Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1518.271ON89389347320.0
YLR092W (SUL2)8.271ON89389344300.0
Skud_12.1608.271ON89389343520.0
Suva_10.1768.271ON89389441380.0
NCAS0B050508.271ON92382030760.0
NDAI0B020208.271ON90589930640.0
KNAG0G020708.271ON89990829560.0
Skud_2.424na 1ON86390629350.0
YBR294W (SUL1)na 1ON85990429190.0
TDEL0F039808.271ON86787829160.0
Smik_2.435na 1ON86383328840.0
Suva_4.554na 1ON85083128790.0
Kpol_543.438.271ON86688528470.0
TPHA0J008008.271ON91792828400.0
CAGL0L12342g8.271ON89189128300.0
KAFR0B027508.271ON83488828250.0
SAKL0H16830g8.271ON86287226790.0
ZYRO0C01452g8.271ON90688926570.0
KLLA0F19338g8.271ON89185826130.0
KLTH0G13486g8.271ON90288626020.0
TPHA0A017608.271ON89384325690.0
Kwal_56.237598.271ON86186925380.0
AGR077C8.271ON84885924040.0
Ecym_42998.271ON87486623010.0
TBLA0F030508.271ON89752113471e-172
KNAG0D023908.99ON7166853423e-32
NDAI0B022108.99ON7064763371e-31
TBLA0C052708.99ON7764673077e-28
TDEL0C012808.99ON7274812942e-26
NCAS0B048008.99ON7244882906e-26
YPR003C8.99ON7544782862e-25
Suva_16.3228.99ON7424772817e-25
ZYRO0F04796g8.99ON7354892763e-24
SAKL0B03124g8.99ON7445892746e-24
TPHA0H007208.99ON7875272738e-24
Ecym_7084na 2ON6895042701e-23
CAGL0L09207g8.99ON7254922692e-23
KLLA0E14059g8.99ON7066422665e-23
Kpol_467.118.99ON7445692657e-23
KLTH0G16764g8.99ON7105942621e-22
Skud_16.2868.99ON7454782551e-21
SAKL0H08800gna 2ON6204442058e-16
Kwal_27.110398.99ON7261751711e-11
Smik_16.2418.99ON7441831701e-11
AGR213Cna 2ON6891761664e-11
KAFR0C019103.485ON1020204970.008
KLLA0E04731g3.485ON1060379920.028
ZYRO0C07986g3.485ON1024414900.057
YGR125W3.485ON1036217870.13
KLTH0G15752g3.119ON964170840.26
TBLA0C044403.485ON1150204820.44
Suva_6.2571.163ON609138800.64
SAKL0F02926g3.485ON1050217800.81
KLTH0F14674g3.485ON1010219800.87
NDAI0D039404.167ON19772733.0
Smik_7.6na 3ON37293743.4
KAFR0E008508.555ON186675727.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.151
         (893 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...  1827   0.0  
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...  1711   0.0  
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...  1680   0.0  
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...  1598   0.0  
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271   1189   0.0  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271   1184   0.0  
KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.2...  1143   0.0  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...  1135   0.0  
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...  1129   0.0  
TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.2...  1127   0.0  
Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W ...  1115   0.0  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...  1113   0.0  
Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON} (93697..9...  1101   0.0  
TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8....  1098   0.0  
CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON} sim...  1094   0.0  
KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.2...  1092   0.0  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...  1036   0.0  
ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {...  1028   0.0  
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...  1011   0.0  
KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]...  1006   0.0  
TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {O...   994   0.0  
Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {...   982   0.0  
AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON} S...   930   0.0  
Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}...   890   0.0  
TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {O...   523   e-172
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...   136   3e-32
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...   134   1e-31
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...   122   7e-28
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...   117   2e-26
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...   116   6e-26
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...   114   2e-25
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...   112   7e-25
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...   110   3e-24
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...   110   6e-24
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...   109   8e-24
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...   108   1e-23
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...   108   2e-23
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...   107   5e-23
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...   106   7e-23
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...   105   1e-22
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...   102   1e-21
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    84   8e-16
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    70   1e-11
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    70   1e-11
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    69   4e-11
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....    42   0.008
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...    40   0.028
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...    39   0.057
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...    38   0.13 
KLTH0G15752g Chr7 (1373153..1376047) [2895 bp, 964 aa] {ON} simi...    37   0.26 
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...    36   0.44 
Suva_6.257 Chr6 (455656..457485) [1830 bp, 609 aa] {ON} YJL176C ...    35   0.64 
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...    35   0.81 
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...    35   0.87 
NDAI0D03940 Chr4 (930509..930576,930647..931172) [594 bp, 197 aa...    33   3.0  
Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)     33   3.4  
KAFR0E00850 Chr5 complement(178580..184180) [5601 bp, 1866 aa] {...    32   7.4  

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1827 bits (4732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 885/893 (99%), Positives = 885/893 (99%)

Query: 1   MSRETYPNLEEVEIPDFQDTSNTVPXXXXXXXXYDQYKNNENNDAFKDNDLESNSVAKPN 60
           MSRETYPNLEEVEIPDFQDTSNTVP        YDQYKNNENNDAFKDNDLESNSVAKPN
Sbjct: 1   MSRETYPNLEEVEIPDFQDTSNTVPDLDDLELEYDQYKNNENNDAFKDNDLESNSVAKPN 60

Query: 61  AVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLK 120
           AVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLK
Sbjct: 61  AVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLK 120

Query: 121 SVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180
           SVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY
Sbjct: 121 SVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180

Query: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIG 240
           SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIG
Sbjct: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIG 240

Query: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300
           FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP
Sbjct: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300

Query: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVI 360
           DTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVI
Sbjct: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVI 360

Query: 361 IVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLL 420
           IVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLL
Sbjct: 361 IVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLL 420

Query: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480
           LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP
Sbjct: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480

Query: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540
           LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC
Sbjct: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540

Query: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAV 600
           FIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAV
Sbjct: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAV 600

Query: 601 SYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHT 660
           SYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHT
Sbjct: 601 SYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHT 660

Query: 661 KWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQL 720
           KWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQL
Sbjct: 661 KWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQL 720

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKIL 780
           IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKIL
Sbjct: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKIL 780

Query: 781 CLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEE 840
           CLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEE
Sbjct: 781 CLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEE 840

Query: 841 YSDESIVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           YSDESIVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 841 YSDESIVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 1711 bits (4430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 819/893 (91%), Positives = 853/893 (95%)

Query: 1   MSRETYPNLEEVEIPDFQDTSNTVPXXXXXXXXYDQYKNNENNDAFKDNDLESNSVAKPN 60
           MSRE YPN EEVEIPDFQ+T+NTVP        YDQYKNNENND F D DLESNSVAK N
Sbjct: 1   MSREGYPNFEEVEIPDFQETNNTVPDLDDLELEYDQYKNNENNDTFNDKDLESNSVAKHN 60

Query: 61  AVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLK 120
           AV + KG KGSKI+YFNPSDVSLYDNSVSQFEE+TVSLKEYYDHSIRSHLT+KGA  YLK
Sbjct: 61  AVNSSKGVKGSKIDYFNPSDVSLYDNSVSQFEETTVSLKEYYDHSIRSHLTVKGACSYLK 120

Query: 121 SVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180
           SVFPIINWLPHYNF+WFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY
Sbjct: 121 SVFPIINWLPHYNFSWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180

Query: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIG 240
           SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGD AITGPVIATTLALLCGIISAA+G
Sbjct: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDSAITGPVIATTLALLCGIISAAVG 240

Query: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300
           FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP
Sbjct: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300

Query: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVI 360
           DTKLDAVFGLIPLFLLYVWKWWCGTYGP LNDRYNSKNPRLHKI+KWTYFYAQASRNG+I
Sbjct: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGII 360

Query: 361 IVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLL 420
           I+VFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVP GLMSKLGPNLPASIIVLL
Sbjct: 361 IIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVLL 420

Query: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480
           LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP
Sbjct: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480

Query: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540
           LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC
Sbjct: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540

Query: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAV 600
           FIVTVLITVFASIEDGIYFAMCWSCAML+LK+AFPAGKFLGRVE+AEVTDAY++ +SD V
Sbjct: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVEVAEVTDAYVRPDSDVV 600

Query: 601 SYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHT 660
           SY SENNNGI T E+G E +K+SSTKY+TNSSKKIETNVQTK FDSPSS I+QPR+KYHT
Sbjct: 601 SYVSENNNGISTLEDGGEDDKESSTKYVTNSSKKIETNVQTKGFDSPSSSISQPRIKYHT 660

Query: 661 KWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQL 720
           KW+PFDHKYTRELNPD+QILPPP+GVLVYRLSESYTYLNCSRHYNIITE+VK+VTRRGQL
Sbjct: 661 KWIPFDHKYTRELNPDVQILPPPDGVLVYRLSESYTYLNCSRHYNIITEEVKKVTRRGQL 720

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKIL 780
           IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRE+D E +ENAP  S+  ERDDRPLLKIL
Sbjct: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRENDPESMENAPSTSVDVERDDRPLLKIL 780

Query: 781 CLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEE 840
           CLDFSQVAQTDATALQSLVDLRK INQYADRQVEFHFVGIISPWVKRGL+SRGFGTLNEE
Sbjct: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNEE 840

Query: 841 YSDESIVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           YSDESIVAGHTSYHVARVPQ +EN +KYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 841 YSDESIVAGHTSYHVARVPQGEENPEKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1680 bits (4352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 808/893 (90%), Positives = 841/893 (94%)

Query: 1   MSRETYPNLEEVEIPDFQDTSNTVPXXXXXXXXYDQYKNNENNDAFKDNDLESNSVAKPN 60
           MS+ET PNLEEVEIPDFQD +++VP        YDQYKNNENN  F DNDLESNSVA  N
Sbjct: 1   MSKETQPNLEEVEIPDFQDNTDSVPNLDDLELEYDQYKNNENNGVFSDNDLESNSVANRN 60

Query: 61  AVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLK 120
           AV + KG KGSKIEYF+PSDVSLYDNSVSQFEES VSLKEYY+HSIRSHLTLKGA DYLK
Sbjct: 61  AVNDAKGVKGSKIEYFDPSDVSLYDNSVSQFEESAVSLKEYYNHSIRSHLTLKGAGDYLK 120

Query: 121 SVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSY 180
           SVFPIINWLPHYNFNWF ADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAY+Y
Sbjct: 121 SVFPIINWLPHYNFNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYAY 180

Query: 181 SFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIG 240
           SFFATSKDVCIGPVAVMSLQTAKVIA+V AKYPDGD  ITGPVIATTLALLCGIISAA+G
Sbjct: 181 SFFATSKDVCIGPVAVMSLQTAKVIAEVQAKYPDGDTTITGPVIATTLALLCGIISAAVG 240

Query: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLP 300
           FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYN LVNTRAATYKVVIETLKHLP
Sbjct: 241 FLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRAATYKVVIETLKHLP 300

Query: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVI 360
           DTKLDAVFGLIPLFLLYVWKWWCGTYGP LNDRYNSKN RLHKI+KWTYFYAQASRNG+I
Sbjct: 301 DTKLDAVFGLIPLFLLYVWKWWCGTYGPRLNDRYNSKNARLHKIVKWTYFYAQASRNGII 360

Query: 361 IVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLL 420
           I+VFTCIGWAITRGKS SERPISILGSVPSGLKEVGVFHVPSGLMSKLGP+LP+SIIVLL
Sbjct: 361 IIVFTCIGWAITRGKSSSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPSLPSSIIVLL 420

Query: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480
           LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP
Sbjct: 421 LEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTP 480

Query: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540
           LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC
Sbjct: 481 LSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFIC 540

Query: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAV 600
           FIVTVLITVFASIEDGIYFAMCWSCAMLLLK+AFPAGKFLGRVEIAEVTDAY+KA+SDAV
Sbjct: 541 FIVTVLITVFASIEDGIYFAMCWSCAMLLLKVAFPAGKFLGRVEIAEVTDAYVKADSDAV 600

Query: 601 SYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHT 660
           SY SENNN I T EE  E EK+ S KYITNSSKKIETNVQTK F SPSS I QPR+KYHT
Sbjct: 601 SYVSENNNRISTLEENGEDEKEISAKYITNSSKKIETNVQTKGFASPSSSIGQPRIKYHT 660

Query: 661 KWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQL 720
           KW+PFDHKYTRELNPD+ ILPPPE VLVYRLSESYTYLNCSRHYNII ++VK  TRRGQ+
Sbjct: 661 KWLPFDHKYTRELNPDVHILPPPESVLVYRLSESYTYLNCSRHYNIIIDEVKRATRRGQI 720

Query: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKIL 780
           IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKK+ESD EF +NAP+NSI  ERD+RPLLKIL
Sbjct: 721 IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKKESDLEFTQNAPNNSIDAERDERPLLKIL 780

Query: 781 CLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEE 840
           CLDFSQVAQTDATALQSLVDLRK INQYADRQVEFHFVGIISPWVKRGL+SRGFGT+NEE
Sbjct: 781 CLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTINEE 840

Query: 841 YSDESIVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           YSDESIVAGHTSYHVARVP++KEN DKYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 841 YSDESIVAGHTSYHVARVPRNKENPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 1598 bits (4138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 765/894 (85%), Positives = 817/894 (91%), Gaps = 2/894 (0%)

Query: 1   MSRETYPNLEEV-EIPDFQDTSNTVPXXXXXXXXYDQYKNNENNDAFKDNDLESNSVAKP 59
           MSRET+ N+EEV EIPDFQD S TVP        YDQYKNNENN AF DNDLESNS+   
Sbjct: 1   MSRETHSNIEEVVEIPDFQD-STTVPDLDDLELEYDQYKNNENNGAFNDNDLESNSLTNH 59

Query: 60  NAVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYL 119
           N     KG KGSK+EYFN SD+SLYDNSVSQF+E TVS KEYYDHSIRSHLTLK A +YL
Sbjct: 60  NTASEAKGVKGSKVEYFNTSDISLYDNSVSQFDEPTVSFKEYYDHSIRSHLTLKAAGNYL 119

Query: 120 KSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYS 179
           KSVFPII WLPHYN NWF ADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAY+
Sbjct: 120 KSVFPIIYWLPHYNVNWFIADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYA 179

Query: 180 YSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAI 239
           YSFFATSKDVCIGPVAVMSLQTAKVIADVTA+YPDGD  ITGP+IATTLALLCGIISAA+
Sbjct: 180 YSFFATSKDVCIGPVAVMSLQTAKVIADVTARYPDGDTTITGPIIATTLALLCGIISAAV 239

Query: 240 GFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHL 299
           GFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYN LVNTR ATYK+VI++LKHL
Sbjct: 240 GFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNKLVNTRVATYKIVIDSLKHL 299

Query: 300 PDTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGV 359
           PDT LDA FGLIPLF+LY WKWWCGTYGP LNDR+NSK PRLHKI+KWT FYAQASRNG+
Sbjct: 300 PDTTLDAAFGLIPLFILYTWKWWCGTYGPRLNDRFNSKKPRLHKIVKWTCFYAQASRNGI 359

Query: 360 IIVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVL 419
           II+VFTCI WAITRGKS ++RPISILGSVPSGLKEVGVFHVP GLMSKLGPNLPASIIVL
Sbjct: 360 IIIVFTCIAWAITRGKSSADRPISILGSVPSGLKEVGVFHVPPGLMSKLGPNLPASIIVL 419

Query: 420 LLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRT 479
           LLEHIAISKSFGR+NDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRT
Sbjct: 420 LLEHIAISKSFGRVNDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRT 479

Query: 480 PLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFI 539
           PLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFI
Sbjct: 480 PLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFI 539

Query: 540 CFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDA 599
           CFIVTVLITVF+SIE+GIYFAMCWSCA+ +LK+AFPAGKFLGRVEIAEVTDAY++A+SD+
Sbjct: 540 CFIVTVLITVFSSIENGIYFAMCWSCAIFILKVAFPAGKFLGRVEIAEVTDAYVRADSDS 599

Query: 600 VSYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYH 659
           VS+TSENNN I T EE    EK+  T YI NS KK+ET VQTK F+SPS+ I QPR+KYH
Sbjct: 600 VSFTSENNNRISTLEEDGVGEKEGPTNYIINSFKKLETKVQTKGFESPSASIGQPRIKYH 659

Query: 660 TKWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQ 719
           TKW+PFDHKYT+ELNPD+ ILPPPEGVLVYRLSESYTY+NCSRHYN+IT+++K+VTRRGQ
Sbjct: 660 TKWLPFDHKYTKELNPDVNILPPPEGVLVYRLSESYTYINCSRHYNVITDEIKKVTRRGQ 719

Query: 720 LIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKI 779
           LIRHRKKSDRPWNDPGPWE P F KNLKFWKK+E+D E  ENA +N     RDDRPLLKI
Sbjct: 720 LIRHRKKSDRPWNDPGPWEPPTFFKNLKFWKKKETDIESSENAVNNPTDAVRDDRPLLKI 779

