTGSSNLWV---------PSTE 122

Query: 126 SNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIG 163
             S    +  + D  +S +   +   F    GTG L G
Sbjct: 123 CGSLACFLHSKYDHEASSSYKPNGTEFAIQYGTGSLEG 160

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 117/271 (43%), Gaps = 31/271 (11%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F+I YG G    G    D + + DL +    FA A          G       + +   +
Sbjct: 156 FAIRYGSGAL-EGYMSNDTVTVGDLQIPKQDFAEATSEPGLAFAFGKFDGIFGLAFDTIS 214

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSD--AEHGTILFGAVDHSKYTGTLYT 327
            +R   PF Y+       N G +    ++ YL D     E G + FG  D +++TG +  
Sbjct: 215 VNRAVPPF-YNAV-----NRGLLDAPQFAFYLGDKRLRKEGGEVTFGGYDETRFTGNITW 268

Query: 328 IPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVV 387
           +P+              ++V  NGI       G +    T   A +D+GT+L  LP  + 
Sbjct: 269 LPV---------RREAYWEVDFNGISF-----GSQYAPLTATGAAIDTGTSLITLPSGLA 314

Query: 388 ALIADEIGAQYSYRLGYYVLDCPSDDST--QIVFDFGGFHINASLSSFILSTGSTCLLGI 445
            ++  +IGA+ ++  G YVLDC S  ST   I F+ GG + +     + L    TC+  I
Sbjct: 315 EILNAQIGARKNWS-GQYVLDC-SRRSTLPDITFNLGGSNFSIGPYDYTLEASGTCISAI 372

Query: 446 IPTS--DNTG--TILGDSFLTNAYVVYDLDN 472
           +P    +  G   I+GD+FL   Y VYDL N
Sbjct: 373 VPMDFPEPVGPLAIIGDAFLRRWYSVYDLGN 403

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 9/78 (11%)

Query: 86  YSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGAL 145
           Y  ++ +GSP Q   V++DTGSS+LW+              NS    +  + D   S   
Sbjct: 99  YFADISIGSPGQTFRVIMDTGSSNLWV---------PSVDCNSLACFLHNKYDHRVSSTY 149

Query: 146 VNDINPFGWLTGTGGLIG 163
           V +   F    G+G L G
Sbjct: 150 VRNGTRFAIRYGSGALEG 167

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 119/278 (42%), Gaps = 29/278 (10%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           FSI YG G+   G    DVL + DL + G  FA A          G     L + Y    
Sbjct: 146 FSIQYGSGSM-EGYISQDVLQIGDLVIPGQDFAEATSEPGLAFAFGKFDGILGLAYDTIA 204

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLND--SDAEHGTILFGAVDHSKYTGTLYT 327
            +R   PF Y+       N   +    +S YL D     + G + FG  D S +TG +  
Sbjct: 205 VNRVVPPF-YNAI-----NKKLVDEPIFSFYLGDDTKSEDGGQVTFGGYDSSLFTGDITW 258

Query: 328 IPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVV 387
           +P+            ++FD    G  V+D  N           A +D+GT+L  LP  + 
Sbjct: 259 LPVRRKAYWE-----VKFDAIALGNEVADLVNHG---------AAIDTGTSLITLPSGLA 304

Query: 388 ALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGSTCLLGI- 445
            +I  +IGA+ S+  G +++DC + D+   + F F G++   +   + L    +C+  I 
Sbjct: 305 EVINSQIGAKKSWS-GQWIVDCKTRDTLPDMTFTFDGYNFTITPYDYTLEVSGSCISAIT 363

Query: 446 ---IPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA 480
               P       I+GD+FL   Y +YD+ N  + +A A
Sbjct: 364 PMDFPAPVGPLAIVGDAFLRRYYSIYDVGNNAVGLAAA 401

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 28/47 (59%)

Query: 66  HLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWI 112
           H F +  G+   +     + Y  ++ +G+P Q+  V++DTGSS+LW+
Sbjct: 69  HPFFKNGGHNIPLSNYLNAQYYTDITLGTPAQSFKVILDTGSSNLWV 115

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 82.0 bits (201), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 123/278 (44%), Gaps = 29/278 (10%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F+I YG G+   G    D L + DL +    FA A          G     L + Y   +
Sbjct: 148 FAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLAYDSIS 206

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDA--EHGTILFGAVDHSKYTGTLYT 327
             +   P  Y+       ++G +    +S YL ++D   + G   FG +D SKY G +  
Sbjct: 207 VDKVVPPV-YNAI-----HNGLLDEPKFSFYLGNADKSTDGGEATFGGIDSSKYEGNITW 260

Query: 328 IPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVV 387
           +P+              ++V  +GIG+     G++        A +D+GT+L  LP  + 
Sbjct: 261 LPVRRK---------AYWEVKFDGIGL-----GDEYAILDGHGAAIDTGTSLIALPSGLA 306

Query: 388 ALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGSTCLLGII 446
            ++  EIGA+  +  G Y ++C + DS   +  +FGG++   +   + L    +C+    
Sbjct: 307 EILNAEIGAKKGWS-GQYSVECDTRDSLPDLTLNFGGYNFTITPYDYTLEVSGSCISAFT 365

Query: 447 PTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
           P    +  G   I+GD+FL   Y VYDL N  + +A+A
Sbjct: 366 PMDFPEPVGPLAIIGDAFLRKHYSVYDLGNDAVGLAKA 403

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 5/55 (9%)

Query: 63  PEAHLFKRADGYEE----IIITNQ-QSFYSVELDVGSPPQNVTVLVDTGSSDLWI 112
           PEA   K    Y E    + +TN   + Y  E+ +G+PPQN  V++DTGSS+LW+
Sbjct: 63  PEAEFAKEHQFYAEAGHDVPLTNYLNAQYYTEISLGTPPQNFKVILDTGSSNLWV 117

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 81.6 bits (200), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 126/280 (45%), Gaps = 31/280 (11%)

Query: 210 FSISYGDGTFASGTFGTDVLDL-SDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGS 268
           F+I YG G+   G    D L +  DL +    FA A          G     L + Y   
Sbjct: 161 FTIQYGSGSM-DGYISRDTLIIGDDLVIPEQDFAEATSEPGLAFAFGKFDGILGLAYDTI 219

Query: 269 TASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEH---GTILFGAVDHSKYTGTL 325
             ++   PF Y+         G +  N ++ YL D++ ++   G   FG  D SK+TG +
Sbjct: 220 AVNKVVPPF-YNAI-----KQGILDENKFAFYLGDTNKDNKSGGEATFGGYDKSKFTGDI 273

Query: 326 YTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPET 385
             +P+              ++V  + I +     G++  +     A +D+GT+L  LP  
Sbjct: 274 TWLPV---------RRKAYWEVKFDSIAL-----GDEVASLDGYGAAIDTGTSLITLPSG 319

Query: 386 VVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGSTCLLG 444
           +  +I  +IGA+ S+  G Y +DC + D+   + F+F G++   S   + L    +C+  
Sbjct: 320 LAEVINTQIGAKKSWS-GQYTIDCDTRDALPDMTFNFNGYNFTVSPYDYTLEMSGSCISA 378