Query: 780 LCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNE 839
           LCLDFSQVAQTDATALQSLVDLRK INQYADRQVEFHFVGIISPWVKRGL+SRGFGTLNE
Sbjct: 780 LCLDFSQVAQTDATALQSLVDLRKAINQYADRQVEFHFVGIISPWVKRGLISRGFGTLNE 839

Query: 840 EYSDESIVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           EYSDESIVAGHTSYHVARVPQ++E  DKYSVYTASGTNLPFFHIDIPDFAKWDI
Sbjct: 840 EYSDESIVAGHTSYHVARVPQNEETPDKYSVYTASGTNLPFFHIDIPDFAKWDI 893

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 1189 bits (3076), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/820 (68%), Positives = 672/820 (81%), Gaps = 22/820 (2%)

Query: 88  VSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITI 147
           +  ++E TVS+K+YYDHSIR ++TL G RDY  S+FPI  WLPHYN  WFT+DLIAGIT+
Sbjct: 112 IPNYDEKTVSIKDYYDHSIRENVTLVGVRDYFLSIFPITRWLPHYNLTWFTSDLIAGITV 171

Query: 148 GCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIAD 207
           GCVLVPQSMSYAQ+ATLPAQYGLYSSFIGA+ YS FATSKDVCIGPVAVMSL+TAKV+  
Sbjct: 172 GCVLVPQSMSYAQIATLPAQYGLYSSFIGAFCYSLFATSKDVCIGPVAVMSLETAKVVTK 231

Query: 208 VTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNI 267
           V AKYPD DP IT P++AT L+LLCGI++A +G LRLGFLVELISLNAV GFMTGSA NI
Sbjct: 232 VLAKYPDNDPTITAPIVATALSLLCGIVTAGVGVLRLGFLVELISLNAVTGFMTGSALNI 291

Query: 268 LWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYG 327
           LWGQVP LMGYNS VNTR A YKV+IETLKHLPDTKLDAVFGLIPLFLLY+WKWWC   G
Sbjct: 292 LWGQVPGLMGYNSKVNTRTANYKVIIETLKHLPDTKLDAVFGLIPLFLLYLWKWWCDNMG 351

Query: 328 PILNDRY--NSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISIL 385
           P L D++   +KN R +   K  YFYAQA++N +II+VFT I W+ITRGK+K++RPISIL
Sbjct: 352 PKLVDKWFPKNKNERANFYFKKFYFYAQAAKNAIIIIVFTAISWSITRGKAKADRPISIL 411

Query: 386 GSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELI 445
           G+VP GLKEVGV  +P GL+SKL P LPAS+IVLLLEHIAI+KSFGRINDYKVVPDQELI
Sbjct: 412 GTVPKGLKEVGVMKLPDGLLSKLAPELPASVIVLLLEHIAIAKSFGRINDYKVVPDQELI 471

Query: 446 AIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIP 505
           AIGV+NL+GTFFNAYPATGSFSRSALKAKC VRTPLSG+F+G+CVLLALYCLTGAFFYIP
Sbjct: 472 AIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGIFTGACVLLALYCLTGAFFYIP 531

Query: 506 KATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSC 565
           KATLSAVII AVSDL+ASY+ TWNFWKMNPLD +CF+VTV ITVF+SIE+GIYFA+CWSC
Sbjct: 532 KATLSAVIIQAVSDLIASYKITWNFWKMNPLDCLCFLVTVFITVFSSIENGIYFAVCWSC 591

Query: 566 AMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSST 625
           A+LLLK+ FPAGKFLGR+E+AEV D Y+  + ++ +    ++    +S+   + +K   T
Sbjct: 592 AILLLKVCFPAGKFLGRIEVAEVIDGYVDNSIESATTAEYSSASSPSSDNETDTKKIQKT 651

Query: 626 KYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEG 685
             I+         V T   D        P+++Y+TKWVPFDH YTRELNP + ILPPP G
Sbjct: 652 SSISFGKDAKAVAVSTSPVDC------NPKVRYYTKWVPFDHAYTRELNPSVNILPPPPG 705

Query: 686 VLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKN 745
           V+VYRL++S+TY+NCSRHY++I ++VK  TRRGQL+RHRKK+DRPWNDPG WEAP FLKN
Sbjct: 706 VIVYRLTDSFTYINCSRHYDVIFDEVKRQTRRGQLLRHRKKADRPWNDPGEWEAPQFLKN 765

Query: 746 LKFWKKRES-DSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKV 804
           L   KK+ S D E   +  DNS  + RD+RPLLKI+CLDFSQVAQ DA+A+QSLVDLRK 
Sbjct: 766 LFHRKKKNSTDEESAVDVSDNS--SIRDNRPLLKIVCLDFSQVAQIDASAIQSLVDLRKS 823

Query: 805 INQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVAR-VPQSKE 863
           IN+YADRQVEFHF GI+SPWVKRGL++RGFGT+N+E+SD SI+AGH+SYH+ R +P S  
Sbjct: 824 INRYADRQVEFHFAGIVSPWVKRGLINRGFGTINDEFSDASIIAGHSSYHLTRTLPDSDF 883

Query: 864 NSD----------KYSVYTASGTNLPFFHIDIPDFAKWDI 893
           + +          +Y V+ A+GTNLPFFHIDIPDF+KWD+
Sbjct: 884 DLESNFRDTYSRSQYHVFAATGTNLPFFHIDIPDFSKWDL 923

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score = 1184 bits (3064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/899 (64%), Positives = 694/899 (77%), Gaps = 29/899 (3%)

Query: 11  EVEIPDFQDTSNTVPXXXXXXXXYDQYKNNE-NNDAFKDNDLESNS--VAKPNAVGNGKG 67
           + E+P F ++  +          YDQYK +E NN +    DLE+N+  V   N    G  
Sbjct: 20  QYELPSFPNSDTSSQNLADLELEYDQYKASETNNKSNHGPDLETNNLDVQFSNTYNTGDK 79

Query: 68  AKGSK-----IEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSV 122
               K     I  FN   V      +  FEE  +S K+YY HS++ + +LK  ++Y  S+
Sbjct: 80  KNSIKNHQIQINTFNADSVI-----IPSFEEHAISFKDYYRHSLKENFSLKSVKEYALSI 134

Query: 123 FPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSF 182
           FPII WLPHYN  WF++DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSFIGA++YS 
Sbjct: 135 FPIIRWLPHYNLAWFSSDLIAGITVGCVLVPQSMSYAQIATLPPQYGLYSSFIGAFTYSL 194

Query: 183 FATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFL 242
           FATSKDVCIGPVAVMSL+T KVI  V AKYP+ DP IT PVIAT LA LCG+I+A IGFL
Sbjct: 195 FATSKDVCIGPVAVMSLETGKVITKVLAKYPEADPNITAPVIATVLAFLCGVITAGIGFL 254

Query: 243 RLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDT 302
           RLGFLVELISLNAV GFMTGSA NI+WGQ+PALMGY S VNTR +TYKV+IE+LKHLPDT
Sbjct: 255 RLGFLVELISLNAVTGFMTGSALNIMWGQIPALMGYGSKVNTRTSTYKVIIESLKHLPDT 314

Query: 303 KLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIV 362
           KLDAVFGLIPLF+LY+WKWWCG  GP + D++ + N + +  LK  YFYAQA++N VII+
Sbjct: 315 KLDAVFGLIPLFILYLWKWWCGNMGPRMADKWFANNEKGNFYLKKFYFYAQAAKNAVIII 374

Query: 363 VFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLE 422
           VFT I W+IT+GK+K ERPISILGSVP GLKEVGV  +P GL SK+ P LPAS+IVLLLE
Sbjct: 375 VFTAIAWSITKGKTKDERPISILGSVPKGLKEVGVMKLPDGLASKIAPELPASVIVLLLE 434

Query: 423 HIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLS 482
           HIAI+KSFGRINDYKVVPDQELIAIGV+NL+GTFFNAYPATGSFSRSALKAKC VRTPLS
Sbjct: 435 HIAIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLS 494

Query: 483 GLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFI 542
           GLF+GSCVLLALYCLTG F YIPKATLSAVIIHAVSDL+ASY TTWNFWKMNPLD   FI
Sbjct: 495 GLFTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIASYHTTWNFWKMNPLDCFSFI 554

Query: 543 VTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSY 602
           VTV ITVF+SIE+GIYFAMCWSCA+L+LK+AFPAGKFLGRVEIAEV +  +  + +   Y
Sbjct: 555 VTVFITVFSSIENGIYFAMCWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSFEVTDY 614

Query: 603 TSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKW 662
           +S        S   D    +   K +     K    ++ + F   SS+  + +++Y+TKW
Sbjct: 615 SSN----SNLSLSADTINHNKKLKILHIPLLK---TLKDQLFSDISSIQGKSKIRYYTKW 667

Query: 663 VPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIR 722
           +PFDH YT+ELNP++ ILPPP GV+VYRL++S+TY+NCS+HY++I E++K+ T+RGQLIR
Sbjct: 668 LPFDHAYTKELNPNVIILPPPPGVIVYRLTDSFTYMNCSKHYDVIFEEIKKQTKRGQLIR 727

Query: 723 HRKKSDRPWNDPGPWEAPAF---LKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKI 779
           HRKKSDRPWNDPG WEAP F    K L F + + ++     + PD  + ++RDDRPLLK+
Sbjct: 728 HRKKSDRPWNDPGEWEAPNFSKLWKKLSFRRNKNNNDNEETHIPDVPV-SKRDDRPLLKV 786

Query: 780 LCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNE 839
           LCLDFSQVAQ DATALQSLVDLRK IN+YADRQVEFHF GI+SPW+K+GL++ GFGT+NE
Sbjct: 787 LCLDFSQVAQVDATALQSLVDLRKAINKYADRQVEFHFAGIVSPWIKKGLINIGFGTINE 846

Query: 840 EYSDESIVAGHTSYHVARVPQSK-----ENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           EYSDESI+AGHTSYH+AR+P             Y VYTA+GTNLPFFHIDIPDF +WD+
Sbjct: 847 EYSDESIIAGHTSYHLARIPGDDLELPTMRGGNYKVYTATGTNLPFFHIDIPDFYQWDV 905

>KNAG0G02070 Chr7 (469623..472322) [2700 bp, 899 aa] {ON} Anc_8.271
           YLR092W
          Length = 899

 Score = 1143 bits (2956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/908 (62%), Positives = 693/908 (76%), Gaps = 37/908 (4%)

Query: 2   SRETYPNLEEVEIPDFQDTSNTVPXXXXXXXXYDQYKNNE--------NNDAFKDNDLES 53
           S  ++PN    E  +  + S+T P        YDQYK +E        +N A  D +  +
Sbjct: 13  SDNSFPNEYGAEYNNANEVSST-PDLDNLELEYDQYKADELHPQRTILSNQADTDREKIA 71

Query: 54  NSVAKPNAV--GNGKGAKGSKIEYF-NPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHL 110
           N   +  +V   N   A   +++YF + SD +     +  + E  V+  E+++HS+RS  
Sbjct: 72  NVFVEEQSVRDSNIPSASIEELQYFAHESDGA---KVIPSYVEGNVTELEFFNHSLRSKF 128

Query: 111 TLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGL 170
           TL  A++Y+ S+FPII+WLPHYN  WF  DLIAGIT+GCVLVPQSMSYAQ+ATLP QYGL
Sbjct: 129 TLNAAKNYILSIFPIIHWLPHYNVYWFIQDLIAGITVGCVLVPQSMSYAQIATLPPQYGL 188

Query: 171 YSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLAL 230
           YSSFIGA+ YS FATSKDVCIGPVAVMSL+TAK+IA V  ++P+ DP + GP+IATT AL
Sbjct: 189 YSSFIGAFIYSLFATSKDVCIGPVAVMSLETAKIIARVMKRFPN-DPDVQGPIIATTTAL 247

Query: 231 LCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYK 290
           LCG I+A +GFLRLGFLVELISLNAVAGFMTGSA NI+ GQVPALMGY  LVNTR ATYK
Sbjct: 248 LCGGIAAGVGFLRLGFLVELISLNAVAGFMTGSALNIISGQVPALMGYGKLVNTRTATYK 307

Query: 291 VVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYF 350
           V++ TLKHLPDTKLDAVFGLIPLF+LY W+WWC  YGP L DRY  K  R + + K  YF
Sbjct: 308 VIVNTLKHLPDTKLDAVFGLIPLFILYFWRWWCNGYGPKLTDRYYPKGSRGNFLWKKFYF 367

Query: 351 YAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGP 410
           YAQASR+G+II+VFT I W+ITR     ER ISILG+VP GLK+VG   VP  L +K+ P
Sbjct: 368 YAQASRSGIIIIVFTAISWSITRHVPSKERRISILGTVPKGLKDVGAIKVPPELPAKIAP 427

Query: 411 NLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSA 470
            LPA++IVLLLEHIAISKSFGRINDYKVVPDQELIAIGV+NL+GTFF+AYP TGSFSRSA
Sbjct: 428 ELPAAVIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHAYPTTGSFSRSA 487

Query: 471 LKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF 530
           LKAKCNV+TPLSGLF+GSCVLLALYCLTGAFFYIPKATLSAVIIH+VSDL+ASY TTWNF
Sbjct: 488 LKAKCNVKTPLSGLFTGSCVLLALYCLTGAFFYIPKATLSAVIIHSVSDLVASYHTTWNF 547

Query: 531 WKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTD 590
           +KMNPLDF+CF+ T++ITVF+SIE+GIYFA+CWSCA+LL K+AFPAGKFLGRVEIAEV D
Sbjct: 548 YKMNPLDFVCFLTTIIITVFSSIENGIYFAICWSCALLLFKVAFPAGKFLGRVEIAEVVD 607

Query: 591 AYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSL 650
             I  ++  V  T +  +    ++E  + + +  + +I     K+++        + SS 
Sbjct: 608 GEIINDNSVVMTTDDCVSEFGGNKEFSKDKLNGKSDFIVKD--KLDST-------ASSSS 658

Query: 651 ITQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEK 710
           I + ++KY+TKWVPFDH YTRELNPD+ I PPP GV+VYR+S+SYTY+N S HY+II ++
Sbjct: 659 IAENKLKYYTKWVPFDHAYTRELNPDVTIQPPPPGVIVYRMSDSYTYINASNHYDIIIDE 718

Query: 711 VKEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRE-----SDSEFLENAPDN 765
           +K VTRRGQL++HRKKSDRPWNDPG W+ P FL N+  W+K +     +D E LE     
Sbjct: 719 IKRVTRRGQLLQHRKKSDRPWNDPGEWKPPKFLSNVLHWRKNKKKNQTADVESLET---- 774

Query: 766 SIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWV 825
             G  RD+RP+LK+LCLDFSQVAQ D+T+LQSLVDLRK +N YADRQVEFHF GIISPW+
Sbjct: 775 --GIVRDERPVLKVLCLDFSQVAQVDSTSLQSLVDLRKAVNAYADRQVEFHFAGIISPWI 832

Query: 826 KRGLVSRGFGTLNEEYSDESIVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDI 885
           KRGLV  GFGT+NEE+SDESI+AGH+SYH+ +     +  + Y V TA+GTNLPFFHIDI
Sbjct: 833 KRGLVKIGFGTVNEEFSDESIIAGHSSYHLVK-NTIGDIENGYQVKTATGTNLPFFHIDI 891

Query: 886 PDFAKWDI 893
           PDF KWDI
Sbjct: 892 PDFKKWDI 899

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/906 (62%), Positives = 684/906 (75%), Gaps = 67/906 (7%)

Query: 2   SRETYPNLEEVEIPDFQDTSNTVPXXXXXXXXYDQYKNNENNDAFKDNDLESNSVAKPNA 61
           S E   N E+ +I  F+    T          Y + +  EN D F++ D +S  +     
Sbjct: 11  STEVLDNQEDTDIEVFESEYRT----------YRESEAAENRDNFQNGDDQSWKI----- 55

Query: 62  VGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKS 121
             NGK  +  ++     SDV+ YD S+  +EESTV+LKEYYDHSI+S LT+K A DYL S
Sbjct: 56  --NGK--QKYEVTKSEVSDVA-YD-SIPAYEESTVTLKEYYDHSIKSSLTVKSAGDYLYS 109

Query: 122 VFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYS 181
           +FPII WLPHYNF W  ADL+AGIT+GCVLVPQSMSYAQ+A+L  +YGLYSSFIGA+ YS
Sbjct: 110 LFPIIKWLPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYS 169

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGF 241
            FATSKDVCIGPVAVMSLQTAKVIA+V  KYP+G   +TGP+IAT L  LCG++S A+G 
Sbjct: 170 LFATSKDVCIGPVAVMSLQTAKVIAEVLKKYPEGQTEVTGPIIATALCFLCGVVSTALGV 229

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
           LRLGFLVELISLNAVAGFMTGSAF+I+WGQ+PALMGYNSLVNTR ATYKVVI TLKHLP+
Sbjct: 230 LRLGFLVELISLNAVAGFMTGSAFSIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPN 289

Query: 302 TKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVII 361
           TKLDAVFGLIPL +LYVWKWWCGT+G  L DRY    P++   LK  YFYAQA RN V+I
Sbjct: 290 TKLDAVFGLIPLVILYVWKWWCGTFGITLADRYYRNQPKIANRLKSFYFYAQAMRNAVVI 349

Query: 362 VVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLL 421
           +VFT I W ITR KS  ERPISILG+VPSGL EVGV  +P GL+S +   LPASIIVL+L
Sbjct: 350 IVFTAISWRITRNKSSKERPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVL 409

Query: 422 EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPL 481
           EHIAISKSFGRINDYKV+PDQELIAIGV+NL+GTFF++YPATGSFSRSALKAKCNVRTP 
Sbjct: 410 EHIAISKSFGRINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPF 469

Query: 482 SGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICF 541
           SG+F+G+CVLLALYCLT AFF+IPKATLSAVIIHAVSDLL SY+TTW FWK NPLD I F
Sbjct: 470 SGIFTGACVLLALYCLTSAFFFIPKATLSAVIIHAVSDLLTSYKTTWIFWKTNPLDCISF 529

Query: 542 IVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVS 601
           I TV ITVF+SIE+GIYFAMCWSCAMLLLK AFPAGKFLGRVE+AEV +  ++   +AV+
Sbjct: 530 IATVFITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEGINAVT 589

Query: 602 YTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTK 661
            ++E  N +                     SK++++ V          ++  P  K+  K
Sbjct: 590 SSNELPNEL---------------------SKQVKSTVD---------VLPAPEYKFSVK 619

Query: 662 WVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLI 721
           W+PFDH Y+RELN   ++ PPP GV+VYRL++S+TY+NCSRHY+II +++KE TRRGQLI
Sbjct: 620 WIPFDHDYSRELNRYTKVRPPPPGVIVYRLADSFTYVNCSRHYDIIFDRIKEETRRGQLI 679

Query: 722 RHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRE--SDSEFLENAPDNSIGTERDDRPLLKI 779
             RKKSDRPWNDPG W+ P   K L  +K++   +D+E   ++  N+   E  ++PLLK+
Sbjct: 680 SLRKKSDRPWNDPGEWKMPNSFKALFKFKRKSATTDNELPVSSGRNN--QESYEKPLLKV 737

Query: 780 LCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNE 839
           +CLDFSQVAQ D+TA+QSLVDLRK +N+YADRQVEFHF GIISPW+KR L+S  FGT NE
Sbjct: 738 VCLDFSQVAQVDSTAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTTNE 797

Query: 840 EYSDESIVAGHTSYHVARV--------PQSKENSDKYSVY----TASGTNLPFFHIDIPD 887
           EYSD+SI+AGH+S+HVA+V         +    S  YS Y     A+GTNLPFFHIDIPD
Sbjct: 798 EYSDDSIIAGHSSFHVAKVLKDDVDYTEEDSRISTSYSNYETLCAATGTNLPFFHIDIPD 857

Query: 888 FAKWDI 893
           F+KWD+
Sbjct: 858 FSKWDV 863

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 1129 bits (2919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/904 (62%), Positives = 673/904 (74%), Gaps = 62/904 (6%)

Query: 2   SRETYPNLEEVEIPDFQDTSNTVPXXXXXXXXYDQYKNNENNDAFKDNDLESNSVAKPNA 61
           S E   N E+ +I  F+    T          Y + +  EN D   + D E+    K N+
Sbjct: 6   STEYVHNQEDADIEVFESEYRT----------YRESEAAENRDGLHNGDEEN---WKVNS 52

Query: 62  VGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKS 121
                G   +++     SDV LYD S+  +EESTV+LKEYYDHSI+++LT K A  YL S
Sbjct: 53  SKQKFGVTKNEL-----SDV-LYD-SIPAYEESTVTLKEYYDHSIKNNLTAKSAGSYLVS 105

Query: 122 VFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYS 181
           +FPII W PHYNF W  ADL+AGIT+GCVLVPQSMSYAQ+A+L  +YGLYSSFIGA+ YS
Sbjct: 106 LFPIIKWFPHYNFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYS 165

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGF 241
            FATSKDVCIGPVAVMSLQTAKVIA+V  KYP+    +T P+IATTL LLCGI++  +G 
Sbjct: 166 LFATSKDVCIGPVAVMSLQTAKVIAEVLKKYPEDQTEVTAPIIATTLCLLCGIVATGLGI 225

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
           LRLGFLVELISLNAVAGFMTGSAFNI+WGQ+PALMGYNSLVNTR ATYKVVI TLKHLP+
Sbjct: 226 LRLGFLVELISLNAVAGFMTGSAFNIIWGQIPALMGYNSLVNTREATYKVVINTLKHLPN 285

Query: 302 TKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVII 361
           TKLDAVFGLIPL +LYVWKWWCGT+G  L DRY    P++   LK  YFYAQA RN V+I
Sbjct: 286 TKLDAVFGLIPLVILYVWKWWCGTFGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVI 345

Query: 362 VVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLL 421
           VVFT I W+ITR KS  +RPISILG+VPSGL EVGV  +P GL+S +   +PASIIVL+L
Sbjct: 346 VVFTAISWSITRNKSSKDRPISILGTVPSGLNEVGVMKIPDGLLSNMSSEIPASIIVLVL 405

Query: 422 EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPL 481
           EHIAISKSFGRINDYKVVPDQELIAIGV+NL+GTFF++YPATGSFSRSALKAKCNVRTP 
Sbjct: 406 EHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPF 465

Query: 482 SGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICF 541
           SG+F+G CVLLALYCLT AFF+IPKATLSAVIIHAVSDLL SY+TTW FWK NPLD I F
Sbjct: 466 SGVFTGGCVLLALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISF 525

Query: 542 IVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVS 601
           IVTV ITVF+SIE+GIYFAMCWSCAMLLLK AFPAGKFLGRVE+AEV +  ++ + DAV 
Sbjct: 526 IVTVFITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTVQEDIDAVI 585

Query: 602 YTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTK 661
            ++E  N                           E N Q K   S   ++  P  K+  K
Sbjct: 586 SSNELPN---------------------------ELNKQVK---STVEVLPAPEYKFSVK 615

Query: 662 WVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLI 721
           WVPFDH Y+RELN +  + PPP GV+VYRL +S+TY+NCSRHY+II +++KE TRRGQLI
Sbjct: 616 WVPFDHGYSRELNINTTVRPPPPGVIVYRLGDSFTYVNCSRHYDIIFDRIKEETRRGQLI 675

Query: 722 RHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILC 781
             RKKSDRPWNDPG W+ P  LK+L  +K+  + +       + S   E  ++PLLK++C
Sbjct: 676 TLRKKSDRPWNDPGEWKMPDSLKSLFKFKRHSATTNSDLPISNGSSNGETYEKPLLKVVC 735

Query: 782 LDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEY 841
           LDFSQVAQ D+TA+QSLVDLRK +N+YADRQVEFHF GIISPW+KR L+S  FGT NEEY
Sbjct: 736 LDFSQVAQVDSTAVQSLVDLRKAVNRYADRQVEFHFAGIISPWIKRSLLSVKFGTTNEEY 795

Query: 842 SDESIVAGHTSYHVARV--------PQSKENSDKYSVY----TASGTNLPFFHIDIPDFA 889
           SD+SI+AGH+S+HVA+V         +    S  YS Y     A+GTNLPFFHIDIPDF+
Sbjct: 796 SDDSIIAGHSSFHVAKVLKDDVDYTDEDSRISTSYSNYETLCAATGTNLPFFHIDIPDFS 855

Query: 890 KWDI 893
           KWD+
Sbjct: 856 KWDV 859

>TDEL0F03980 Chr6 (737605..740208) [2604 bp, 867 aa] {ON} Anc_8.271
           YLR092W
          Length = 867

 Score = 1127 bits (2916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/878 (63%), Positives = 672/878 (76%), Gaps = 52/878 (5%)

Query: 34  YDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKG---AKGSKIEYFNPSDVSLYDNSVSQ 90
           YD YK NE     +DN++  N     +  GN KG    K +++ Y+          ++  
Sbjct: 24  YDLYKANEQ---LEDNEVTVN--GSEDDYGNKKGIDLVKETEVRYYGSPGPEAIGGNIPG 78

Query: 91  FEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCV 150
           FEESTVS+K+YY+  IR  LTL  A  Y+ S+FPI+ W PHYN  W  ADL+AGIT+GCV
Sbjct: 79  FEESTVSVKDYYNQFIREKLTLNSAGSYVYSLFPIVKWFPHYNLTWGYADLVAGITVGCV 138

Query: 151 LVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTA 210
           LVPQSMSYAQ+A+LP QYGLYSSFIGA+ YS FATSKDVCIGPVAVMSLQTAKVIA V+A
Sbjct: 139 LVPQSMSYAQIASLPPQYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAQVSA 198

Query: 211 KYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWG 270
           KYP+ DP +T PVIAT L+LLCGI++  +G LRLGFLVELISLNAVAGFMTGSAFNILWG
Sbjct: 199 KYPENDPIVTAPVIATALSLLCGIVAIGVGLLRLGFLVELISLNAVAGFMTGSAFNILWG 258

Query: 271 QVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPIL 330
           QVPALMGY+S VNTRA+TYKVVI++LKHLPDTKLDAVFGL+PL LLY+WKWWCGTYGP L
Sbjct: 259 QVPALMGYSSKVNTRASTYKVVIDSLKHLPDTKLDAVFGLVPLCLLYLWKWWCGTYGPKL 318

Query: 331 NDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPS 390
            DR  + +P+  +ILK  YFY+ A RN VII+VFT I W IT+ K K  RPI +LG+VPS
Sbjct: 319 ADRQLAHSPKKQRILKRFYFYSNAMRNAVIIIVFTAISWRITKNKDKEHRPIKVLGTVPS 378

Query: 391 GLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVS 450
           GL++VGV  +P GL++K+ P++PASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIG +
Sbjct: 379 GLEDVGVAKIPEGLLAKMAPDIPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGAT 438

Query: 451 NLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLS 510
           NL+GTFFNAYPATGSFSRSALKAKC VRTP SG+F+G CVL+A+YCLT AFF+IP ATLS
Sbjct: 439 NLIGTFFNAYPATGSFSRSALKAKCEVRTPFSGVFTGCCVLVAIYCLTDAFFFIPSATLS 498

Query: 511 AVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLL 570
           AVIIHAVSDLLASY+TTWNFWKMNPLD   FIVTVLITVF+SIE+GIYFAMCWSCAMLLL
Sbjct: 499 AVIIHAVSDLLASYKTTWNFWKMNPLDCCAFIVTVLITVFSSIENGIYFAMCWSCAMLLL 558

Query: 571 KMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKYITN 630
           K AFPAG+FLGRVE+AEV +  +  + +A+S     N+ I  S                 
Sbjct: 559 KHAFPAGQFLGRVEVAEVINPTVVEDVEAISI----NDQIEGS---------------VG 599

Query: 631 SSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEGVLVYR 690
            SK ++ +    S  S S+       K+H+KWV   + Y RELNPD++ILPPP GV+VYR
Sbjct: 600 KSKSLKADKGAISASSGSN------YKFHSKWVAEQYAYNRELNPDVKILPPPPGVVVYR 653

Query: 691 LSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWE-APAFLKNLKFW 749
           +S+S+TY+NCSRHY+ I + +K+ TRRGQL+  RKKSDRPWNDPG WE +P+  K  K  
Sbjct: 654 MSDSFTYINCSRHYDTIFDHIKKHTRRGQLLHLRKKSDRPWNDPGEWEISPSIKKFFKLG 713

Query: 750 KKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVINQYA 809
           KK ++D E  +   D +I   RD+RPLLKI+CLDFSQV Q D+TA+QSLVDLRK +++YA
Sbjct: 714 KKNQNDIESQDE--DVAIDNTRDERPLLKIICLDFSQVVQVDSTAIQSLVDLRKAVHKYA 771

Query: 810 DRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVARVPQSKENSDKYS 869
           DRQVEFHF GIIS WVKR L+S GFGT+N  YSDESI+AGH+SYH+A+   +K  +D ++
Sbjct: 772 DRQVEFHFTGIISSWVKRSLLSMGFGTVNASYSDESIIAGHSSYHIAKT--TKPLADDFT 829

Query: 870 --------------VYTASGTNLPFFHIDIPDFAKWDI 893
                         +Y A+GTN+PFFH+DIPDF+KWD+
Sbjct: 830 TDSSGSSQLQQSQEIYAATGTNMPFFHLDIPDFSKWDL 867

>Smik_2.435 Chr2 (775289..777880) [2592 bp, 863 aa] {ON} YLR092W
           (REAL)
          Length = 863

 Score = 1115 bits (2884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/833 (64%), Positives = 657/833 (78%), Gaps = 42/833 (5%)

Query: 73  IEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHY 132
           +E  N     ++ +S+  +EE+TV+LK+YYDH+I+ +LTLK A  YL S+FPII WLPHY
Sbjct: 61  LELTNSKVSEVFYDSIPAYEENTVTLKDYYDHTIKDNLTLKSAGSYLYSLFPIIKWLPHY 120

Query: 133 NFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIG 192
           NF W  ADL+AGIT+GCVLVPQSMSYAQ+A+L  +YGLYSSFIGA+ YS FATSKDVCIG
Sbjct: 121 NFTWGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIG 180

Query: 193 PVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELIS 252
           PVAVMSLQTAKVIA+V  KYP+    +TGP+IATTL LLCG+++  +G LRLGFLVELIS
Sbjct: 181 PVAVMSLQTAKVIAEVLKKYPEDQVEVTGPIIATTLCLLCGLVATGLGVLRLGFLVELIS 240

Query: 253 LNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIP 312
           LNAVAGFMTGSAF+I+WGQ+PALMGYN LVNTR ATYKVVI TLKHLP+TKLDAVFGLIP
Sbjct: 241 LNAVAGFMTGSAFSIIWGQIPALMGYNKLVNTREATYKVVINTLKHLPNTKLDAVFGLIP 300

Query: 313 LFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAIT 372
           L +LY+WKWWCG++G  L DR+ S  P+    +K  YFYAQA RN V+I+VFT I + IT
Sbjct: 301 LVILYLWKWWCGSFGIKLVDRHYSNQPKTANRIKSFYFYAQAMRNAVVIIVFTAISFRIT 360

Query: 373 RGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGR 432
           R KSK +RPISILG+VPSGL EVGV  +P GL+S +   LPASIIVL+LEHIAISKSFGR
Sbjct: 361 RNKSKEKRPISILGTVPSGLNEVGVMKIPDGLLSNMSSELPASIIVLVLEHIAISKSFGR 420

Query: 433 INDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLL 492
           INDYKV+PDQELIAIGV+NL+GTFF++YPATGSFSRSALKAKCNVRTP SG+F+G+CVLL
Sbjct: 421 INDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGACVLL 480

Query: 493 ALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFAS 552
           ALYCLT AFFYIPKATLSAVIIHAVSDLLASY+TTWNFWKMNPLD I FIVTVLITVF+S
Sbjct: 481 ALYCLTSAFFYIPKATLSAVIIHAVSDLLASYETTWNFWKMNPLDCISFIVTVLITVFSS 540

Query: 553 IEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRT 612
           IE+GIYFAMCWSCAMLLLK AFPAGKFLGRVE+AEV +  I+ + D++         +  
Sbjct: 541 IENGIYFAMCWSCAMLLLKQAFPAGKFLGRVEVAEVLNPTIQGHIDSI---------VSP 591

Query: 613 SEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRE 672
           +E  +E+            SK+++++V       PSS       K+  KWVPFDH YTRE
Sbjct: 592 NESPNEF------------SKQVKSSVDAL----PSS-----EYKFSVKWVPFDHAYTRE 630

Query: 673 LNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWN 732
           LN   ++ PPP GV+VYR S+S+TY+NCSRHY++I +++KE TRRGQL+  RKKSDRPWN
Sbjct: 631 LNSYTRVRPPPPGVIVYRFSDSFTYVNCSRHYDVIFDRIKEETRRGQLVSLRKKSDRPWN 690

Query: 733 DPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDA 792
           DPG W+ P   KN+   K+  +       A +++  +E  ++PLLK++CLDFSQVAQ D+
Sbjct: 691 DPGEWKLPNSFKNIFRVKRGLATKNSELPAVNDNTNSESYEKPLLKVVCLDFSQVAQVDS 750

Query: 793 TALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTS 852
           TA+QSLVDLRK +N+YADRQVEFHF GIISPW+KR L+S  FGT+NEE+SD SI+ GH+S
Sbjct: 751 TAVQSLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLLSVKFGTINEEFSDTSIITGHSS 810