Query: 445 IIPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
           I P    +  G   I+GD+FL   Y +YDLDN  + +A++
Sbjct: 379 ITPMDFPEPVGPLAIIGDAFLRKYYSIYDLDNNAVGLAKS 418

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 21/27 (77%)

Query: 86  YSVELDVGSPPQNVTVLVDTGSSDLWI 112
           Y  ++ +G+P QN  V++DTGSS+LW+
Sbjct: 104 YYTDISLGTPKQNFKVILDTGSSNLWV 130

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 81.6 bits (200), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 124/279 (44%), Gaps = 30/279 (10%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F+I YG G+   G    D L++ DLN+    FA A          G     L + Y   +
Sbjct: 151 FAIRYGTGSL-EGYISQDTLNIGDLNIPKQDFAEATSEPGLTFAFGKFDGILGLAYDSIS 209

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEH---GTILFGAVDHSKYTGTLY 326
            ++   PF Y+     L     +    ++ YL D++ +    G I  G +D +K+ G + 
Sbjct: 210 VNKVVPPF-YNAIEQEL-----LDEKKFAFYLGDANKKSEDGGEITIGGIDKTKFKGDID 263

Query: 327 TIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETV 386
            +P+              ++V   GIG+     G++        A +D+GT+L  LP  +
Sbjct: 264 WLPV---------RRKAYWEVKFEGIGL-----GDQFAELENHGAAIDTGTSLIALPSGL 309

Query: 387 VALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGSTCLLGI 445
             +I  EIGA+  +  G Y ++C +  +   + F+F G +       + L    +C+  I
Sbjct: 310 AEIINTEIGAKKGWT-GQYTVECDARPNLPDLTFNFNGKNFTIGPYDYTLEVSGSCISAI 368

Query: 446 IPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
           +P    +  G   I+GD+FL   Y +YDL+N  + +A+A
Sbjct: 369 MPMDFPEPVGPMAIIGDAFLRKYYSIYDLENNAVGLAEA 407

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 22/27 (81%)

Query: 86  YSVELDVGSPPQNVTVLVDTGSSDLWI 112
           Y  ++ +G+PPQ+  V++DTGSS+LW+
Sbjct: 94  YFADITLGTPPQSFKVILDTGSSNLWV 120

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 75.9 bits (185), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 111/239 (46%), Gaps = 42/239 (17%)

Query: 278 KYDNFPIVLKNSGAIKTNAYSLYL----------NDSDAEHGTILFGAVDHSKYTGTL-- 325
           +Y  F  +LK++  I++ +YSL+L           D     G +L G VD S +TGTL  
Sbjct: 202 EYSYFLSLLKDANFIESPSYSLWLAGDTSTYKTYRDPILNCGKLLLGGVDPSLFTGTLGQ 261

Query: 326 -----YTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTK---IPALLDSGT 377
                Y  P+ N ++       I + +   G     S +GE    T+K    PALLDS +
Sbjct: 262 FDLIPYADPVTNAIT-------IGYPIVPLGPIYIVSNSGESLNMTSKDFLSPALLDSTS 314

Query: 378 TLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASL------ 430
           +++YLP + +  IA +I A Y   L  +++ C  +D    + F      I   L      
Sbjct: 315 SVSYLPTSTIIQIAVQIAATYVESLDRWLVQCSMADMGVTLAFRLRDLFIEIPLRDLLSS 374

Query: 431 -------SSFILSTGS-TCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQ 481
                  SS + S+G   C L +   ++    ILG++F+ N Y+  DL++  I++AQA+
Sbjct: 375 TYDTSTNSSMLFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQAK 433

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 75.1 bits (183), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 118/278 (42%), Gaps = 29/278 (10%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F I YG G+   G    D L + DL +    FA A          G     L + Y   +
Sbjct: 143 FVIQYGSGSL-KGYISQDTLTIGDLIIPQQDFAEATAEPGLAFAFGKFDGILGLAYDSIS 201

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEH--GTILFGAVDHSKYTGTLYT 327
            ++   P  Y+       + G +    ++ YL D  +    G   FG  D S++ G +  
Sbjct: 202 VNKAVPPL-YNAI-----HRGLLDKPMFAFYLGDEKSSKNGGEATFGGYDPSRFEGEIKW 255

Query: 328 IPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVV 387
           +P+              ++V  +GI     K G+K +      A +D+GT+L  LP  + 
Sbjct: 256 LPV---------RRKAYWEVQFDGI-----KLGDKFMKLEGHGAAIDTGTSLITLPSQIA 301

Query: 388 ALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGSTCLLGII 446
             + +EIGA+ S+  G Y +DC   +S  ++  +F   +       + L    +C+  I 
Sbjct: 302 DFLNNEIGAKKSWN-GQYTIDCKKRESLPKLTLNFYNHNFTIDPFDYTLEISGSCISAIT 360

Query: 447 PTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
           P       G  +I+GD+FL   Y +YDL+N  + +A++
Sbjct: 361 PMDFPQPVGPLSIIGDAFLRRFYSIYDLENNAVGLAKS 398

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 63  PEAHLFKR----ADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWI 112
           PE H+ K+     + ++  +     + Y  ++ +G+PPQ   V++DTGSS+LW+
Sbjct: 59  PEVHISKKDQFTIESHDVPLDNYLNAQYYTDVSIGTPPQKFKVILDTGSSNLWV 112

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 110/231 (47%), Gaps = 39/231 (16%)

Query: 286 LKNSGAIKTNAYSLYL-------------NDSDAEHGTILFGAVDHSKYTGTLYT---IP 329
           L N G IKT +YSL+              + + A+ G ++ GAVD S YTG L +   IP
Sbjct: 199 LMNLGIIKTPSYSLWFGADTVPYDRRKLASGTMADCGKLILGAVDPSLYTGILRSFKMIP 258

Query: 330 IVNTLS-ASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKI--PALLDSGTTLTYLPETV 386
            ++ +S A   + PI   + +  I ++ +      +T+ +   P LLDS  + TYLP   
Sbjct: 259 FIDPVSQAQSNNYPI---LPLGTIYINSANGKSLNMTSEEFVEPVLLDSRYSTTYLPIDA 315

Query: 387 VALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILST-------- 437
           +  IA +IGA +   L  +++ C  +     + F FG   I   L  F+++T        
Sbjct: 316 IVQIAVQIGATFVESLDKWLVACSVAKLDVSLDFTFGNIEIRVPLEDFLVTTYDPKSNTS 375

Query: 438 ------GSTCLLGIIPTSDNTG-TILGDSFLTNAYVVYDLDNLEISMAQAQ 481
                    C L ++ + D TG  +LG  FL N Y+  D+++  I++AQA+
Sbjct: 376 LHFSTGEEACFLAMV-SKDKTGYNVLGGPFLKNLYMAVDIEDSSIAIAQAK 425

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 126/293 (43%), Gaps = 53/293 (18%)

Query: 234 LNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRG----RRPFKYDNFPI-VLKN 288
           L ++  SF   N+T S+ GVLG+G         G    +G       F    F +  L++
Sbjct: 289 LTLSNSSFFEINDTTSSKGVLGLG---------GKINDKGTDIDSSQFDSSFFLLESLRD 339