Query: 853 YHVARV------------PQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           +H+A+V            P S   S+  ++  A+GTNLPFFHIDIPDF+KWD+
Sbjct: 811 FHIAKVLKDEVDYTDEDSPISVTCSNYDTLCAATGTNLPFFHIDIPDFSKWDV 863

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 1113 bits (2879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/831 (65%), Positives = 650/831 (78%), Gaps = 55/831 (6%)

Query: 79  SDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFT 138
           SDVS YD S+ ++EESTV+LKEYY HSI++ LT K A +Y+ S+FPI+ WLPHYNF W  
Sbjct: 59  SDVS-YD-SIPRYEESTVTLKEYYGHSIKNSLTAKSAGNYVSSLFPIVKWLPHYNFTWCY 116

Query: 139 ADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMS 198
           ADL+AGIT+GCVLVPQSMSYAQ+A+L  +YGLYSSF+GA+ YS FATSKDVCIGPVAVMS
Sbjct: 117 ADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFVGAFIYSLFATSKDVCIGPVAVMS 176

Query: 199 LQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAG 258
           LQTAKVIA+V  KYP     +TGP+IAT L LLCGI++ A+G LRLGFLVELISLNAVAG
Sbjct: 177 LQTAKVIAEVLKKYPQDQTEVTGPIIATALCLLCGIVTTALGVLRLGFLVELISLNAVAG 236

Query: 259 FMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYV 318
           FMTGSAF+I+WGQVPALMGYN LVNTR +TYKVVI TLKHLP+TKLDAVFGLIPL +LYV
Sbjct: 237 FMTGSAFSIIWGQVPALMGYNKLVNTRESTYKVVINTLKHLPETKLDAVFGLIPLVILYV 296

Query: 319 WKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKS 378
           WKWWCGTYG  L +R+   +P++   LK  YFYAQA RN V+IVVFT I W+ITR K+  
Sbjct: 297 WKWWCGTYGITLANRHYQNHPKIANNLKSFYFYAQAMRNAVVIVVFTAISWSITRNKASE 356

Query: 379 ERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKV 438
           +RPISILG+VPSGL EVGV  +P GL+S +   LPASIIVL+LEHIAISKSFGRINDYKV
Sbjct: 357 DRPISILGTVPSGLNEVGVMKIPEGLLSNMSSELPASIIVLVLEHIAISKSFGRINDYKV 416

Query: 439 VPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLT 498
           VPDQELIAIGV+NL+GTFF++YPATGSFSRSALKAKCNVRTP SGLF+G CVLLALYCLT
Sbjct: 417 VPDQELIAIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVLLALYCLT 476

Query: 499 GAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIY 558
            AFF+IPKATLSAVIIHAVSDLL SY+TTW FWK NPLD + FIVTV ITVF+SIE+GIY
Sbjct: 477 DAFFFIPKATLSAVIIHAVSDLLTSYETTWTFWKTNPLDCVSFIVTVFITVFSSIENGIY 536

Query: 559 FAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDE 618
           FAMCWSCA+LLLK AFPAG+FLGRVE+AE+ +  ++ N  AV   +E+N  ++T+ +   
Sbjct: 537 FAMCWSCAILLLKQAFPAGRFLGRVEVAEILNPTLQNNVSAVVSLNESNKQVKTTVD--- 593

Query: 619 YEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQ 678
                                          ++     ++ TKWVPFDH+Y+RELN   +
Sbjct: 594 -------------------------------VLRSSEYRFTTKWVPFDHEYSRELNRCAK 622

Query: 679 ILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWE 738
           I PPP GV+VYRLS+S+TY+NCSRHY+II + VKE TRRGQL+  RKKSDRPWNDPG W+
Sbjct: 623 ICPPPPGVIVYRLSDSFTYVNCSRHYDIIFDHVKEETRRGQLVNLRKKSDRPWNDPGEWK 682

Query: 739 APAFLKNLKFWKKRESDSEFLENAPDNSIGTERD--DRPLLKILCLDFSQVAQTDATALQ 796
            P  LK L F  KR+S +E  E +  N   T R   ++PLLK++CLDFSQVAQ D+TA+Q
Sbjct: 683 MPTSLKTL-FRFKRKSVTENEEPSVSNG-STNRGSYEKPLLKVICLDFSQVAQVDSTAIQ 740

Query: 797 SLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVA 856
           SLVDLRK +N+YADRQVEFHF GIISPW+KR L S  FGT+NEEYSDES++AGH+S HV 
Sbjct: 741 SLVDLRKAVNKYADRQVEFHFAGIISPWIKRSLSSVDFGTVNEEYSDESVIAGHSSVHVT 800

Query: 857 RVPQSKENSD----------KYSVY----TASGTNLPFFHIDIPDFAKWDI 893
           +   S +++D           YS Y     A+GTNLPFFHIDIPDF+KWDI
Sbjct: 801 KF-SSDDDADYTDEESHISAPYSNYGTLCAATGTNLPFFHIDIPDFSKWDI 850

>Kpol_543.43 s543 (93697..96297) [2601 bp, 866 aa] {ON}
           (93697..96297) [2601 nt, 867 aa]
          Length = 866

 Score = 1101 bits (2847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/885 (61%), Positives = 664/885 (75%), Gaps = 58/885 (6%)

Query: 34  YDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKGAKGSKIEYFNPSDVSLYDNS------ 87
           Y+QYK  E        D   N     + +GN         ++    D+   D+S      
Sbjct: 15  YNQYKTVEEQGNSDVGDSSGN-----DDLGNAGDGLTKDSKFVFEKDLGYTDDSNELTRE 69

Query: 88  --------VSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTA 139
                   V ++ E TV+LKEYY+HSIR +LT K   +YL S+FPII WLP YN+ W  +
Sbjct: 70  SFLNSSENVPRYIEETVTLKEYYNHSIRHYLTFKSFGNYLISIFPIIKWLPFYNYKWLIS 129

Query: 140 DLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSL 199
           DLIAGITIGCVLVPQSMSYAQ+ATLP QYGLYSSF+GAY+YS FATSKDVCIGPVAVMSL
Sbjct: 130 DLIAGITIGCVLVPQSMSYAQIATLPPQYGLYSSFVGAYTYSLFATSKDVCIGPVAVMSL 189

Query: 200 QTAKVIADVTAKYPDGDPA-ITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAG 258
           QTAKVI  V +   +     IT P+IATTLALLCGIISA +G LRLGFLVELISLNAV G
Sbjct: 190 QTAKVIQHVNSSLTEEQKTYITAPLIATTLALLCGIISAGVGLLRLGFLVELISLNAVTG 249

Query: 259 FMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYV 318
           FMTGSA NI+ GQVPALMGY S VNTR ATYKV+I TLKHLPDTK+DA+FGLIPL +LY 
Sbjct: 250 FMTGSALNIISGQVPALMGYASEVNTREATYKVIINTLKHLPDTKIDAIFGLIPLVILYF 309

Query: 319 WKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKS 378
           WKWW  + GP L DRY   N +  K +K  YFY  A R+G+II+V T I W++TRGKSKS
Sbjct: 310 WKWWFSSMGPKLVDRY-YPNSKYKKYIKAFYFYGNAMRSGIIIIVMTSISWSVTRGKSKS 368

Query: 379 ERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKV 438
           ERPISILG+VPSGL+EVGVF  P+GL++K+ P LP+SIIVLLLEHIAI+KSFGR+NDYKV
Sbjct: 369 ERPISILGTVPSGLQEVGVFTPPNGLLAKVAPELPSSIIVLLLEHIAIAKSFGRVNDYKV 428

Query: 439 VPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLT 498
           VPDQELIAIG+SNL+GTFFN+YP TGSFSRSALKAKCNV+TPLSG+F+GSCVLLALYCLT
Sbjct: 429 VPDQELIAIGISNLIGTFFNSYPVTGSFSRSALKAKCNVKTPLSGIFTGSCVLLALYCLT 488

Query: 499 GAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIY 558
           GAFFYIPKATLSAVIIHAVSDL+ASY+TTW+FWKMNPLDFICFI TV ITVFASIEDGIY
Sbjct: 489 GAFFYIPKATLSAVIIHAVSDLVASYKTTWSFWKMNPLDFICFITTVFITVFASIEDGIY 548

Query: 559 FAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDE 618
           F MCWS A+LL K+AFPAGKFLG V+IAE+ +  I  +SD +   +E             
Sbjct: 549 FTMCWSAAILLFKVAFPAGKFLGYVKIAEIVNPEI-VDSDYLVEKAE------------- 594

Query: 619 YEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQ 678
               +S +Y T     +  N +       SS  ++ ++KYH KW+P+DH YT+E+NP+++
Sbjct: 595 ----TSVQYST-----VLMNPEKGELSYLSSKSSESQLKYHIKWIPYDHAYTKEMNPNVE 645

Query: 679 ILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWE 738
           + PPP+GV+VYRL+ES+TY+NCSR+Y  + +KVKE+TR GQL+ H KKSDRPWNDPG W+
Sbjct: 646 VTPPPDGVIVYRLTESFTYINCSRNYETLYDKVKELTRPGQLMTHIKKSDRPWNDPGDWK 705

Query: 739 APAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSL 798
            P FLKN+  W+K ++     ++ P        D RP+LKI+CLDFSQVAQTD+TALQSL
Sbjct: 706 PPKFLKNIINWRKNKNK----DDEPTTFDNKVVDTRPILKIICLDFSQVAQTDSTALQSL 761

Query: 799 VDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVARV 858
           +DLR+ IN+YADRQVEFHF GI+SPWVK+GLV+ GFGT+N+EYSDESI+ GHTSYHV + 
Sbjct: 762 LDLRRAINKYADRQVEFHFSGILSPWVKKGLVNLGFGTVNKEYSDESIIIGHTSYHVVKT 821

Query: 859 PQSKEN----------SDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
              + N          +  Y ++  +GTN PFFHI+IPDF+KW+I
Sbjct: 822 EDLENNPMTTVEEPNQNSSYYIHAGTGTNFPFFHIEIPDFSKWNI 866

>TPHA0J00800 Chr10 (186144..188897) [2754 bp, 917 aa] {ON} Anc_8.271
           YLR092W
          Length = 917

 Score = 1098 bits (2840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/928 (59%), Positives = 678/928 (73%), Gaps = 67/928 (7%)

Query: 8   NLEEVEIPDFQDTSNTVPXXXXXXXXYDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKG 67
           +L+ +E+  + + SNTV         YDQYK  E  +    N L S+     N   N K 
Sbjct: 15  DLDNIELSSYSN-SNTV-DLEALEEEYDQYKKEEEIEYISGNYLNSSPTQNINVTSNPKY 72

Query: 68  AKGSKIEYFNPS------DVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKS 121
            +  K+++ + S      +    D  +    E+ ++ KEYY+HS++ + T   A++Y  S
Sbjct: 73  EEYKKLKHLDQSYNYVSTEYLDTDYLIPAHNENIITFKEYYNHSLKEYFTFNAAKNYALS 132

Query: 122 VFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYS 181
           +FPII+WLP YNFNWF +DLIAGITIGCVLVPQSMSYAQ+ATL  QYGLYSSFIGA+ Y+
Sbjct: 133 IFPIIHWLPFYNFNWFISDLIAGITIGCVLVPQSMSYAQIATLDPQYGLYSSFIGAFVYA 192

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGF 241
            FATSKDVCIGPVAVMSL+TAKVIADV++ + + DP +TGP+IATTLALLCG I+AA+GF
Sbjct: 193 LFATSKDVCIGPVAVMSLETAKVIADVSSHFQN-DPDVTGPIIATTLALLCGGIAAAVGF 251

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
           LRLGFLVELISLNAV GFMTGSAFNILWGQVP LMGY+ LVNTR ATYKVVI+TLKHLPD
Sbjct: 252 LRLGFLVELISLNAVTGFMTGSAFNILWGQVPGLMGYSKLVNTRQATYKVVIDTLKHLPD 311

Query: 302 TKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVII 361
           TKLDAVFGLIPLF+LYV KWWC  YG  L ++  S N R    LK  YFY  A RN V+I
Sbjct: 312 TKLDAVFGLIPLFILYVVKWWCTNYGLQLAEKQFSSNERYRFYLKKFYFYTNAMRNAVVI 371

Query: 362 VVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLL 421
           ++FT I W+ITR KS SERPI++LG+VPSGLK++GVF   + ++ K+GP LPASIIVLLL
Sbjct: 372 IIFTAISWSITRNKSSSERPITVLGTVPSGLKDIGVFKPQTKIVQKIGPQLPASIIVLLL 431

Query: 422 EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPL 481
           EHIAI+KSFGRINDYK+VPDQELIAIG+SNL+GTFF+AYPATGSFSRSAL AKCNV+TPL
Sbjct: 432 EHIAIAKSFGRINDYKIVPDQELIAIGISNLVGTFFSAYPATGSFSRSALNAKCNVKTPL 491

Query: 482 SGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICF 541
           SG+F+G CVLLALYCLTGAFFYIPKATLSAVIIHAVSDL+ASYQTT +FW MNPLD +CF
Sbjct: 492 SGIFTGGCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLIASYQTTLSFWNMNPLDTLCF 551

Query: 542 IVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVS 601
           +VTVLITVF+SIE+GIYFAMC+SCA+ + + AFPAGKFLGR+EIAEV +A  K +     
Sbjct: 552 LVTVLITVFSSIENGIYFAMCYSCALFIFRSAFPAGKFLGRIEIAEVINATPKDD----- 606

Query: 602 YTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTK 661
           +  +N NG  TSE  +     S  K+          N  T  ++SP          ++TK
Sbjct: 607 FQMDNFNGFETSEYNNFPADQSYGKFDI-------ANKNTHKYNSPHC-----SKNFYTK 654

Query: 662 WVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLI 721
           WVPFDH YT+ELN D++IL PP GV+VYRLS+S+ YLNCSRH++ I ++VK  T+RG+ I
Sbjct: 655 WVPFDHTYTKELNKDVEILEPPPGVIVYRLSDSFIYLNCSRHFDTIFDEVKRKTKRGKFI 714

Query: 722 RHRKKSDRPWNDPGPWEAPAFL------KNLKFWKKRESDSEFLENAPDNSIGT------ 769
            + KKS RPWNDPG WEAP ++      +NL F +K+E++S    N P+    T      
Sbjct: 715 GNIKKSQRPWNDPGEWEAPTWMTKKFSIRNL-FKRKQEAES----NVPNEDASTDLDISN 769

Query: 770 ----ERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWV 825
               + D RP+L+++CLDFSQV+QTD TALQSL DLRK +N YADRQVEFHF GIISPWV
Sbjct: 770 NKDIDMDHRPVLQVICLDFSQVSQTDNTALQSLFDLRKSVNSYADRQVEFHFCGIISPWV 829

Query: 826 KRGLVSRGFGTLNEEYSDESIVAGHTSYHVARVPQSKENS-------------------- 865
           KRGL+  GFGT+NE YSD S + GH SYH+ + P  +  S                    
Sbjct: 830 KRGLIKLGFGTVNEAYSDASTIVGHVSYHIVKNPTFRNKSFSSHTSEDTISDMNIEAKDY 889

Query: 866 DKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           + YS+  ASGTN PFFHIDIP+F+KWD+
Sbjct: 890 NNYSIEAASGTNYPFFHIDIPNFSKWDV 917

>CAGL0L12342g Chr12 (1333884..1336559) [2676 bp, 891 aa] {ON}
           similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092w SEL2 sulfate transporter or uniprot|P38359
           Saccharomyces cerevisiae YBR294w SUL1
          Length = 891

 Score = 1094 bits (2830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/891 (61%), Positives = 673/891 (75%), Gaps = 52/891 (5%)

Query: 44  DAFKDNDLESNSVAKPNAVGNGKGAKGSKIEYFNPSDVSLYDN---SVSQFEESTVSLKE 100
           + FK+N+  SN+ A  +     KG    K    + +D S Y     S+  +EE T++LK+
Sbjct: 12  NQFKNNERPSNTNAGADI---EKGLDTKKYFERSITDNSTYGKKSYSIPSYEEDTITLKD 68

Query: 101 YYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQ 160
           YYD ++R + T     DY++S+FP++NWLP YN  WF +DLIAGIT+G VLVPQSMSYAQ
Sbjct: 69  YYDTNLRDYFTWASVVDYIRSLFPVVNWLPFYNPKWFLSDLIAGITVGTVLVPQSMSYAQ 128

Query: 161 VATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAIT 220
           +ATLP +YGLYSSFIGA  YSFFATSKDVCIGPVAVMSLQTAKVIA V  K+PD DP+IT
Sbjct: 129 IATLPPEYGLYSSFIGALVYSFFATSKDVCIGPVAVMSLQTAKVIARVKEKHPDLDPSIT 188

Query: 221 GPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNS 280
           GP+IAT LA +CGII+  +G LRLGFLVELISLNAVAGFMTGSAFNI+WGQ+P LMGY+ 
Sbjct: 189 GPIIATVLAFICGIIATGVGLLRLGFLVELISLNAVAGFMTGSAFNIIWGQIPGLMGYSK 248

Query: 281 LVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKN-- 338
            VNTR +TY VVI++LKHLPDTKLDA FGLIPLF L+ WKWWC + GP L DRY   N  
Sbjct: 249 KVNTRRSTYHVVIDSLKHLPDTKLDAAFGLIPLFTLFFWKWWCNSMGPKLTDRYFPANSR 308

Query: 339 PRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVF 398
           PR +K  K  YFY QASRNG+II++FT + + IT+G +K +R IS+LG+VP GL+  GV 
Sbjct: 309 PRANKYWKAFYFYLQASRNGIIIILFTAVSYGITKGVAKDKRRISVLGTVPKGLRHTGVM 368

Query: 399 HVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFN 458
            +P G+++ +   +P+SIIVLLLEHIAISKSFGR+NDYK+ P+QE+IAIGVSNLLGTFFN
Sbjct: 369 KLPHGILNNIAAEIPSSIIVLLLEHIAISKSFGRVNDYKINPNQEIIAIGVSNLLGTFFN 428

Query: 459 AYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVS 518
           AYPATGSFSRSALKAKCNV TPLSG+FS +CVLLA+YCLTGAFFYIPKATLSAVIIHAV 
Sbjct: 429 AYPATGSFSRSALKAKCNVMTPLSGIFSAACVLLAIYCLTGAFFYIPKATLSAVIIHAVF 488

Query: 519 DLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGK 578
           DL+ASY TTW+ WKMN  DFI FI TV ITVF+SIE+GIYFA+CWSCA+LL   AFPAGK
Sbjct: 489 DLIASYHTTWSLWKMNVFDFIGFITTVFITVFSSIENGIYFAVCWSCAILLYNNAFPAGK 548

Query: 579 FLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKYITNSS---KKI 635
           FLGR+EIAEV +  I  + D   ++ EN+N     +EG  ++   +   +  SS   KK 
Sbjct: 549 FLGRIEIAEVVNPKIVDDDD---FSFENSNE-SFDDEGIYFDNSVAEDKLGTSSNDLKKF 604

Query: 636 ETNVQTKSFDSPSSLI---TQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEGVLVYRLS 692
              V+T+S +    L+   T   ++Y+TKWVPFDH Y++ELNP ++I PPP GV+VYRLS
Sbjct: 605 NAGVKTRSIN--GELVNGQTSSDIRYYTKWVPFDHAYSKELNPSVRITPPPPGVIVYRLS 662

Query: 693 ESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLK--NLK--- 747
           +SYTY+NCSRHY++I +++K VTRRGQLI+HR K DRPWNDPG WEAP   K  N+K   
Sbjct: 663 DSYTYINCSRHYDLIFDEIKRVTRRGQLIQHRHKWDRPWNDPGEWEAPDLKKFFNVKKFV 722

Query: 748 -FWKKRESDSEFLENAPDNSI----------GTERDDRPLLKILCLDFSQVAQTDATALQ 796
             +K++ +D +  EN  +N I            ++D+RPLL+++CLDFSQVA TDATALQ
Sbjct: 723 SVFKRKVTDVDTFEN--ENEIEHIHDGEHYKKNDKDERPLLRVVCLDFSQVANTDATALQ 780

Query: 797 SLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVA 856
           SL DLRK +N+YADRQVEFHFVGI SPW+KRGL + GFGT NEEYSDESI+AGH+SYH++
Sbjct: 781 SLADLRKAVNKYADRQVEFHFVGIYSPWIKRGLRNLGFGTTNEEYSDESIIAGHSSYHLS 840

Query: 857 RVPQSKEN--------------SDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           R  +S+++                K  V  ASGTNLPFFH+DIPDF+KWDI
Sbjct: 841 RFRESEQDGFNELDSLESQRNIGSKTKVLAASGTNLPFFHVDIPDFSKWDI 891

>KAFR0B02750 Chr2 (562981..565485) [2505 bp, 834 aa] {ON} Anc_8.271
           YLR092W
          Length = 834

 Score = 1092 bits (2825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/888 (61%), Positives = 657/888 (73%), Gaps = 58/888 (6%)

Query: 8   NLEEVEIPDFQDTSNTVPXXXXXXXXYDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKG 67
           N  + E+ DF +  +           ++QYK  E   +    + E +S  +      GK 
Sbjct: 3   NQHDTELTDFSNLDD-------LEQEFNQYKKIELTISSTRQNEEVDSKRQ------GKS 49

Query: 68  AKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIIN 127
            K  K   F+          V  +EE+++++ +YY +S+R + T K   DY+KS+FPI +
Sbjct: 50  DKNVKSSSFDSIFSLTQQQQVPTYEENSITIADYYTYSLRPYFTFKTITDYIKSLFPIFH 109

Query: 128 WLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSK 187
           WLPHYN  WF +DLIAGIT+GCVLVPQSMSYAQ+ATL  Q+GLYSSFIGA+SYS FATSK
Sbjct: 110 WLPHYNLTWFISDLIAGITVGCVLVPQSMSYAQIATLSPQFGLYSSFIGAFSYSLFATSK 169

Query: 188 DVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFL 247
           DVCIGPVAVMSLQTAKVIA V  K P  D  IT   IATTLALLCGII+  +G LRLGFL
Sbjct: 170 DVCIGPVAVMSLQTAKVIARVQDKLP-SDTDITASEIATTLALLCGIIATGVGLLRLGFL 228

Query: 248 VELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAV 307
           VELISLNAVAGFMTGSA NI+ GQVP LMGYNS VNTR +TYKV+I+TLKHLPDTKLDAV
Sbjct: 229 VELISLNAVAGFMTGSALNIISGQVPGLMGYNSEVNTRTSTYKVIIDTLKHLPDTKLDAV 288

Query: 308 FGLIPLFLLYVWKWWCGTYGPILNDRY--NSKNPRLHKILKWTYFYAQASRNGVIIVVFT 365
           FGLIPLFLL+ WKW C   GP LN+R+  N KNPR H+I+K  YFYAQ ++N +II+VFT
Sbjct: 289 FGLIPLFLLFAWKWVCDVLGPRLNERHFGNGKNPRAHRIMKNFYFYAQTTKNAIIIIVFT 348

Query: 366 CIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIA 425
           CI WAITRGK+   RPIS+LGSVP GLK+V  F VPSGLM+KL P LPASIIVLLLEHIA
Sbjct: 349 CISWAITRGKTSETRPISVLGSVPKGLKDVETFTVPSGLMAKLAPELPASIIVLLLEHIA 408

Query: 426 ISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLF 485
           I+KSFGRINDYK+VPDQE++AIG++NLLGTFF+AYPATGSFSRSALKAKCNVRTPLSGLF
Sbjct: 409 IAKSFGRINDYKIVPDQEIVAIGITNLLGTFFHAYPATGSFSRSALKAKCNVRTPLSGLF 468

Query: 486 SGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTV 545
           SG+CVLLALYCLTGAFFYIPKATL AVIIHAVS+L+ASY+ T NFWKMNPLD  CF+VTV
Sbjct: 469 SGACVLLALYCLTGAFFYIPKATLCAVIIHAVSNLIASYKATMNFWKMNPLDCFCFLVTV 528

Query: 546 LITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSE 605
           +ITVFASIEDGIYFAMCWS A+LL K+AFP GKFLG++EI EV D  +  +S  ++ + E
Sbjct: 529 IITVFASIEDGIYFAMCWSVAVLLFKVAFPPGKFLGQIEITEVLDGKLVGDSSVLTSSDE 588

Query: 606 NNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPF 665
           N+  + T++ G   E  S+    TN                           Y+TKWVPF
Sbjct: 589 NSEILPTTKAGYSVEVVSNHNENTN---------------------------YYTKWVPF 621

Query: 666 DHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRK 725
           D  YT+ELNPD  I PPP GV+VYR+++S+TY+NCSRH++I+ +++K  T+RG+L +  +
Sbjct: 622 DFSYTKELNPDAHIKPPPPGVIVYRMADSFTYMNCSRHFDILFDEIKRSTKRGKLTQIMR 681

Query: 726 KSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFS 785
           KSDRPWNDPG WE   F+K    + +RE+  E   +  D  I    DDRP LKI+CLDFS
Sbjct: 682 KSDRPWNDPGKWEPRVFIKK---YLRRENYDEDNVDIEDRVI----DDRPFLKIICLDFS 734

Query: 786 QVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDES 845
           QV+Q DATA+Q L DLRK +N+YADRQVEFHFVGIISPW+K+ L + GFGT+N EYSDES
Sbjct: 735 QVSQIDATAIQCLYDLRKSVNKYADRQVEFHFVGIISPWIKKSLRNFGFGTINNEYSDES 794

Query: 846 IVAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           I+ GH+SYH+ +        D   +  A+GTNLPFFHIDIP+F KWDI
Sbjct: 795 IIMGHSSYHLTK--------DVDGIKAATGTNLPFFHIDIPNFNKWDI 834

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 1036 bits (2679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/872 (61%), Positives = 652/872 (74%), Gaps = 55/872 (6%)

Query: 34  YDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKGAKGSKIEYFNPSDVSLYDNSVSQ--- 90
           YD YKN E N   K + +E+     P    N   AKG K +    + V LY  + S    
Sbjct: 34  YDNYKNAEQNPREKSDVVET---LPPTTHQND--AKGLKND--GQTTVELYGTTSSGGVI 86

Query: 91  --FEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITIG 148
             + E TV+ K+YYD S+ S+++    R+YL S+FP+I W+PHYNF W   D++AG+T+G
Sbjct: 87  PGYHEDTVNFKDYYDQSLSSNISFSSFREYLISLFPVIRWIPHYNFAWMYGDVVAGVTVG 146

Query: 149 CVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADV 208
           CVLVPQSMSYAQ+A+LPAQYGLYSSFIGA+ YSFFATSKDVCIGPVAVMSL+TAKVIA V
Sbjct: 147 CVLVPQSMSYAQIASLPAQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLETAKVIARV 206

Query: 209 TAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNIL 268
           T   PD D  ITGP+IAT L+LLCG I+  IG LRLGFLVELISLNAVAGFMTGSAF+I+
Sbjct: 207 TEHLPD-DTEITGPIIATALSLLCGAITLGIGVLRLGFLVELISLNAVAGFMTGSAFSII 265

Query: 269 WGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGP 328
            GQ+PALMGYN  VNTR  TYKVVI TLKHLPDTKLDAVFGLIPL +LY+WK+ C T GP
Sbjct: 266 TGQLPALMGYNEKVNTRDTTYKVVINTLKHLPDTKLDAVFGLIPLLILYLWKYGCNTIGP 325

Query: 329 -ILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGS 387
             ++ R N  +PR  K  K  +FYAQA RN  +IV+FT I W ITR K K   PIS+L +
Sbjct: 326 NWVDRRMNPHSPRA-KFWKSFFFYAQALRNAFVIVLFTLIAWGITRHKKK--HPISLLNT 382

Query: 388 VPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAI 447
           VPSGLK VGV   P  L + L P LPA+ I+LLLEHIAI+K+FGRINDYKVVPDQELIAI
Sbjct: 383 VPSGLKNVGVMKFPDHLATNLAPELPAAAIILLLEHIAIAKAFGRINDYKVVPDQELIAI 442

Query: 448 GVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKA 507
           GV+NL+GTFFNAYPATGSFSRSALKAKCNVRTPLSG+F+G+CVLLALYCLT AF+YIPKA
Sbjct: 443 GVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVLLALYCLTEAFYYIPKA 502

Query: 508 TLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAM 567
           TLSAVIIHAVSDL+ASY+TTWNFWKMNPLD +CF+VTV IT+F+SIE+GIYFA+CWSCA+
Sbjct: 503 TLSAVIIHAVSDLIASYETTWNFWKMNPLDCLCFLVTVFITIFSSIENGIYFAICWSCAI 562

Query: 568 LLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVS-YTSENNNGIRTSEEGDEYEKDSSTK 626
           LL K+AFP+GKFLGRVE++EV +  ++ +   V  + SEN N                  
Sbjct: 563 LLFKIAFPSGKFLGRVEVSEVINPTVREDLGVVEDFDSENIN------------------ 604

Query: 627 YITNSSKKIETNVQTKSFDSPSSLITQP-RMKYHTKWVPFDHKYTRELNPDIQILPPPEG 685
               SS K +  +   +    SS+ T P R+++HTKW+P ++ Y RE N  I + PPP G
Sbjct: 605 --VASSTKPKLGLSADN----SSISTGPSRVRFHTKWIPLENNYGREYNSGIVVQPPPPG 658

Query: 686 VLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKN 745
           V+VYR SES+TY+NCSR Y+II ++VK +TRRG ++ H KKSDRPWNDPG WE P FLK 
Sbjct: 659 VIVYRPSESWTYINCSRQYDIIFDEVKRLTRRGIVLAHTKKSDRPWNDPGQWEPPLFLKK 718

Query: 746 LKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVI 805
           L    KR      LE      +G  RD+RP+LKIL +D+SQV Q DAT +Q+LVDLRK I
Sbjct: 719 LFKRGKR------LEQELSPELG--RDERPVLKILAMDWSQVTQIDATGVQNLVDLRKAI 770

Query: 806 NQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVARV-PQSKEN 864
           N+YADRQVEFHF GIISPW+KR LV+ GFGT+N+E++DES++ GH+SYH+ +  PQ +EN
Sbjct: 771 NKYADRQVEFHFSGIISPWIKRALVAVGFGTVNDEFADESLILGHSSYHIVKTRPQDEEN 830

Query: 865 ---SDKYSVYTASGTNLPFFHIDIPDFAKWDI 893
                +Y++  ASGTN+PFFH+++PDF+KW +
Sbjct: 831 HIGQGRYNISAASGTNMPFFHVEMPDFSKWSL 862

>ZYRO0C01452g Chr3 complement(103175..105895) [2721 bp, 906 aa] {ON}
           similar to uniprot|P38359 Saccharomyces cerevisiae
           YBR294W SUL1 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|Q12325 Saccharomyces cerevisiae YLR092W SUL2
          Length = 906

 Score = 1028 bits (2657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/889 (58%), Positives = 654/889 (73%), Gaps = 54/889 (6%)

Query: 34  YDQYKNNEN-------NDAFKDNDLESNSVAKPNAVGNGKGAKGSKIEYFNPSDVSLY-- 84
           YDQYK  E+        D   D+DL    V            K +++EY+N ++ +    
Sbjct: 43  YDQYKAAEDRERVVGRGDDEYDDDLRKGKV----------DYKETELEYWNSTNGTTNLL 92

Query: 85  --DNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLI 142
               +V  +EE  V   + + H ++  +TL   + Y +S FPII WLP YN+ W  ADL+
Sbjct: 93  APKATVPSYEEGQVGPFDIFYHDLKDRMTLGAVKHYFESAFPIIKWLPFYNWKWGYADLV 152

Query: 143 AGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTA 202
           AGIT+GCVLVPQSMSYAQ+ATLP QYGLYSSF+GA+ YSFFATSKDVCIGPVAVMSL+TA
Sbjct: 153 AGITVGCVLVPQSMSYAQIATLPPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETA 212

Query: 203 KVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTG 262
           KVI +   K+P  D  +TGP+IAT LALLCGI++   G LRLGFLVELISLNAVAGFMTG
Sbjct: 213 KVIQETLEKFPKEDHEVTGPLIATALALLCGIVAMGAGVLRLGFLVELISLNAVAGFMTG 272

Query: 263 SAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWW 322
           S+ NI+ GQVPALMG+   V+TR +TYK++I +LK+L  T+LDAVFGLIPL LLY WKWW
Sbjct: 273 SSLNIISGQVPALMGFKKYVHTRDSTYKIIINSLKNLKHTQLDAVFGLIPLVLLYTWKWW 332

Query: 323 CGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPI 382
           C +YGP L DR+   NP+   ILK  YFYAQA R+ VII+VFT I + IT+G+ K+ R I
Sbjct: 333 CSSYGPKLADRHFKNNPKKRDILKTFYFYAQAMRSAVIIIVFTAISYGITKGR-KTPR-I 390

Query: 383 SILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQ 442
           S+LG VP GLK+V V  +P GL+SK+G ++P++II+LLLEHI+I+KSFGR+N+YKVVPDQ
Sbjct: 391 SVLGKVPKGLKDVHVMRIPEGLLSKMGSSIPSAIIILLLEHISIAKSFGRVNNYKVVPDQ 450

Query: 443 ELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFF 502
           ELIAIG +NL+GTFFNAYPATGSFSRSALKAKCNVRTPLSG+FSG+CVLLALYCLT  F+
Sbjct: 451 ELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFSGACVLLALYCLTQTFY 510

Query: 503 YIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMC 562
           YIP ATLSAVIIHAVSDL ASY+T+WNF+KMNP DFI FIVTV ITVF+SI+ GIYFAMC
Sbjct: 511 YIPSATLSAVIIHAVSDLCASYKTSWNFYKMNPGDFIAFIVTVFITVFSSIDYGIYFAMC 570

Query: 563 WSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKD 622
           WS AM LLK  F  G+FLGRVE+AEV +A +  N ++VS ++ ++         D ++  
Sbjct: 571 WSAAMFLLKNMFAPGRFLGRVEVAEVVNAQVDPNVESVSESAGSHL--------DGFQAQ 622

Query: 623 SSTKYITNSSKKIE--------TNVQTKSFDSPSSLITQ---PRMKYHTKWVPFDHKYTR 671
           SS   I +SSKK++        +N      D   + I      ++ YHTKW+ +D  Y+R
Sbjct: 623 SS---IESSSKKLDPLDKSAVHSNYLNGGDDGSDNNINNQIGQKLVYHTKWISYDRSYSR 679

Query: 672 ELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPW 731
           E NP++ I PPP GV+VYR  +SYTYLNCSRHY+II ++V+  TRRGQ+I   KK DRPW
Sbjct: 680 EFNPEVPIQPPPPGVIVYRFGDSYTYLNCSRHYDIIYDEVRRTTRRGQMISAVKKVDRPW 739

Query: 732 NDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTE---RDDRPLLKILCLDFSQVA 788
           NDPG WEAP + K L    K+++  E+ E     S   E   +D+RPLLKI+CLDFSQ +
Sbjct: 740 NDPGEWEAPRWFKKLT--SKKKTAEEWAETEAQESKAAEQKLQDNRPLLKIICLDFSQCS 797

Query: 789 QTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVA 848
           QTDATA+Q+L DLRK +N+YADRQVEFH  G+ +PWVKR LV+ GFGT+NEEYSDES++A
Sbjct: 798 QTDATAIQNLTDLRKQVNRYADRQVEFHICGLYAPWVKRALVNFGFGTVNEEYSDESLLA 857

Query: 849 GHTSYHVARVPQSKENS----DKYSVYTASGTNLPFFHIDIPDFAKWDI 893
           GH SYHVAR P S E+      +YSVY ASGTNLPFFH++IPDF+KWD+
Sbjct: 858 GHRSYHVARAPTSLEDGLGSPAQYSVYPASGTNLPFFHVEIPDFSKWDL 906

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score = 1011 bits (2613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/858 (57%), Positives = 639/858 (74%), Gaps = 43/858 (5%)

Query: 44  DAFKDNDLESNSVA-KPNAVGNGKGAKGSKIEYFNPSDVSLYDN-SVSQFEESTVSLKEY 101
           D   D+ +++N+   K +  GNGK A  +  + +N      YD+  V  +EE+ V  K+ 
Sbjct: 69  DRHLDSIIDTNTHGFKKHDNGNGKFADVNIEQIYN------YDSLRVPNYEETVVDAKQL 122

Query: 102 YDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYAQV 161
           YD  +R +LT     +YL S+FP++ W+ HYNFNW   DL+AGIT+GCVLVPQSMSYAQ+
Sbjct: 123 YDEKLRPYLTFSAIVEYLTSLFPLLKWVHHYNFNWLYNDLVAGITVGCVLVPQSMSYAQI 182

Query: 162 ATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITG 221
           ATLPAQYGLYSSF+GA+ YSFFATSKDVCIGPVAVMSL+TAKVIA V  K  + +P IT 
Sbjct: 183 ATLPAQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVLEKVGEDNPEITA 242

Query: 222 PVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSL 281
           P+IATTL+L+CG ++  +G LRLGFLVE ISLNAVAGFMTGSA NI+ GQVP LMGY+  
Sbjct: 243 PIIATTLSLICGGVALGVGLLRLGFLVEFISLNAVAGFMTGSAINIMSGQVPGLMGYSKN 302

Query: 282 VNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSK-NPR 340
           VNTR +TYKV+I TLKHLPDTKLDAVFGLIPLF+LY WK++CGT GP L DRY ++ + +
Sbjct: 303 VNTRDSTYKVIINTLKHLPDTKLDAVFGLIPLFILYSWKYFCGTLGPKLVDRYVARSDVK 362

Query: 341 LHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHV 400
                K+  FY QA RN  +I++FT I W ITR K+K + PIS+LG+VPSGLK VGV  +
Sbjct: 363 RAAAYKYILFYLQALRNAFVIIIFTLISWGITRHKAKEDLPISLLGTVPSGLKNVGVMKL 422

Query: 401 PSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAY 460
           P GL+S L   LP++II+L+LEHIAISK+FGR+N YKVVPDQELIAIGV+NL+ TFFNAY
Sbjct: 423 PDGLVSNLASELPSAIIILVLEHIAISKAFGRVNGYKVVPDQELIAIGVTNLISTFFNAY 482

Query: 461 PATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDL 520
           PATGSFSRSALKAKCNV+TPLSG+F+G+CVLL+LYCLT AF++IPKA LSA+IIHAVSDL
Sbjct: 483 PATGSFSRSALKAKCNVKTPLSGIFTGACVLLSLYCLTDAFYFIPKAALSAIIIHAVSDL 542

Query: 521 LASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFL 580
           +ASY+TTWNFW MNPLDF+CFIVTV+IT+F+SIE+GIYFA+CWSCA+LLLK+ FP G+FL
Sbjct: 543 VASYKTTWNFWLMNPLDFVCFIVTVIITIFSSIENGIYFAVCWSCALLLLKVVFPTGQFL 602

Query: 581 GRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQ 640
           G VEI +V++A +  N D +  +                 +DS  K I ++  K  T V+
Sbjct: 603 GYVEICQVSNAEVDENIDRIVLS-----------------EDSQPKTIEDNVTKNNTAVK 645

Query: 641 TKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNC 700
                + S      +++YHTKW+P ++ Y RELNPD+ +  PP GV+VYR SES+TY+NC
Sbjct: 646 VGVVANES--FGHSQLQYHTKWLPLNNHYQRELNPDVVVQAPPPGVIVYRPSESWTYVNC 703

Query: 701 SRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLE 760
           SR Y+ I ++VKE+TR G+L++H  K D+ WNDPG WE P  +K  K +K        L 
Sbjct: 704 SRQYDTIFDRVKELTRPGKLLKHVSKHDKMWNDPGEWEPPFLVK--KLFK--------LG 753

Query: 761 NAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGI 820
           N  D   G   D+RP+LKIL +D+SQV Q D+T +Q+LVDLRK IN+YA+RQVEFHF GI
Sbjct: 754 NKHDLEGGEVIDERPVLKILAMDWSQVTQIDSTGVQNLVDLRKAINKYANRQVEFHFSGI 813

Query: 821 ISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVARVPQSKENSDK-----YSVYTASG 875
           ISPW+KR L++ GFGT+NEE+SDESI+ GHTSY + +     ++ +       +++TA G
Sbjct: 814 ISPWIKRSLINAGFGTVNEEFSDESIIVGHTSYSLVKNRPDLQDPEAALPEPIALHTALG 873

Query: 876 TNLPFFHIDIPDFAKWDI 893
            NLPFFH+++P+F KW +
Sbjct: 874 VNLPFFHLEMPEFHKWHL 891

>KLTH0G13486g Chr7 complement(1156678..1159386) [2709 bp, 902 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 902

 Score = 1006 bits (2602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/886 (57%), Positives = 648/886 (73%), Gaps = 50/886 (5%)

Query: 34  YDQYKNNENNDAFKDNDLESNSVAKPNA-------VGNGKGAKGSKIEYFNPSDVSLYDN 86
           Y Q+KN E++DA    DL S   A+  A        G+G G+   + +   P+      +
Sbjct: 37  YGQFKNAEHSDATAGRDLTSEYGAQFAAEFGGEPGSGSGSGSGFPEAKPVAPAAPGNVPS 96

Query: 87  SVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGIT 146
           ++ +F E  V++ E+Y  ++RS  TL    +YL+S+ PI+ WLPHYN  W   DL+AGIT
Sbjct: 97  ALYEFHERPVTVGEFYSQNLRSTFTLATFTNYLRSLLPIMRWLPHYNARWLYQDLVAGIT 156

Query: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIA 206
           +GCVLVPQSMSYAQ+ATL  QYGLYSSF+GA+ YSFFATSKDVCIGPVAVMSLQTAK I+
Sbjct: 157 VGCVLVPQSMSYAQIATLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLQTAKAIS 216

Query: 207 DVTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFN 266
            V +  P+ D  IT P+IAT LALLCGIIS  +G LRLGFLVELIS  AVAGFMTGSA N
Sbjct: 217 HVVSSLPE-DTEITSPMIATALALLCGIISLGLGVLRLGFLVELISSTAVAGFMTGSALN 275

Query: 267 ILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTY 326
           I+ GQVPALMGYN LVNTR +TYKV+I +L+HLPDTKLDAVFGL+PL +LYVWKW C T 
Sbjct: 276 IIAGQVPALMGYNKLVNTRTSTYKVIINSLRHLPDTKLDAVFGLVPLVILYVWKWGCSTG 335

Query: 327 GPILNDRYNSKNPRLHKILKW--TYFYAQASRNGVIIVVFTCIGWAITRG--KSKSERPI 382
           GP L  RY S+  R+     W   + Y QA RN V+IVVFT I W ++    K      I
Sbjct: 336 GPRLVQRYGSRRSRM-----WDNVFLYTQALRNAVVIVVFTAIAWGMSHRALKEGGSARI 390

Query: 383 SILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQ 442
           S+LG+VPSGLK+VGV  VPSGL+SK+ P LPAS+IVL+LEHIAISK+FGR+NDY+VVPDQ
Sbjct: 391 SLLGTVPSGLKDVGVMKVPSGLLSKIAPELPASVIVLVLEHIAISKAFGRVNDYRVVPDQ 450

Query: 443 ELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFF 502
           ELIAIG +NL+GTFFNAYPATGSFSRSALKAKCNV TPLSGLFSG+CVLLA+YCLT AF 
Sbjct: 451 ELIAIGATNLIGTFFNAYPATGSFSRSALKAKCNVSTPLSGLFSGACVLLAIYCLTSAFK 510

Query: 503 YIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMC 562
           +IPKATLSAVIIHAVSDL+ASY+TTW+FW+++P D +CF+VTV+ITVF+SIE+GIYFAMC
Sbjct: 511 FIPKATLSAVIIHAVSDLIASYKTTWSFWRLSPPDLVCFLVTVVITVFSSIENGIYFAMC 570

Query: 563 WSCAMLLLKMAFPAGKFLGRVEIAE--VTDAYIKANSDAVSYTSENNNGIRTSEEGDEYE 620
           WS A+LL + AFPAGKFLGRV+IAE  VT++   A    V  +S N+ G   +    E E
Sbjct: 571 WSVAVLLFRTAFPAGKFLGRVQIAEARVTNSGAGA---GVGMSSGNSAGTAVNR---EKE 624

Query: 621 KDSSTKYITNSSKKIETNVQTKSFDSPSSLITQ-------------PRM-KYHTKWVPFD 666
           ++++   ++ SS+ +      K+  + S+   +             PR  ++HTKWVPFD
Sbjct: 625 RETTFTAVSVSSESLSHTAPGKAKAANSAGTDKLGKVEGHVTDGGSPRAPRFHTKWVPFD 684

Query: 667 HKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKK 726
            +YTRELNP++ + PPP GV+V+R SES+TY+NCSR Y+ I ++V  +TRRG+     K 
Sbjct: 685 -RYTRELNPEVFVAPPPPGVIVFRPSESWTYVNCSRQYDAIFDEVVRLTRRGRPQIVAKS 743

Query: 727 SDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQ 786
           S RPWNDPG W  P FL+ L      +S SE LEN         RD+RP+L+++ +D+SQ
Sbjct: 744 SSRPWNDPGEWHPPKFLRKL-----FKSSSEDLENR-----AVARDERPVLRVIAMDWSQ 793

Query: 787 VAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESI 846
           VAQ D+T LQ+L DLRK +N+YADRQVEFHF GII PWVKRGL++ GFGT+N+E++DES+
Sbjct: 794 VAQVDSTGLQTLQDLRKAVNKYADRQVEFHFAGIIEPWVKRGLINSGFGTVNDEFADESL 853

Query: 847 VAGHTSYHVARVPQSKENSDKYSVYTASGTNLPFFHIDIPDFAKWD 892
           + GH S H+AR  +  E+ +    + A+GTNLPFFH+++PDF++WD
Sbjct: 854 LVGHKSCHIARSAEPTEDEESRLAHPATGTNLPFFHLELPDFSEWD 899

>TPHA0A01760 Chr1 complement(356771..359452) [2682 bp, 893 aa] {ON}
           Anc_8.271 YLR092W
          Length = 893

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/843 (59%), Positives = 619/843 (73%), Gaps = 48/843 (5%)

Query: 87  SVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGIT 146
           S+  + E  V++K++Y   I  + ++     YL S+FP++ WLPHYN +W   DLIAGIT
Sbjct: 63  SIPMYNEKPVTIKDFYYEKINDYFSIGEIVQYLTSLFPLLKWLPHYNLDWLIQDLIAGIT 122

Query: 147 IGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIA 206
           +GCVLVPQSMSYAQ+ATL  QYGLYSSFIGA+ YSFFATSKDVCIGPVAVMSLQTAKVI 
Sbjct: 123 VGCVLVPQSMSYAQIATLAPQYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSLQTAKVIE 182

Query: 207 DVTAKYPDGDPAI-TGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAF 265
            VT+     +  I T P+IAT LALLCGIIS  IGFLRLGFL+E ISLNAVAGFMTGSAF
Sbjct: 183 RVTSGLTADEQTIYTAPIIATALALLCGIISTGIGFLRLGFLIEFISLNAVAGFMTGSAF 242

Query: 266 NILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGT 325
           NI+ GQVPALMGYN  VNTRA+TY+VVI TLKHLPDTKLDAVFGLIPL +LY+ KW+  +
Sbjct: 243 NIICGQVPALMGYNKKVNTRASTYEVVINTLKHLPDTKLDAVFGLIPLSILYLCKWFFSS 302

Query: 326 YGP-ILNDRYNSKN--PRLHKILKWT---YFYAQASRNGVIIVVFTCIGWAITRGKSKSE 379
            GP  LN   N +N   R  KI+K+    +FY+ A RNGV+I+VFT I WAITRGKS + 
Sbjct: 303 LGPQYLNKLSNRRNLTERQRKIIKYLGNYFFYSNAMRNGVVIIVFTAISWAITRGKSSTS 362

Query: 380 RPISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVV 439
            PISILG+VP GLKEV VF VP GL  KL P+LP+SII+LLLEHIAISKSFGR+NDYK+V
Sbjct: 363 VPISILGTVPKGLKEVAVFKVPGGLFEKLAPDLPSSIIILLLEHIAISKSFGRVNDYKIV 422

Query: 440 PDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTG 499
           PDQELIAIGV+NL+GTFF AYPATGSFSRSALKAKC+V+TPLSGLFSG+CVLLALYCLTG
Sbjct: 423 PDQELIAIGVTNLIGTFFMAYPATGSFSRSALKAKCDVKTPLSGLFSGACVLLALYCLTG 482

Query: 500 AFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYF 559
           AF+YIPKATLSAVIIHAVSDLLASY+TT NF+KMNPLDF+CFI TV ITVF+SIE GIYF
Sbjct: 483 AFYYIPKATLSAVIIHAVSDLLASYKTTLNFYKMNPLDFVCFITTVFITVFSSIEYGIYF 542

Query: 560 AMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIKAN------SDAVSYTSENN---NGI 610
           A+C+SCA L+ K  FP G FLG ++IAEV +  +  N       D+ S   E N   + +
Sbjct: 543 AICFSCAQLIFKNMFPVGSFLGYIKIAEVLNPTLSTNDYTILLDDSSSVLGEENTKDDSV 602

Query: 611 RTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYT 670
           +   + +E  K S  +Y    S ++ +N +T +            + Y+ +WVP  + Y 
Sbjct: 603 KNRLDQNENPKSSEKEYSEFKSYEMSSNSKTTN------------LSYYVRWVPMKNDYH 650

Query: 671 RELNPDIQILPPPEGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRP 730
           RE+NP I+I PPP G++VYR  +S+TYLNCSRHY+II ++VK+ TR+G    +++K DRP
Sbjct: 651 REVNPLIKITPPPPGIIVYRFGDSFTYLNCSRHYDIIYDEVKKNTRKGISNVYKRKQDRP 710

Query: 731 WNDPGPWEAPAFLKNLKFWKKR------ESDSEFLENAPDNSIGTERDDRPLLKILCLDF 784
           WND G WE P  LKNL    K+      + D +  E    NS     D++P LKI+C DF
Sbjct: 711 WNDVGEWECPKSLKNLFNKFKKKTDIGGDEDKDGNEAIESNSKANNTDNKPELKIICFDF 770