Query: 289 SGAIKTNAYSLYLNDSDAEH-------------GTILFGAVDHSKYTGTL-------YTI 328
           +G I++ +YSL+L      +             G ++ G VD   Y+G L       +  
Sbjct: 340 NGIIESLSYSLWLGGDTRPYYDVGRNVPDEINCGKLILGGVDPYYYSGPLKKFNNLIFLD 399

Query: 329 PIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVA 388
              + LS      P++    ++  G S +   E  LT    P LLDS  + ++LP   + 
Sbjct: 400 SRTDMLSRGYPVLPMRTINVVSATGNSINVTNENFLT----PVLLDSRYSFSHLPAETIV 455

Query: 389 LIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILSTGS-------- 439
            IA ++ A Y   +  +V+ C  +D    I F+FG   I+     F++ST +        
Sbjct: 456 QIAVQVNAIYMKEVDMFVVSCKIADMGVNIQFEFGDVSIDVPFKDFLMSTHNPETNSTMK 515

Query: 440 ------TCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTT 486
                  C + ++ + +    ILG SFL N Y+  D D+  I++AQA+   TT
Sbjct: 516 FSGGDEACFMTMVSSEETGFNILGTSFLRNVYLAVDHDDQSIAIAQARRKYTT 568

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 135/300 (45%), Gaps = 49/300 (16%)

Query: 282 FPIVLKNSGAIKTNAYSLYL----------NDSDAEHGTILFGAVDHSKYTGTL------ 325
           F  +LK++  I++++YSL+L           D  +  G +L G VD S +TGTL      
Sbjct: 216 FLSLLKDADIIESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGTLGKFDLI 275

Query: 326 -YTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPE 384
            Y  P+ N +S      P+     ++  G S +   +  L+    PALLDS ++++YLP 
Sbjct: 276 PYVDPVSNAVSVGYPIVPLGPIYIVSNSGQSLNMTSKDFLS----PALLDSTSSVSYLPT 331

Query: 385 TVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASL------------- 430
           + +  IA +I A Y   L  +++ C  +D    + F      I   L             
Sbjct: 332 STIIQIAVQIAATYVESLDRWLVQCSIADMGVSLGFRLRELTIEIPLRDLLSSTYDTSTN 391

Query: 431 SSFILSTGS-TCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQY----NTT 485
           SS   S+G   C L +   ++    ILG++F+ N Y+  DL++  I++AQA+       T
Sbjct: 392 SSMFFSSGQEACFLTLYANTNTGVNILGEAFIKNIYMAMDLEDNTIAIAQAKKVEDDAVT 451

Query: 486 TENIEVISSSIPSAVKAP--GYTNTWSTSATI-------VTGGNIFTVDSSQTASFSGNV 536
            E  E  +S+I   +K+    Y    ++S T           G +FTV    TA++S  V
Sbjct: 452 EETNETTASTIIKKIKSGYIPYAKVMNSSNTRNLTLYPSYRSGYMFTVPGQLTAAYSNGV 511

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/301 (27%), Positives = 135/301 (44%), Gaps = 51/301 (16%)

Query: 282 FPIVLKNSGAIKTNAYSLYL----------NDSDAEHGTILFGAVDHSKYTGTL------ 325
           F  +L ++  I+  +YSL+L           +S  + G +L G VD S +TGTL      
Sbjct: 217 FLSLLTDASFIECPSYSLWLAGDTSTYQSYKESIPDCGKLLLGGVDPSLFTGTLGKFDLI 276

Query: 326 -YTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPE 384
            Y  P+ N +S      P+     I+  G S +   +  L+    PALLDS ++++YLP 
Sbjct: 277 PYVDPVSNVVSTGYPIVPLGPIYIISNSGQSMNMTSKDFLS----PALLDSTSSVSYLPT 332

Query: 385 TVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILSTGST--- 440
           + +  IA +I A Y   L  ++++C  +D    + F F    I   LS  + ST  T   
Sbjct: 333 STIIQIAVQIAATYVESLDRWLVECSMADMGVTLGFMFRSLTIKIPLSDLLSSTYDTTTN 392

Query: 441 -----------CLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA--------- 480
                      C L +   ++    ILG++F+ N Y+  DL++  I++AQA         
Sbjct: 393 SSMFFSSGQEACFLTLYANTNTGVNILGEAFMKNIYMAVDLEDNSIAIAQAKNIEDGAIT 452

Query: 481 ----QYNTTTENIEVISSSIPSAVKAPGYTNTWS-TSATIVTGGNIFTVDSSQTASFSGN 535
               + N+ +   ++ S  IP A K    TNT + T       G +FTV    TA++S  
Sbjct: 453 DEANETNSVSAVKKIKSGYIPYA-KTMNSTNTRNMTLYPSYKSGYMFTVPGQLTAAYSDG 511

Query: 536 V 536
           V
Sbjct: 512 V 512

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 97/197 (49%), Gaps = 30/197 (15%)

Query: 309 GTILFGAVDHSKYTGTLY---TIPIVNTLS---ASGFSSPIQFDVTINGIGVSDSKNGE- 361
           G ++FGAVD S YTG      TIP  N  +   + G+  PI   + +  + V  SK+GE 
Sbjct: 241 GKVIFGAVDTSLYTGDFVKFDTIPFHNARTGETSRGY--PI---IPLTKVNV-QSKSGET 294

Query: 362 KTLTTTKI--PALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDD-STQIV 418
           K +T+     P L+DS     YLP  ++  IA +  A Y   L  ++L C        I+
Sbjct: 295 KNMTSDSFLEPVLIDSRFRYNYLPLEIIVQIAMQANAYYVESLNRWLLACDVGRLGASII 354

Query: 419 FDFGGFHINASLSSFILST--------------GSTCLLGIIPTSDNTGTILGDSFLTNA 464
           F+FG   IN  L++ +  T                 C L ++P++ +   +LG +F+ N 
Sbjct: 355 FEFGNLSINVPLNNLMGPTFDSDTNGTLHFSNKQQACELKLLPSTASGFNVLGGAFIKNV 414

Query: 465 YVVYDLDNLEISMAQAQ 481
           Y+  +L++ ++++AQAQ
Sbjct: 415 YMAAELESNQVALAQAQ 431

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 111/241 (46%), Gaps = 33/241 (13%)

Query: 292 IKTNAYSLYLNDSDAEH-GTILFGAVDHSKYTGTLY---TIPIVNT---LSASGFSSPIQ 344
           I++ AYS  L+    E+ G ++FG VD S YTG L    T+P  N    +++ G+  PI 
Sbjct: 223 IESYAYSSALDSVAVENCGILIFGGVDRSLYTGDLVKIDTLPYYNVRTGVTSRGY--PI- 279

Query: 345 FDVTINGIGVSDSKNGEKTLTTTKI--PALLDSGTTLTYLPETVVALIADEIGAQYSYRL 402
             V +  + V       K LT+     P LLD+     YLP  ++  IA +  A Y   L
Sbjct: 280 --VPLVKVDVKSKSGQVKNLTSEYFLEPVLLDTRYRYNYLPLDLIVKIATQANAYYVESL 337

Query: 403 GYYVLDCPSDD-STQIVFDFGGFHINASLSSFILST--------------GSTCLLGIIP 447
             ++L C        I+FDFG   I+  LS  +  T                 C L  +P
Sbjct: 338 NRWLLACDVGKLGASILFDFGEVVIDVPLSDLMGPTYDSTTNGTLYFSNADQACELRFLP 397