Query: 785 SQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDE 844
           SQV QTDATA+QSL DLRK +N+Y+++Q+E+HF GIIS WVK+ L+  GFGT+N+ YSD+
Sbjct: 771 SQVVQTDATAIQSLNDLRKAVNRYSNKQIEYHFSGIISAWVKKSLIEMGFGTVNDNYSDK 830

Query: 845 SIVAGHTSYHVARVPQSKENSDK--------------YSVYTASGTNLPFFHIDIPDFAK 890
           SI+ GH SYHV+++   ++  +               Y + T +GTN PFFHIDIPDF+ 
Sbjct: 831 SIIIGHQSYHVSKINNQEDGLENQINEKYLQPDGSYIYHIQTVTGTNYPFFHIDIPDFSN 890

Query: 891 WDI 893
           W++
Sbjct: 891 WEL 893

>Kwal_56.23759 s56 complement(693180..695765) [2586 bp, 861 aa] {ON}
           YBR294W (SUL1) - Probable sulfate transport protein
           [contig 173] FULL
          Length = 861

 Score =  982 bits (2538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 498/869 (57%), Positives = 627/869 (72%), Gaps = 39/869 (4%)

Query: 34  YDQYKNNENND---AFKDNDLESNSVAKPNAVG---NGKGAKGSKIEYFNPSDVSLYDNS 87
           Y  +KN E+++       N   +  V     +G   NG  +  +         ++LYD+ 
Sbjct: 19  YGHFKNTEHSEIGGGPSSNPGAAVGVGASTKLGQDQNGDKSGATGGGNGANEPLALYDSP 78

Query: 88  VSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITI 147
            + +E+  V+ +EYYD +IR  LT    R YL+ + P+INWLPHYN  WF  D++AGIT+
Sbjct: 79  EAYYEDK-VTFREYYDTTIRPSLTASNVRQYLRDLLPVINWLPHYNGRWFYQDMVAGITV 137

Query: 148 GCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIAD 207
           GCVLVPQSMSYA +ATLP Q+GLYSSF+GA  YSFFATSKDVCIGPVAVMSLQTAK ++ 
Sbjct: 138 GCVLVPQSMSYAVIATLPPQFGLYSSFVGAMIYSFFATSKDVCIGPVAVMSLQTAKAVSK 197

Query: 208 VTAKYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNI 267
           V A+ P  D  IT PV+AT LA LCG+IS  +G LRLGFLVELIS  AVAGFMTGSA NI
Sbjct: 198 VMAELP-ADTDITAPVVATALAFLCGLISLGLGVLRLGFLVELISSTAVAGFMTGSALNI 256

Query: 268 LWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYG 327
           + GQ+PALMGYN LVNTR +TYKV+IETLKHLPDTKLDAVFGLIPL +LY WKW C + G
Sbjct: 257 ISGQLPALMGYNKLVNTRTSTYKVIIETLKHLPDTKLDAVFGLIPLVMLYTWKWLCNSGG 316

Query: 328 PILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGS 387
           P L +RY  +  R  +I   T FY QA RN VII+VFT I W+I+  K K+  PIS+LG 
Sbjct: 317 PRLVERYTVRGSRKQRIWSATLFYTQALRNAVIIIVFTAIAWSISHHKKKA--PISLLGP 374

Query: 388 VPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAI 447
           VPSGLK+VGV  +P GL +K+ P LPAS+IVLLLEHIAI+K+FGR+NDY+VVPDQELIAI
Sbjct: 375 VPSGLKDVGVMKLPDGLAAKIAPELPASVIVLLLEHIAIAKAFGRVNDYRVVPDQELIAI 434

Query: 448 GVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKA 507
           G +NLLGTFFNAYPATGSFSRSALKAKCNV TPLSG+FSG+CVLLA+YCLT AF YIPKA
Sbjct: 435 GATNLLGTFFNAYPATGSFSRSALKAKCNVSTPLSGVFSGACVLLAIYCLTSAFQYIPKA 494

Query: 508 TLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAM 567
           TLSAVIIHAVSDL+ASY+TTW+ W++NPLD +CF+ TV I VF+SIE+GIYFAMCWS A+
Sbjct: 495 TLSAVIIHAVSDLIASYKTTWSIWRLNPLDLVCFLATVFIAVFSSIENGIYFAMCWSVAV 554

Query: 568 LLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKY 627
           LL K+AFP  +FLGRVEIAE+      A ++ VS  SE       +    ++EK     Y
Sbjct: 555 LLFKVAFPRAQFLGRVEIAEL------ATNEGVSAGSE------FAPLSKDFEKGKGVSY 602

Query: 628 ITNSSKKIETNVQTKSFDSPSSLI----TQPRMKYHTKWVPFDHKYTRELNPDIQILPPP 683
            + S      N + +  +  S  +          +HTKWVPF+  YTRELNP + +  PP
Sbjct: 603 ASGSVSSESFNAKKQGIEGGSQFVGGASNAAGAGFHTKWVPFE-PYTRELNPQVPVAQPP 661

Query: 684 EGVLVYRLSESYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFL 743
            GV+V+R SES+TY+NC+R YN I ++V   TRRG+ ++   KS RPWNDPG W  P FL
Sbjct: 662 PGVIVFRPSESWTYVNCARQYNAIFDEVVRTTRRGK-VQVTSKSGRPWNDPGEWHPPKFL 720

Query: 744 KNLKFWKKRESDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRK 803
           +  K++ K+ S+S  LE       G   DDRP+L+++ +D+SQVAQ D+T LQ+L DLRK
Sbjct: 721 R--KWFGKKYSES--LEQ------GVVSDDRPVLRVIAMDWSQVAQVDSTGLQTLHDLRK 770

Query: 804 VINQYADRQVEFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVARVPQSKE 863
            +++YADRQVEFHF GIISPW+KRGL++ GFGT+NEE++DES++ GH +Y VAR   +  
Sbjct: 771 AVSKYADRQVEFHFSGIISPWIKRGLLNTGFGTVNEEHADESLLVGHKTYQVAR-GGATG 829

Query: 864 NSDKYSVYTASGTNLPFFHIDIPDFAKWD 892
           + +      A+G N+PFFH ++PDF+KWD
Sbjct: 830 DEEALLPQPATGVNMPFFHAEMPDFSKWD 858

>AGR077C Chr7 complement(874110..876656) [2547 bp, 848 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR092W
           (SUL2)
          Length = 848

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/859 (54%), Positives = 597/859 (69%), Gaps = 53/859 (6%)

Query: 34  YDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEE 93
           YDQ K  E + A          +      G+GK A     +Y   +  S    +V ++EE
Sbjct: 38  YDQLKAGEVHSA---QGATHGDIGSRQYSGSGKPAA----QYLGLNVNS--REAVPEYEE 88

Query: 94  STVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVP 153
           + VS+K+YY++ +R  ++L  ARDY  SVFP+  W+ HYN  W  AD++AGIT+GCVLVP
Sbjct: 89  TVVSVKDYYNYKLRGFISLNTARDYALSVFPLHRWIHHYNVAWMYADMVAGITVGCVLVP 148

Query: 154 QSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYP 213
           QSMSYAQ+A+L  QYGLYSSF+GA+ YSFFATSKDVCIGPVAVMSL+TAKVIA VT   P
Sbjct: 149 QSMSYAQLASLSPQYGLYSSFVGAFIYSFFATSKDVCIGPVAVMSLETAKVIARVTENLP 208

Query: 214 DGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVP 273
           + D  ITGP+IAT L LLCG I+  IG LRLGFLVE IS+ AV GFMTGSA +I+ GQVP
Sbjct: 209 E-DTNITGPIIATALTLLCGAIAMVIGILRLGFLVEFISITAVTGFMTGSALSIISGQVP 267

Query: 274 ALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDR 333
           +LMGY+  VNTRA TYKV+IE+LKHL DT ++A FGL+PL LL++WKW CG+ GP L DR
Sbjct: 268 SLMGYSKKVNTRATTYKVIIESLKHLKDTNMNAAFGLVPLVLLFLWKWICGSLGPRLVDR 327

Query: 334 YNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSGLK 393
           Y    P         +FY QA RN VIIVVFT I W I+R K + + PIS+LG VPSGLK
Sbjct: 328 YLQFKPSRASRWNAAFFYLQALRNAVIIVVFTAISWGISRHKLE-KPPISLLGKVPSGLK 386

Query: 394 EVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLL 453
            VG   +P GL+ KL P LPA+ I+LLLEHIAI+KSFGRIN+YKVVPDQELIAIGV+NL 
Sbjct: 387 NVGPLELPEGLVEKLLPELPAATIILLLEHIAIAKSFGRINNYKVVPDQELIAIGVTNLF 446

Query: 454 GTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVI 513
            TFFNAYPATGSFSRSALKAKCNV+TPLSGLF+G+CVLLALYCLT AF++IPKATLSAVI
Sbjct: 447 ATFFNAYPATGSFSRSALKAKCNVKTPLSGLFTGACVLLALYCLTEAFYFIPKATLSAVI 506

Query: 514 IHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMA 573
           IHAV+DL+ASY+ TW FW+ NPLDF  FIVTV+ITVF+SIE GIYF++ WSCA+LL K+A
Sbjct: 507 IHAVADLIASYKVTWMFWRTNPLDFFAFIVTVIITVFSSIEHGIYFSISWSCAVLLCKVA 566

Query: 574 FPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKYITNSSK 633
           FP GKFLG +++AEV +      +   S  SE                 +    I NS+ 
Sbjct: 567 FPDGKFLGYIDVAEVIEP-----AGPPSINSE-----------------ADLASIDNSAT 604

Query: 634 KIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEGVLVYRLSE 693
             + +      ++  S++  P  ++H +W+P DH Y+RELNP+  + PPP GV+VYR ++
Sbjct: 605 FQQIDKDGGKLNTVESVLPDPHTRFHRRWIPLDHAYSRELNPEAVVNPPPPGVIVYRPTD 664

Query: 694 SYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRE 753
           S+TYLNCSRH++II + VKE TR GQL+ H    +R W DPGPW  P   +  +F   + 
Sbjct: 665 SWTYLNCSRHFDIILDHVKEHTRPGQLVNHLSNKERLWCDPGPWRPPRIFR--RFIADKR 722

Query: 754 SDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVINQYADRQV 813
           + S               D RP+L++L +D+SQV+Q D+T +Q+LVDLR  +N+YADR V
Sbjct: 723 TGSAV------------ADARPVLRVLAMDWSQVSQVDSTGIQNLVDLRNALNKYADRPV 770

Query: 814 EFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVARVPQSKEN-SDKYSVYT 872
           EFHF GI+SPW+KR LV+ GFG      +D  +++   SYH+ R+P    +    +SV  
Sbjct: 771 EFHFAGIVSPWIKRALVNTGFGI-----ADPPLISSRVSYHLVRLPADPPHIVHGHSVVF 825

Query: 873 ASGTNLPFFHIDIPDFAKW 891
           A GTN PFFH+D+PDF  W
Sbjct: 826 ALGTNTPFFHLDMPDFETW 844

>Ecym_4299 Chr4 complement(639078..641702) [2625 bp, 874 aa] {ON}
           similar to Ashbya gossypii AGR077C
          Length = 874

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/866 (52%), Positives = 607/866 (70%), Gaps = 44/866 (5%)

Query: 34  YDQYKNNENNDAFKDNDLESNSVAKPNAVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEE 93
           Y ++K NE++  +   + E + + K ++VG       S +++      +L D     + E
Sbjct: 47  YTRFKTNEDSAGYSGAENERSRIDKFDSVG-------SSLQFAKYDGNALPDFKAPPYYE 99

Query: 94  STVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVP 153
           +TV+  EYYD +IRS +     R Y  S+FPII W+ HYNF W  +D IAGIT+GCVLVP
Sbjct: 100 TTVTFMEYYDRTIRSRVGRSFFRSYFLSLFPIIKWIHHYNFAWMYSDFIAGITVGCVLVP 159

Query: 154 QSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYP 213
           QSMSYAQ+A L  +YGLYSSFIGA+ YSFFATSKDVCIGPVAVMS+Q +KVI+ V  + P
Sbjct: 160 QSMSYAQLAGLKPEYGLYSSFIGAFIYSFFATSKDVCIGPVAVMSVQVSKVISHVIDQLP 219

Query: 214 DGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVP 273
           +G P IT P++A+ LAL   I+   IG LRLGF++ELIS+ AVAGFMTGSA +IL  Q+P
Sbjct: 220 EGTP-ITAPMVASALALFSSILVIPIGLLRLGFILELISVTAVAGFMTGSALSILASQLP 278

Query: 274 ALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDR 333
           +L+G    +NTR  TY+V+I TLKHL  + ++A FGLI L LL+ WKW CG  GP L  +
Sbjct: 279 SLLGIQK-INTRVETYRVLISTLKHLNGSDINAAFGLICLALLFFWKWTCGYLGPKLISK 337

Query: 334 YNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSGLK 393
           Y   N +  +I +  +FYAQA RN  ++ + T + W +  G+ K +  IS+LG+VPSGLK
Sbjct: 338 YLRPNSKKARIWQSFFFYAQALRNAFVLFLATFVSWLVI-GRHKKKTSISVLGTVPSGLK 396

Query: 394 EVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLL 453
            VGV  +PSGL+ KL P LP ++I+LLLEHI I+KSFGRIN+YK+VPDQELIAIGV+NL+
Sbjct: 397 HVGVPTIPSGLVHKLMPQLPPAVIILLLEHITIAKSFGRINNYKIVPDQELIAIGVTNLI 456

Query: 454 GTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVI 513
           G+FFNAYPATGSFSRSALKAKCNV+TPLSGLFSG+CVLLALY LT AF+YIPKA LSAVI
Sbjct: 457 GSFFNAYPATGSFSRSALKAKCNVKTPLSGLFSGACVLLALYYLTSAFYYIPKAALSAVI 516

Query: 514 IHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMA 573
           IHAV DL+ASY+ ++  W  NP D I F+ T+L+T+F+SIE+GIYFA+ +S A LL+K A
Sbjct: 517 IHAVVDLIASYKLSFYLWNTNPFDLISFLATILLTIFSSIENGIYFAVAFSMATLLMKNA 576

Query: 574 FPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKYITNSSK 633
           FP+GKFLG V+I EV++  +  + D++     NN+     E   E  KDS  K   +   
Sbjct: 577 FPSGKFLGYVKITEVSNLNVFEDLDSIG----NND----PELPQEISKDS--KLAKDPDV 626

Query: 634 KIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEGVLVYRLSE 693
               N+     D          +++HTKWVP D+ Y+RELNP+I +  PP GV+VYR +E
Sbjct: 627 HASANLMASKLD----------VRFHTKWVPLDNGYSRELNPEIAVHMPPPGVIVYRPTE 676

Query: 694 SYTYLNCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRE 753
           S+ YLNCSR ++II ++VK +TR G+L+ H +KS++ W +PG W  P FL+  KF+KK  
Sbjct: 677 SWHYLNCSRQFDIIVDRVKTLTRPGKLVNHLRKSEQLWCEPGDWVPPLFLR--KFFKK-- 732

Query: 754 SDSEFLENAPDNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVINQYADRQV 813
               +   A    +  + D+RP+LKIL +D++QV   D+T++QSL+DLRK IN+YADRQV
Sbjct: 733 ----YRHKAAKPEVVEQVDNRPVLKILAMDWTQVTHVDSTSIQSLIDLRKTINRYADRQV 788

Query: 814 EFHFVGIISPWVKRGLVSRGFGTLNEEYSDESIVAGHTSYHVARV-----PQSKENSD-K 867
            FHF GI+SPW+KR LV  GFGT+NE YS++ ++  +++YHV +       ++++NS+  
Sbjct: 789 GFHFSGIVSPWIKRALVHAGFGTINENYSNDPLLLKYSTYHVVQNVLSADEENQQNSEIS 848

Query: 868 YSVYTASGTNLPFFHIDIPDFAKWDI 893
            S+  ASGTN PFFHID+PDF KWDI
Sbjct: 849 ASLDVASGTNFPFFHIDMPDFTKWDI 874

>TBLA0F03050 Chr6 complement(738517..741210) [2694 bp, 897 aa] {ON}
           Anc_8.271 YLR092W
          Length = 897

 Score =  523 bits (1347), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 264/521 (50%), Positives = 358/521 (68%), Gaps = 24/521 (4%)

Query: 91  FEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCV 150
           + E  V+L E ++H +    T +  + YL S+ PI  W+ HYN  WF +D+IAGIT+GCV
Sbjct: 3   YREKQVTLIETFNHRVPRAFTWQSIKTYLLSLLPITKWIAHYNLQWFISDVIAGITVGCV 62