Query: 448 TSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTN 507
            SD   +ILG  F+ N Y+  +L + ++++AQA Y   T   E +SS++  ++    Y N
Sbjct: 398 NSDLGFSILGGPFIKNVYLAAELQSNQVALAQA-YKWPT---ETVSSNLGGSISVSTYAN 453

Query: 508 T 508
           +
Sbjct: 454 S 454

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 66.6 bits (161), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F  +YGDGT+  GT+GTDV+ L ++ +   SF VAN T +  G+LGI LP  E T+S   
Sbjct: 51  FDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTHSLGG 110

Query: 270 ASRGRRPFKYDNFP 283
           A     PF+Y+NFP
Sbjct: 111 AYN-TTPFEYENFP 123

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/278 (23%), Positives = 112/278 (40%), Gaps = 28/278 (10%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           FS+SYG G+   G    D L + DL +    FA A     +  V G     L + Y G  
Sbjct: 158 FSVSYGKGSM-EGFVSYDTLKIGDLTIKNQGFAEATVEPGSAFVYGQFDGILGLAYDGLA 216

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDS---DAEHGTILFGAVDHSKYTGTLY 326
            +    PF Y+       + G +    ++ YL+D    D+  G ++FG  D +K+TG + 
Sbjct: 217 VNHIVPPF-YEAV-----HQGLLDEPVFAFYLSDEKKGDSLAGEVVFGGYDETKFTGEIS 270

Query: 327 TIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETV 386
            +P++             ++V +N I +     G +          LD+GT+    P  +
Sbjct: 271 WLPVIRK---------AYWEVELNSITL-----GSQKFQLQNYGGALDTGTSFITFPSEL 316

Query: 387 VALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFDFGGFHINASLSSFILS-TGSTCLLGI 445
                 + GA      G+ +  C       + F+  G     S S +++    +TC + I
Sbjct: 317 YQEFVSKTGATVDPDDGHIIAPCSGSGFPDLTFELAGRSFTISSSDYVVQWDDTTCAVAI 376

Query: 446 IPT---SDNTGTILGDSFLTNAYVVYDLDNLEISMAQA 480
            P          I+GD FL   Y +YDL    + +A++
Sbjct: 377 TPLDLGGAGKMVIIGDVFLRRWYSIYDLSKNAVGLAKS 414

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 6/58 (10%)

Query: 78  IITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDK 135
            + NQ   Y  E+ +G+PPQ+  V++DTGSS+LW+   N   C S+   N  R   D+
Sbjct: 96  FVNNQ---YYSEIGLGTPPQSFKVVMDTGSSNLWVPNKN---CVSEACLNHARFDHDR 147

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 103/236 (43%), Gaps = 40/236 (16%)

Query: 282 FPIVLKNSGAIKTNAYSLYL-------------NDSDAEH-GTILFGAVDHSKYTGTLYT 327
           F   L NS  I T +YSL+L             N +  ++ G ++ GAVD   Y G L  
Sbjct: 208 FLTYLSNSEVIDTPSYSLWLGGDTLPYTNMTSINSTTIDYCGNLVLGAVDQRYYEGRLVQ 267

Query: 328 IPIV-----NTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKI--PALLDSGTTLT 380
             ++     N   A  +  PI   + +  I + +S   +  LTTT    P LLDS  T  
Sbjct: 268 FDMLPALLNNVTEAVTYGLPI---IPMGPIYIENSSGTQLNLTTTNFLEPVLLDSRYTNA 324

Query: 381 YLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFI----- 434
            LP   V  IA ++ A Y    G ++++C  ++ +  + F+F G  I  SL+ F+     
Sbjct: 325 RLPLNTVIQIATQLNAAYVEEFGSWIVECSLAEMNVNLNFNFQGLTIPVSLNDFLSRVIN 384

Query: 435 ----------LSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA 480
                      S+   C L + P +D    ILG  FL N Y+  D +   +++A+A
Sbjct: 385 STTGEPIKFSESSEDACALAVYPNTDIGFNILGGPFLKNIYLAIDNEGRSVAIAKA 440

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 69.7 bits (169), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 118/282 (41%), Gaps = 33/282 (11%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST 269
           F+I YG G+   G    D L + DL +    FA A          G     L + Y+  +
Sbjct: 148 FAIQYGSGSL-EGYISQDTLSVGDLVIPKQDFAEATSEPGLAFAFGKFDGILGLAYNTIS 206

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEH------GTILFGAVDHSKYTG 323
             +   PF Y+       +   +    ++ YL DS          G   FG +D SK+ G
Sbjct: 207 VDKVVPPF-YNAI-----DQDLLDEPRFAFYLGDSSDSEDSSVSGGVATFGGIDKSKFKG 260

Query: 324 TLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLP 383
            +  +P+              ++V   GIG+     G++        A +D+GT+L  LP
Sbjct: 261 EISWLPVRRK---------AYWEVKFEGIGL-----GDEFAILDGHGAAIDTGTSLITLP 306

Query: 384 ETVVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGSTCL 442
             +  +I  EIGA+  +  G Y +DC +  S   + F+F G +       + L    +C+
Sbjct: 307 SGLAEIINSEIGAKKGWS-GQYTVDCETRSSLPDLTFNFSGKNYTIGPYDYTLEVSGSCI 365

Query: 443 LGIIPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
             I P    +  G   I+GD+FL   Y VYDL N  + +A+A
Sbjct: 366 SAITPMDFPEPVGPLAIVGDTFLRRFYSVYDLGNNAVGLAKA 407

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%)

Query: 66  HLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWI 112
           H F   D ++  +     + Y  ++ +G+P QN  V++DTGSS+LW+
Sbjct: 71  HPFFAEDNHDVPLTNYLNAQYYTDISLGTPAQNFKVILDTGSSNLWV 117

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 121/278 (43%), Gaps = 35/278 (12%)

Query: 234 LNVTGLSFAVANETNS-TMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAI 292
           L V+ +SF  A++T    MG LG+     ++T +G+          YD F   L  +  I
Sbjct: 161 LGVSNVSFINADDTVPYAMGSLGL---SGKITGTGTDIDSSNFDNSYD-FLDRLYQTNLI 216

Query: 293 KTNAYSLYL------------NDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFS 340
            +++YSL+L            N   +  G ++ GAVD + +TG+     ++  L +   +
Sbjct: 217 DSHSYSLWLAMNQTYNGTRVQNSVTSSFGKLILGAVDPTLFTGSFLQFEMLPALESDSAT 276

Query: 341 SPIQFDVTINGIGVSDSKNGEKTLTTTK---IPALLDSGTTLTYLPETVVALIADEIGAQ 397
             I + +   G     SK+GE    T+K    P  LDS  T TYLP  ++  +A +IGA 
Sbjct: 277 ETIGYPIIPMGPIYVVSKSGEMANVTSKDFLEPVFLDSTYTSTYLPLNMIIQVAIQIGAM 336

Query: 398 YSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFI-------------LSTG-STCL 442
           Y   L  +++ C  ++    + F F    I   L+  +              STG   C 
Sbjct: 337 YVESLERWLVPCNIANQHATLDFTFQDVSIRVPLTDLLGTTYDSSTNTSMHFSTGDEACY 396

Query: 443 LGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQA 480
           L I         ILG  FL + Y+  DLD   I++AQA
Sbjct: 397 LKIFSNQMTGYNILGRPFLKHVYMAVDLDGNNIAIAQA 434

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 107/244 (43%), Gaps = 49/244 (20%)

Query: 276 PFKYDNFPIVLKNSGAIKTNAYSLYL--------------NDSDAEHGTILFGAVDHSKY 321
           PF   N    L NSG I+T +YS++                +  +++G I+FG VD S  
Sbjct: 222 PFSLLN---ALLNSGVIQTASYSMWFANGSSYIDTKHFPYEEKKSDYGLIVFGGVDSSLI 278

Query: 322 TGTLYT---IPIVNT---LSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKI----PA 371
            GT  +   IP  +T   L+ SG+  PI     I  I      N  +TL  T +    P 
Sbjct: 279 DGTFQSFTMIPYEDTSDGLTTSGY--PILPMGPIYIIA-----NSGRTLNLTTLDFLEPV 331

Query: 372 LLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASL 430
           LLDS  T + LP + +  +A ++ A Y   L  +V+ C  +D +    F FG   I   L
Sbjct: 332 LLDSRITNSRLPASFIIQVAIQLEAMYLESLDRWVVPCSLADYNVNFDFSFGSVRIRVPL 391

Query: 431 SSFILSTGST--------------CLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEIS 476
             F++ +G T              C L + P +D    ILG  FL NA +  D  + +I+
Sbjct: 392 EDFLVPSGLTGDNKTIHFSQNEDACYLAMYPNTDIGFNILGTPFLKNAVIAVDHSSSQIA 451

Query: 477 MAQA 480
           + +A
Sbjct: 452 IGKA 455

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 142/305 (46%), Gaps = 53/305 (17%)

Query: 220 ASGTFGTDVLDLS--------DLNVTGLSFAVANETN-STMGVLGIGLPELEVTYSGSTA 270
           +SGT  T++L            L+++ +SF     +N  T G+LG+     ++T  GS A
Sbjct: 149 SSGTLVTELLKTRGNVQFNSGSLSISNVSFFSVESSNFKTSGLLGL---SGKITNPGSAA 205

Query: 271 SRGRRPFKYDNFPIVLKNSGAIKTNAYSLYL----------NDSDAEHGTILFGAVDHSK 320
                  +   F  +LK+   I++ +YSL+L           D     G +L G VD S 
Sbjct: 206 DSSHYT-EQSYFLSLLKDVNLIESPSYSLWLAGDTSTYQTHRDPIYNCGKLLLGGVDPSL 264

Query: 321 YTGTLYT---IPIVNTLSAS---GFSSPIQFDVTINGIGVSDSKNGEKTLTTTK---IPA 371
           +TGTL     IP V+ +S++   G+  PI   V +  I +  S +G+    T+K    PA
Sbjct: 265 FTGTLGKFDLIPYVDPVSSAVSTGY--PI---VPLGPIYIV-SNSGQSLNMTSKDFLSPA 318

Query: 372 LLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASL 430
           LLDS ++++YLP   +  IA +I A Y   L  +++ C  ++    + F      I   L
Sbjct: 319 LLDSTSSVSYLPTNTIIQIAVQIAATYVESLDRWLVQCSMANMGVSLGFTLRELVIEIPL 378

Query: 431 -------------SSFILSTGS-TCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEIS 476
                        SS   S+G   C L +   ++    ILG++F+ N Y+  DL++  I+
Sbjct: 379 RDLLSSTYDTSTNSSMFFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIA 438

Query: 477 MAQAQ 481
           +AQA+
Sbjct: 439 IAQAK 443

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 127/279 (45%), Gaps = 35/279 (12%)

Query: 252 GVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDA----- 306
           GVLG+G     +T S    + G     Y  F    K +   ++N+YSL+L + ++     
Sbjct: 208 GVLGLGG---SITSSNEYENSGNYDSSYFIFN-KFKEANITQSNSYSLWLVEDESSLTTT 263

Query: 307 -----EHGT---ILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSK 358
                E GT   +L G +D + Y G+LY   ++  +      S   + +   G+    S+
Sbjct: 264 STKFEEEGTFGKLLLGVIDPALYRGSLYQFDMIPYVDPESLVSSQGYPILPMGVIYVKSE 323

Query: 359 NGEKTLTTTK---IPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDS 414
           +G +   T+K    P LLDS     YLPE  +  IA +IGA Y   +  +++ C  +   
Sbjct: 324 SGARLNVTSKDFLEPVLLDSSQQGNYLPENAIIQIAIQIGATYIESMDRWLVSCDMASYG 383

Query: 415 TQIVFDFGGFHINASLSSFILSTGST--------------CLLGIIPTSDNTGTILGDSF 460
             ++F F G  I+  L + + +T  T              C L I   ++    +LG +F
Sbjct: 384 ASVLFTFDGLEIDVPLENLLTNTFETGSNSSIYYSDGETACALTIYDNANMGYNLLGSAF 443

Query: 461 LTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSA 499
             N Y+  DL+   +++AQA+ +   ++  + ++++P+A
Sbjct: 444 FRNTYIAVDLEGNTVAIAQAKPSDEDDSSNLSATTLPAA 482

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%)

Query: 81  NQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSS 140
           N Q  Y V   VG P Q  ++++DT    LW++  N     +DT +      +   ++SS
Sbjct: 69  NLQGRYYVNASVGEPQQEQSLVLDTTEPYLWVISGNVEMNCTDTNNVCNANSLYYYNESS 128

Query: 141 SSGAL 145
           S+ A+
Sbjct: 129 SAVAI 133

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 111/239 (46%), Gaps = 32/239 (13%)

Query: 286 LKNSGAIKTNAYSLYLNDS---------DAEHGTI----LFGAVDHSKYTGTLYTIPIVN 332
           + N   IK+ +YSL+L +          DA++G++    + GAVD S Y G  +    ++
Sbjct: 208 MANLNLIKSKSYSLWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSLYEGEFFQFNTIS 267

Query: 333 TLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKI---PALLDSGTTLTYLPETVVAL 389
            +  S   S   + +   G     S+ G +   T++    PALLDS    ++LP   +  
Sbjct: 268 YIEPSHNLSTFGYPILPMGPIYMTSQAGRRLNMTSEQYLQPALLDSSFVGSFLPANTIIQ 327

Query: 390 IADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDFGGFHINASLSSFILSTG---------- 438
           IA +IGA Y   L  +V+ C  +     I F F G  I   LS  + S+           
Sbjct: 328 IAIQIGAIYIESLNRWVVPCSVASMGAHIDFTFDGLDIKVPLSDLLTSSKDPATNSTMHF 387

Query: 439 ----STCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVIS 493
               S C L +   +     +LG SF+ NAY+  DLD  ++++AQA+ NTT ++  +++
Sbjct: 388 AEGESACFLMLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAIAQAK-NTTGDSTSIVT 445

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 66.6 bits (161), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 108/452 (23%), Positives = 175/452 (38%), Gaps = 84/452 (18%)

Query: 86  YSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGAL 145
           Y V + +GSPPQ   + +DT    +W++   +                DK+ +   SG L
Sbjct: 51  YYVNVTIGSPPQQEMLRIDTSQPFVWVLSGAD----------------DKQCNRLDSGCL 94

Query: 146 VNDINPFGWLTGTGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGXXXXXXXXXXXX 205
                       +G    P  + +G   E+AT S   S   +D                 
Sbjct: 95  ------------SGNRFYPEESTTG---ESATNSTIYSLNFLDTFRVNGSIVVDNLNFTN 139

Query: 206 XXXYFSISYGDGTFASGTFGTDVLDLSD--LNVTGLSFAVANETNST-MGVLGIGLPELE 262
                ++ Y   TF S      ++D+ D  L +    F  A ++  T MG LG+      
Sbjct: 140 TDITAALDYT--TFNSSK-NNSIIDIGDDFLVIKNFGFINAEDSYPTDMGSLGLS-STFN 195

Query: 263 VTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLN---------------DSDAE 307
            T + S +      F       +L  SG I + +YSL+L                D    
Sbjct: 196 ETLNYSPSGNFNTSFS---MLAMLAESGLIDSQSYSLWLGNGAERDTQLSSQRTPDPQYN 252

Query: 308 HGTILFGAVDHSKYTGTLY---TIPIVN-TLSASGFSSPIQFDVTINGIGVSDSKNGEKT 363
           +G +L G+VD S +    Y    +P V+       FS P+   + +N I +  SK G  T
Sbjct: 253 NGKLLLGSVDPSLFKEPFYQFDVLPYVDPNTQIESFSFPV---IPMNAIYIV-SKTGTGT 308

Query: 364 LTTTK---IPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVF 419
             T++    P LL+S     YLP   +  IA ++GA Y   L  ++L C  ++++    F
Sbjct: 309 NVTSEDFLEPVLLNSNFRSNYLPLNSIIQIAIQVGATYVESLDRWLLPCSIANENVHFEF 368

Query: 420 DFGGFHINASLSSFILST--------------GSTCLLGIIPTSDNTGTILGDSFLTNAY 465
            F   +I A L  F+ ST                 C L + P +      LG  FL + Y
Sbjct: 369 TFDKLNIKAPLIDFLESTFDSTTNTSMHFSDNSEACFLKLYPNTYVGFNALGRPFLKSVY 428

Query: 466 VVYDLDNLEISMAQA--QYNTTTENIEVISSS 495
           +  + +   + MAQA  + N+T  N +V+ ++
Sbjct: 429 LAVEQEGRIVGMAQAVQEMNSTFLNADVVPAT 460

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/323 (22%), Positives = 126/323 (39%), Gaps = 46/323 (14%)

Query: 175 TATQSVPASEA-TMDCKEYGXXXXXXXXXXXXXXXYFSISYGDGTFASGTFGTDVLDLSD 233
           ++T  VP  E   M C+ +                   ++YG G+   G    D   +SD
Sbjct: 114 SSTLWVPGKECRAMACRLHKRYDHDRSSTYKENGTLTGVTYGSGSIM-GYVSEDTFRISD 172

Query: 234 LNVTGLSF-AVANETNSTM------GVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVL 286
           L + G  F    +E  S        G+LG+  P L     G T      PF+       L
Sbjct: 173 LEIPGQQFTETTDEPGSVFVFAAFDGILGLAYPSLGY---GVTP-----PFQQ------L 218

Query: 287 KNSGAIKTNAYSLYLND--SDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQ 344
                +K   + +YL+D  +   +G ++ G  D +K+ G +  +P+              
Sbjct: 219 MEKKLVKEPVFGMYLDDMKTGEGNGQLVLGGYDETKFKGEIAWLPV---------RRQAY 269

Query: 345 FDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGY 404
           ++V  + + V     G+  +      A +DSGT+L   P  +      ++      R G 
Sbjct: 270 WEVVFDSVTV-----GDDNIPLENYGAAIDSGTSLITFPSELFNQFISKLSGVTKDRQGN 324

Query: 405 YVLDCPSDDSTQ-IVFDFGGFHINASLSSFILST---GSTCLLGIIPTS-DNTG--TILG 457
             +DC +  +   + F FGG   + S   +I+S     + C+  I+    D+ G   I+G
Sbjct: 325 VYVDCANKQTAPPLTFGFGGHKFSISGEDYIISVPGQSARCMPAIVQLDIDSAGKVAIIG 384

Query: 458 DSFLTNAYVVYDLDNLEISMAQA 480
           D FL   Y +YD  N  + +A A
Sbjct: 385 DVFLRRYYSIYDFGNNAVGLATA 407

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 10/101 (9%)

Query: 64  EAHLF-KRADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSS 122
           E +LF K  DG+   +     + Y+ ++ +G+PPQ+  V+VDTGSS LW+ G        
Sbjct: 70  EYNLFAKNNDGHVSELANLANNIYAADVTIGTPPQDFRVVVDTGSSTLWVPG-------K 122

Query: 123 DTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIG 163
           + R+ + R  + KR D   S     +    G   G+G ++G
Sbjct: 123 ECRAMACR--LHKRYDHDRSSTYKENGTLTGVTYGSGSIMG 161

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 94/336 (27%), Positives = 144/336 (42%), Gaps = 60/336 (17%)

Query: 210 FSISYGDGTFASGTFGTDVLDL----SDLNVTG----------------LSFAVANETNS 249
           +SI++ DG   +GT   DV+ L    S LNV+G                LSF  A+ ++ 
Sbjct: 112 YSINFIDGISLNGTRYMDVMRLMNVSSSLNVSGVDSGVSFRNHTLTVQNLSFFNADYSSG 171

Query: 250 TM-GVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYL------- 301
            + G LG+G      T +  T   G        F   LK +  I +++YSL+L       
Sbjct: 172 YLYGSLGLG-----GTLNSDTELEGDFINHSFFFLDALKEARLINSSSYSLWLGSQKRNG 226

Query: 302 --NDSDA-EHGTILFGAVDHSKYTGTLY---TIPIVNTLSAS-GFSSPIQFDVTINGIGV 354
             + SDA E G ++FGAVD +   G       IP ++  +    +  P+   V +  I +
Sbjct: 227 FADTSDANEAGYLIFGAVDPNLVEGEFRKFDMIPYIHPQTGKVAYGYPV---VPMGPIYI 283

Query: 355 SDSKNGEKTLTTTKI--PALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSD 412
           + S      +TT     P LLD    L+YLP   +  IA +I A Y   L  +++ C   
Sbjct: 284 TSSSGRSLNVTTDGFSAPVLLDPSFALSYLPTKAIIQIAIQIAAVYVESLDLWLVSCDVA 343

Query: 413 DSTQIV-FDFGGFHINASLSSFILSTG--------------STCLLGIIPTSDNTGTILG 457
            S   V F FG   I   LS  + ST                 C+L + P +     +LG
Sbjct: 344 SSGATVDFSFGDLTIKVPLSDLLASTHDQSTNTTLHFNTGQEACVLQLYPNTFTGYNVLG 403

Query: 458 DSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVIS 493
            +F+ NAY+  DL+   ++M QA    + E  E+I+
Sbjct: 404 QAFMKNAYLAVDLEGKGVAMGQAANFKSGERKEIIT 439

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 82/288 (28%), Positives = 123/288 (42%), Gaps = 41/288 (14%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGV-LGIGLPE--LEVTYS 266
            SISYG G+   G    D L + DL +    F    ET S  G+    G  +  L + Y 
Sbjct: 148 LSISYGSGSI-EGYISEDNLQIGDLTIQNQKFG---ETTSEPGLAFAFGKFDGILGLAYD 203

Query: 267 GSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYL---NDSDAEHGT------ILFGAVD 317
                    PF    +  + ++   +  + +S YL   ND  AE G+         G VD
Sbjct: 204 TIAQDDITPPF----YSAIQQH--LLDESKFSFYLKSVNDPAAEGGSASDGGVFTLGGVD 257

Query: 318 HSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGT 377
            SK+ G L  IP+     A        ++V +N I + D   G+   T     A +D+GT
Sbjct: 258 SSKFKGDL--IPLHVRRQA-------YWEVPLNAIKLGDQSTGKLENTG----AAIDTGT 304

Query: 378 TLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILS 436
           +L  LP  +  +I  +IGA+  +  G Y L+C +      + F   G     S   + L 
Sbjct: 305 SLITLPSDMAEIINAQIGAKKGWT-GQYTLECSTRAKLPDLTFTLDGHDFVLSPFEYTLE 363

Query: 437 TGSTCLLGIIPTS--DNTG--TILGDSFLTNAYVVYDLDNLEISMAQA 480
              +C+  I P    +  G   ILGD+FL   Y V+DLD   +S+A+A
Sbjct: 364 VSGSCISVITPMDFPEPIGRMAILGDAFLRRYYSVFDLDANVVSLAEA 411

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 11/102 (10%)

Query: 63  PEAHLFKRADGYEEIIITN-QQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCS 121
           P  HLF   D    + ++N   + Y  ++ +G+PPQ   V++DTGSS+LW+         
Sbjct: 68  PRDHLF-YPDQVHNVPLSNYMDAQYFADISLGTPPQKFKVILDTGSSNLWV--------- 117

Query: 122 SDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTGGLIG 163
                 S    +  + D S S   + D  P     G+G + G
Sbjct: 118 PSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIEG 159

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 78/282 (27%), Positives = 124/282 (43%), Gaps = 51/282 (18%)

Query: 229 LDLSDLNVTGLSFAVANETNS-TMGVLGIG----LPELEVTYSGSTASRGRRPFKYDNFP 283
           LD   L++T +SF   + + S T G LG+G     P  ++   G   S          F 
Sbjct: 157 LDSDTLSMTNVSFINVDYSGSITQGALGLGGRITAPGEDINSDGFDGSFF--------FL 208

Query: 284 IVLKNSGAIKTNAYSLYL------NDSDAEH------GTILFGAVDHSKYTGTLY---TI 328
             L  +  I +++YSL+L       D + E+      G ++ GAVD S YTG      TI
Sbjct: 209 EQLVANNVIDSSSYSLWLGQDVGQEDDEDEYYTEENCGKLVLGAVDPSLYTGDFVRFDTI 268

Query: 329 PI--VNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKI--PALLDSGTTLTYLPE 384
           P   V+T  A+ F  PI   V +  + V  S      +T+     P LLD+    ++LP 
Sbjct: 269 PFHDVDT-GATSFGYPI---VPLTKVSVKASSGQTLNVTSPDFAEPVLLDTRYLYSFLPL 324

Query: 385 TVVALIADEIGAQYSYRLGYYVLDCPSDD-STQIVFDFGGFHINASLSSFI--------- 434
            ++  IA +  A Y   L  +++ C   D +  ++F+F G  I+  +  F+         
Sbjct: 325 KLIIQIAIQTNAYYVESLDRWLVSCSVGDLNASMIFEFNGLSIDVPIKDFLSNSYDSVSN 384

Query: 435 ----LSTG-STCLLGIIPTSDNTGTILGDSFLTNAYVVYDLD 471
                S G S C L + P      ++LG +F+ NAY+  DL+
Sbjct: 385 STLHFSNGNSACYLKMYPNYATGFSVLGAAFVKNAYIAADLE 426

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 109/237 (45%), Gaps = 39/237 (16%)

Query: 252 GVLGIGLPELEVTYSGSTASRGRRPFKYDNFPI-VLKNSGAIKTNAYSLYLNDSDAEH-- 308
           G++GIG P +           G +P      PI  L +SG +K   + +Y++++   +  
Sbjct: 187 GIIGIGYPSI---------GYGIKP------PINTLIDSGGLKDPMFGIYISNAQNRNSP 231

Query: 309 -GTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTT 367
            G I+ G  +  K+ G +  +P+   L  + + + +           S  K G   L   
Sbjct: 232 VGEIVLGGYNTQKFKGDIKWLPV---LRKAFWETDL-----------SAFKVGNFALDVQ 277

Query: 368 KIPALLDSGTTLTYLPE-TVVALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFH 425
            + A+ D+G++   +PE T    ++   GA  S+  G   +DC + +S   +  DFGG  
Sbjct: 278 GLTAVFDTGSSFIIMPEDTYTDFVSQFPGA--SHDDGTDYVDCSTVNSGPDLTLDFGGVA 335

Query: 426 INASLSSFILSTG-STCLLGIIPTSDNTG-TILGDSFLTNAYVVYDLDNLEISMAQA 480
           +  S   +++  G +TC+L +   S  TG  ILGD+FL   Y +Y+  +  I +A A
Sbjct: 336 LKLSARDYVMQLGRNTCILAVSGNSRVTGEVILGDTFLRRYYTIYNFGDNTIGVASA 392

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 5/55 (9%)

Query: 79  ITNQQSF-YSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSD-TRSNSRRR 131
           + N ++F YSV++ +G+P QN  V +DTGSS LWI       C+S   R+ +R R
Sbjct: 75  VYNFENFQYSVDITLGTPAQNFRVALDTGSSLLWIPSDR---CTSQICRTRNRYR 126

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 104/242 (42%), Gaps = 38/242 (15%)

Query: 270 ASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDA----------EHGTILFGAVDHS 319
           A+RG   F  D     ++++G I + +YSL+  + +           + GT++ GAVD  
Sbjct: 184 AARGSEFFFLDK----MRDAGLISSRSYSLWFGNDNTSAVDLPTVLEDIGTLMLGAVDPR 239

Query: 320 KYTGTLYT---IPIVNTLSASGFSS--PIQFDVTINGIGVSDSKNGEKTLT--TTKIPAL 372
            Y G  Y    +P V+  S        PI   V +  + +  ++  +  LT  T   P L
Sbjct: 240 LYYGNFYQYDGVPSVDIASGQHTRGGYPI---VPLTRVQLLGTEGRQLNLTDDTFAEPVL 296

Query: 373 LDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPS-DDSTQIVFDFGGFHINASLS 431
           L+S    ++LP+++V  IA +  A ++      +++C    +     F FG   +   LS
Sbjct: 297 LNSRFMTSFLPKSIVQQIARQTNAVFTKSSNRLIVECSLLKEEASFRFHFGELVVEVPLS 356

Query: 432 SFI-------------LSTGSTCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMA 478
            FI               T  TC L ++P++    ++LG   L   Y+  D ++  + MA
Sbjct: 357 DFIGPTNLRAGTSILAPDTNETCYLKLMPSTGMGFSMLGMPILRKLYIAADTESGAVGMA 416

Query: 479 QA 480
            A
Sbjct: 417 LA 418

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 52.4 bits (124), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 48/81 (59%), Gaps = 7/81 (8%)

Query: 41  FVKLPFHKLYGDSLDNV-GRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99
           +V+ P  KL      NV G   +  +++FKR D     +I N    Y V++++G+PPQ  
Sbjct: 27  YVRFPVQKL-----ANVPGMGSQDVSNVFKRDDVLNSTLI-NAVGMYVVKVEIGTPPQTA 80

Query: 100 TVLVDTGSSDLWIMGSNNPYC 120
            + +DTGSSD+++  +++PYC
Sbjct: 81  YLQLDTGSSDMYVNDADSPYC 101

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 5/82 (6%)

Query: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100
           +VK P  K + D + N+G   +  + +FKR +     +I N    Y V++++G+PPQ V 
Sbjct: 27  YVKFPVQK-FADII-NIG--TQDVSTVFKRNEVLNTTVI-NGIGVYVVKMEIGTPPQTVY 81

Query: 101 VLVDTGSSDLWIMGSNNPYCSS 122
           + +DTGSSD+ +  ++  YC S
Sbjct: 82  LQLDTGSSDMIVNNADIAYCKS 103

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 92/325 (28%), Positives = 140/325 (43%), Gaps = 65/325 (20%)

Query: 211 SISYGDGTFASGTFGTDVLDLSDLNVTGLSF-AVANETNSTMGVLGIGLPELEVTYSGST 269
           S SYG+ +      G   +D   LN++ +SF +  N    ++G LG+G         G+ 
Sbjct: 145 SYSYGNHS------GLVEVDHGHLNISSMSFFSTYNSGGLSIGSLGLG---------GNV 189

Query: 270 ASRGRR--PFKYD-NFPIV--LKNSGAIKTNAYSLYL---NDSDAEH-----------GT 310
            SR       +YD +F ++  LK +G I+   YSL+L   N S  E            G 
Sbjct: 190 ESRNSDLDSGQYDGSFFLLEELKEAGLIEGRGYSLWLGGDNTSLVEQEGTVYSSESIAGR 249

Query: 311 ILFGAVDHSKYTGTLYT---IPIVN--TLSASGFSSPIQFDVTINGIGVSDSKNGEKTLT 365
           ++ GAV+ +   G   +   +P  N  TL  S    PI     IN I    SK+G     
Sbjct: 250 LILGAVNPNLIDGKFVSFNMLPYQNPDTLEMSN-GYPILPMGPINII----SKSGASLNM 304

Query: 366 TTK---IPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCP-SDDSTQIVFDF 421
           T+     P LLDS  T + LP   +  IA +I A Y  +L  +V+ C    +S  + F F
Sbjct: 305 TSNNYLQPVLLDSRYTNSRLPIEAIIQIAIQIDASYVEQLNSWVVSCSILKESVVLEFSF 364

Query: 422 GGFHINASLSSFI-------------LSTG-STCLLGIIPTSDNTGTILGDSFLTNAYVV 467
           G   I   L  F+             LS G   C+L + P  D    ILG  F+ + Y+ 
Sbjct: 365 GPLRIKVPLKQFLKKAIDPDTGNARTLSNGDQACILSLYPNHDIGYNILGAPFMKSIYLA 424

Query: 468 YDLDNLEISMAQA--QYNTTTENIE 490
            D +   I++ Q+  ++ +  +NIE
Sbjct: 425 VDNEGGTIALGQSLRRFISEADNIE 449

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 9/79 (11%)

Query: 284 IVLKNSGAI-KTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPI---VNTLSASGF 339
           +  +  G I K  +YSL+LN  +   G+ILFGAVD SKY   L T P+    NTL ++  
Sbjct: 1   MAFERQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQAYNTLDSNS- 59

Query: 340 SSPIQFDVTINGIGVSDSK 358
               +  +T+  + + D K
Sbjct: 60  ----RIIITVQSVAILDGK 74

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 94/219 (42%), Gaps = 29/219 (13%)

Query: 285 VLKNSGAIKTNAYSLYLNDSDAEHGTI-----LF--GAVDHSKYTGTLYTIPIVNTLSAS 337
           VL  S +I++  ++LYL+  ++E+ T+     LF  G      Y G +Y   +V   +  
Sbjct: 216 VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIYYSELVVNPNNY 275

Query: 338 GFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETVVALIADEIGAQ 397
              +  +       +   + +N     + +K   ++DSG+T   LP+     I       
Sbjct: 276 WLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTFLVLPKVDALDI------- 328

Query: 398 YSYRLG------YYVLDCPSDDSTQIVFDFGGFHINASLSSFI---LSTGST----CLLG 444
           +SY  G      Y+ + C S  +  + F+ G  +     SS++      GS     C+  
Sbjct: 329 HSYLPGSITDGNYFAVFCNS--TVDLTFELGNKNWTIPASSYLGEPYQEGSKYYGYCVSN 386

Query: 445 IIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYN 483
           I   + ++  ILGD F+ N Y V+D+DN ++  A    N
Sbjct: 387 IEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFALKNSN 425

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 66/300 (22%), Positives = 114/300 (38%), Gaps = 42/300 (14%)

Query: 210 FSISYGDGTFASGTFGTDVLDLSDLNVT-GLSFAVANETNSTM------GVLGIGLPELE 262
           FS++Y  G  A G    D + +++L  T   +F VA+E           G+ G+     +
Sbjct: 150 FSLAYTSGV-AVGDVYHDRIIVNELATTDNFTFGVASEVPDIFENYPASGIFGLPSDNSQ 208

Query: 263 VTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYT 322
              +  +  R       + F I++ +  A  +      + D  +  G    G      Y 
Sbjct: 209 SIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIFAIGDELEGLYK 268

Query: 323 GTLY---TIPIVNTLSASGFSSPIQFDVTINGIGVSDSK---------NGEKTLTTTKIP 370
           G +Y    IP  N+           + + IN + V+D K          G K+  T    
Sbjct: 269 GEIYYNSLIPDKNSY----------WSLKINNLYVNDYKVNFTNYENFTGSKSHNTRS-- 316

Query: 371 ALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSDDSTQIVFDFGGFHINASL 430
           +++DSGTTL  LP+     I    G   +    + ++ C S  +  + FD   + I +  
Sbjct: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQTLTLEFDNKNWTIPSE- 374

Query: 431 SSFILSTGST-------CLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYN 483
             ++    S        C+  I     +   ILGD FL   Y V+D++N  +  A+   N
Sbjct: 375 -KYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAEGNEN 433

>ZYRO0B01892g Chr2 complement(151888..152991) [1104 bp, 367 aa] {ON}
           conserved hypothetical protein
          Length = 367

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 480 AQYNTTTENIEVISSSIPSAVKAPGYTNTWS 510
           AQ+  T E + V++S  P    AP YT+ W+
Sbjct: 22  AQFKDTIEELTVLASEYPGDYHAPDYTSPWA 52

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,391,294
Number of extensions: 2487641
Number of successful extensions: 6793
Number of sequences better than 10.0: 179
Number of HSP's gapped: 6476
Number of HSP's successfully gapped: 251
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)