Query: 151 LVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTA 210
           LVPQSMSYAQ+ATL  QYGLYSS +G + Y+ FATSKD+CIGPVA+MSLQTAK IA V  
Sbjct: 63  LVPQSMSYAQIATLDPQYGLYSSIMGCFIYTVFATSKDICIGPVAIMSLQTAKAIAHVHQ 122

Query: 211 KYPDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWG 270
           K+PD    I   +IA+T+A++CG I+  IG LRLGF ++LI + AV GF +GSAFNILWG
Sbjct: 123 KHPD----IPAHIIASTIAVICGAITMGIGVLRLGFFIDLIPVTAVFGFTSGSAFNILWG 178

Query: 271 QVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPIL 330
           Q+P LMGY+  VNTR  TYKVV++TLK LP T ++AV GLIPLF L+VWK+ C       
Sbjct: 179 QIPGLMGYSKDVNTRQDTYKVVVDTLKKLPKTNINAVMGLIPLFCLFVWKYGCD------ 232

Query: 331 NDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPS 390
              Y  +   L    K   FY  + R  ++I++ +   +     K+ S   + +LG +P 
Sbjct: 233 ---YALRRGNLKPWPKRIVFYLLSLRVTIVIIICSAAAYG---AKNPS---LKVLGKIPK 283

Query: 391 GLKEVG---VFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAI 447
           G        +  +PS L+S +   +PAS+IVL+LEH++I+KSF R+N+Y+V  DQEL AI
Sbjct: 284 GFAAASDNRLKSIPSDLVSDIWSEIPASVIVLVLEHVSIAKSFARVNNYRVSADQELTAI 343

Query: 448 GVSNLLGTF-FNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPK 506
           GVSN++G     AYP TGSFSR+ALKA+C VRTPL  +FSG CV++A+  LT A  +IPK
Sbjct: 344 GVSNVMGACCLGAYPVTGSFSRTALKARCEVRTPLGSIFSGLCVVVAITSLTSALAWIPK 403

Query: 507 ATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCA 566
           ATLSAVIIHAVS L++SY+ T   +KM PLD + F+VT+ ITVF+ IE G+YFA+CW+C 
Sbjct: 404 ATLSAVIIHAVSGLISSYKVTIRLYKMGPLDCLGFLVTIFITVFSEIEIGVYFAVCWACF 463

Query: 567 MLLLKMAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENN 607
           +L++++AFP G FLG V + E++ + I    + + Y S N+
Sbjct: 464 LLMIRIAFPYGAFLGYVRVREISRSSITM-IEPMDYESGND 503

 Score =  192 bits (488), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 103/242 (42%), Positives = 144/242 (59%), Gaps = 40/242 (16%)

Query: 645 DSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEGVLVYRLSESYTYLNCSRHY 704
           D+P+ +I          W+P+ H++TRELNP ++I PPP GV+VYR S+S TY+NCSR+Y
Sbjct: 681 DTPTEII----------WIPYSHRFTRELNPHVKIHPPPPGVVVYRFSDSLTYINCSRNY 730

Query: 705 NIITEKVKEVTRRGQL-IRHRKKSDRPWNDPGPWEAPAFLKNLKFWKKRESDSEFLENAP 763
           + I + +K+ T+ G++ +       +PWN+PGPWE P     LKFW+   +D E      
Sbjct: 731 DNIIDYIKDNTKPGEIDVLSDALYVKPWNNPGPWEKP----KLKFWE--HADPEIARKK- 783

Query: 764 DNSIGTERDDRPLLKILCLDFSQVAQTDATALQSLVDLRKVINQYADRQVEFHFVGIISP 823
                   D RP L+ILCLDFSQVAQ D+TALQ+L+DLR  +N Y    VE+HF GIISP
Sbjct: 784 -----RMADKRPTLRILCLDFSQVAQIDSTALQALIDLRHEVNAYTCSLVEWHFCGIISP 838

Query: 824 WVKRGLVSRGFGTLNEEY----SDESIVAGHTSYHVARVPQSKENSDKYSVYTASGTNLP 879
           WV+R L+  GFG +N+E+    +D S V   +               +Y+   A G N+P
Sbjct: 839 WVRRNLIEIGFGKINKEFFPKVNDSSTVEVISDL-------------EYNGELALGENVP 885

Query: 880 FF 881
           FF
Sbjct: 886 FF 887

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score =  136 bits (342), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 167/685 (24%), Positives = 285/685 (41%), Gaps = 79/685 (11%)

Query: 117 DYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFI 175
           D L    P + W+P+YN+  F  D IAG+++    +P  +S+A  +A +    GLYS  +
Sbjct: 66  DVLPYYLPCLIWIPNYNWKKFGCDFIAGLSLASFQIPLGLSFATSLAHVEPLCGLYSLAV 125

Query: 176 GAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGII 235
             + Y+ F +   + +GP + +SL   + +  +T+     D ++    IAT ++ + G+ 
Sbjct: 126 TPFIYALFGSVPHMIVGPESAISLVVGQAVETLTSH----DLSLETVDIATMISFMSGLT 181

Query: 236 SAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIET 295
               G  RLGFL  ++S   + GF++   F ++   +   +  N L+ T    Y    E 
Sbjct: 182 LLFGGIFRLGFLGNILSKALLRGFISSIGFVMIVNSLITELKLNKLMLTIPEHYHTPFEK 241

Query: 296 LK----------HLPDTKLD-AVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKI 344
           +           HLP + L  AVF    L  + ++K                   ++ + 
Sbjct: 242 ILFLVRYGPSNYHLPTSFLSLAVF--TTLMTIRIFK------------------KKMMRR 281

Query: 345 LKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPS-GLKEVGVFHVP-- 401
           +KW  F  +     + +V+F+ +   +   K K +  IS++G   + G  +   F  P  
Sbjct: 282 IKWIVFIPEI----LSVVIFSIVLSYMCDLKKKYD--ISVIGDFNTDGFDD---FRNPLS 332

Query: 402 ---SGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFN 458
               GL+  L      S ++  LE I  SKS G   +     ++EL+A+G+ N +G+ F 
Sbjct: 333 KCNRGLIPALRDVSLVSALLGFLESITASKSLGGYGNTVASSNRELVALGLMNTIGSAFG 392

Query: 459 AYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVS 518
             PA G + RS + A    +T ++G+F GS  L  +  L     YIP   LS +      
Sbjct: 393 IIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHYIPTCVLSVITTFVGV 452

Query: 519 DLL--ASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPA 576
            LL  A +   ++       + I F++T L T F SIE GI     +S   ++   A   
Sbjct: 453 SLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCFYSIEFGILAGCTYSLISIVKHSAQSR 512

Query: 577 GKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSE--EGDEYEKDSSTKYITNSSKK 634
            + L RV   E TD +I AN         +N      E  EG    K       TN+   
Sbjct: 513 IQILARV---EGTDHFINANEYLQLDLDSDNCSAPDIEHFEGCLVVKIPEPLTFTNTEDL 569

Query: 635 IETNVQTKSFDSPSSLITQPRMKYH----TKWVPFD-HKYTRELNPDIQILPPPEGVLVY 689
            E   + + F S  +    P MK       +++ FD H  T   +   QIL   + V+ Y
Sbjct: 570 KERLDRLERFGSTKA---HPGMKSEGGSSIEYIIFDLHGMTFMDSSATQIL--KDIVVEY 624

Query: 690 RLSESYTYL-----NCSRHYNIITEKVKEVTRRGQLIRHRKKSDRPWND---PGPWEAPA 741
           R  +   +L     N      +    + ++ ++ ++ +H   S +       P   EA +
Sbjct: 625 RKRDVVVFLARVPPNLEVRERLKESGINDLVQKQEVKQHSNHSLQSAQTPYFPNIAEALS 684

Query: 742 FLKNLKFWKKRESDSEFLENAPDNS 766
            + NL   K R    + L  +P  S
Sbjct: 685 MVDNL---KARTRSQQILRTSPSIS 706

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score =  134 bits (337), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 125/476 (26%), Positives = 203/476 (42%), Gaps = 49/476 (10%)

Query: 107 RSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLP 165
           RS LT     DYL   FP  +W+P+Y    F  DL AG+++    +P ++SYA  +A + 
Sbjct: 44  RSILTTSNIWDYLAYYFPCFSWMPNYTLTKFLGDLTAGLSVASFQIPLALSYATSLAHVE 103

Query: 166 AQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIA 225
              GLYS  I  + Y+ F +   + +GP + +SL    V+        + D  I+   I+
Sbjct: 104 PLSGLYSLAITPFIYAIFGSVPQMIVGPESAISL----VVGQAVEPMVNHDERISTISIS 159

Query: 226 TTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTR 285
             +  + G     +G  RLGFL  ++S   + GF+    F ++   + + +  + ++ T 
Sbjct: 160 IVVTFISGSFLLFLGIFRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATS 219

Query: 286 AATYKVVIETLK----------HLPDTKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYN 335
              Y    E +           H P T + +++  I L L+ V K               
Sbjct: 220 PEHYHTPFEKILFLIKYGQHNYHAP-TAILSLYSFIILMLMKVMK--------------- 263

Query: 336 SKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSGLKEV 395
               RL K  KW  F  +     ++IV+   I ++      K +  ISI+G     +   
Sbjct: 264 ---KRLMKRFKWVIFVPE-----ILIVIVGTIMFSF-HFDIKHKFDISIIGDFK--VNGF 312

Query: 396 GVFHVPSGLMSKL--GPNLPASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVS 450
              H P    ++L   P L A I+  +L   E    SK+ G   D  V  ++EL+A+G  
Sbjct: 313 DSLHNPLDKTNRLLLKPLLDAGIVCAVLGFFESTTASKALGTTYDLTVSSNRELVALGSM 372

Query: 451 NLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLS 510
           N++G+ F A PA G + RS + A    +T +SG+  GS  L  +          P   LS
Sbjct: 373 NIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLS 432

Query: 511 AVIIHAVSDLLASYQTTWNFWKMNPL--DFICFIVTVLITVFASIEDGIYFAMCWS 564
            V       LL    T   F+  +    + I   +T + T+F S+E GI    C+S
Sbjct: 433 VVTSVVGLTLLEEAPTDLKFYFQSHGYNELIVLGLTFITTIFYSVEVGICVGCCYS 488

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score =  122 bits (307), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 121/467 (25%), Positives = 204/467 (43%), Gaps = 51/467 (10%)

Query: 117 DYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFI 175
           + ++   P + WLP+Y       DL+AGITI    +P ++SYA  +A +    GLY+  +
Sbjct: 104 ELIRYYLPCLYWLPNYTRTILVGDLMAGITIASFQIPLALSYATSIAHVDPLSGLYALAV 163

Query: 176 GAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGII 235
             + Y+ F ++  + +GP   +SL   + +       PD DP +   VIA T  L+ G I
Sbjct: 164 SPFFYAIFGSTPQMIVGPEGAISLVIGQCVQSCKKHNPDLDPILI--VIAVT--LISGTI 219

Query: 236 SAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIET 295
               G  RLG+L  +++   + GF+         G V  +M  +SL+N       ++ +T
Sbjct: 220 LLISGIFRLGYLGNILNKALLHGFI---------GSVGFVMIIDSLIN-ELKLGDILADT 269

Query: 296 LKHLPDTKLDAVFGLIPLFLLYVWKW-WCGTYGPILNDRYNS----------KNPRLHKI 344
            +H     L  VF         +WK+ +   + P     + S          K   +H+ 
Sbjct: 270 PEHYNTPFLKIVF---------LWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHR- 319

Query: 345 LKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVP--- 401
            +W  F  +      I++V T +     +        I ILG   S   E  +FH P   
Sbjct: 320 HRWLIFIPE------ILIVLTTVLILSYKLDFADTYDIDILGDFKS--NENSIFHNPLSN 371

Query: 402 --SGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNA 459
              GL+  +      + I    E    SK+ G  ++  V  ++EL+A+G+SN++ +   A
Sbjct: 372 KNRGLIHVVFNIGIITAIFGFFESTTASKALGASSERSVSSNRELVALGLSNIVISTLGA 431

Query: 460 YPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSD 519
            P+ G + RS + A    +T LSG+F G   +LA+  L     YIP   LS +       
Sbjct: 432 LPSFGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFT 491

Query: 520 LLASYQTTWNF-WKMNPLDFICFIV-TVLITVFASIEDGIYFAMCWS 564
           LL       +F W+    + +  IV T + ++F S+E  +Y    +S
Sbjct: 492 LLEEIPKEVSFHWRCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYS 538

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score =  117 bits (294), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 124/481 (25%), Positives = 206/481 (42%), Gaps = 37/481 (7%)

Query: 116 RDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSF 174
           RD L    P  +W+P Y ++ F  DL+AGIT+    +P ++SYA  +A +    GLYS  
Sbjct: 75  RDVLPYYLPCFSWIPEYTWSKFMGDLVAGITLASFQIPLALSYATSLAHVEPLCGLYSLA 134

Query: 175 IGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGI 234
              + Y+ F +   + +GP + +SL    V+     K    +  I+   I+  +  + G+
Sbjct: 135 FTPFIYAIFGSVPQMIVGPESAISL----VVGQAVEKLRAHNHEISTMSISVLVTFISGM 190

Query: 235 ISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIE 294
                G  R GFL  ++S   + GF++          V  +M  NSL++       ++  
Sbjct: 191 FLFVFGICRFGFLGNVLSRALLRGFIS---------SVGVVMIVNSLISELKLHKLLLET 241

Query: 295 TLK-HLPDTKLDAVFGLIPL---FLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYF 350
               H P  K+  +    P        V    C  +  ++  R   K  +L +  +W  F
Sbjct: 242 KGHFHTPFQKIRFIIKYAPANYHIPTAVLSLTC--FIILVTARVIKK--KLMRRRRWPVF 297

Query: 351 YAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPS-GLKEVGVFHVPSGLMSKLG 409
             +     +  ++ +       + K K    ISI+G   + GL  V  ++  S    +L 
Sbjct: 298 VPEILILIITTIILS------HKFKFKKHYEISIVGDFDTDGL--VNFYNPISKSNRELA 349

Query: 410 PNLP-ASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGS 465
           PNL  A  IV +L   E    +KS G   ++ +  ++EL+A+G  NL  +   A PA G 
Sbjct: 350 PNLMNAGFIVAILGFFESTTAAKSLGSAYEFAISSNRELVALGSMNLCASVLGALPAFGG 409

Query: 466 FSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--AS 523
           + RS + +    +T +SG+  G  VLL +        YIP   LS +       LL  A 
Sbjct: 410 YGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQIRYIPVCILSVITTIVGISLLEEAP 469

Query: 524 YQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRV 583
               ++F      + + F VTVL T F S+E G+     +S   ++   A    + L RV
Sbjct: 470 ADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVCIGCGYSVISIIKHSAKSRIQILARV 529

Query: 584 E 584
           E
Sbjct: 530 E 530

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score =  116 bits (290), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 119/488 (24%), Positives = 196/488 (40%), Gaps = 55/488 (11%)

Query: 117 DYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFI 175
           D LK   P  +WLP Y    F  D+IAGIT+    +P ++SYA  +A +    GLYS  I
Sbjct: 75  DRLKYYLPCFSWLPDYTLKKFGGDMIAGITLASFQIPLALSYATSLAHVEPLCGLYSLAI 134

Query: 176 GAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGII 235
             + Y  F +   + +GP + +SL    V+     K    +  +    I+  +  L G I
Sbjct: 135 TPFVYCVFGSVPQMIVGPESAISL----VVGQAVEKLVTHNEKVGTINISVVVTFLSGAI 190

Query: 236 SAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIET 295
               G  RLGFL  ++S   + GF++     ++   +   +    L+ T    Y    E 
Sbjct: 191 LLIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEK 250

Query: 296 LKHL----PDT--KLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTY 349
           ++ L    P+   K  A+  L    +L   ++                  +L K  K   
Sbjct: 251 VQFLFKYGPENLHKPTAILSLCSFIILMTLRFL---------------KKKLMKRYKSVI 295

Query: 350 FYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSV----------PSGLKEVGVFH 399
           F+ +     ++++V + +  ++     K +  IS+LG            P G     + H
Sbjct: 296 FFPE-----ILLIVISSLIISVNFNL-KKDFDISMLGDFSTSGFDKLNNPLGKDNRSLCH 349

Query: 400 --VPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFF 457
             +  GLM           I+   E    SKS G I D  +  ++EL+A+G  NL+G+ F
Sbjct: 350 ELLSVGLMCA---------ILGFFESTTASKSLGTIYDLTISSNRELVALGSMNLVGSLF 400

Query: 458 NAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAV 517
            A P+ G + RS + A    +T +SG   G   L  +  L     Y P   LS +     
Sbjct: 401 GALPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPVIHYTPLCILSVITTVVG 460

Query: 518 SDLL--ASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFP 575
             LL  A     ++       + I F +  + T+  S+E GI     +S   ++   A  
Sbjct: 461 LSLLEEAPSDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQS 520

Query: 576 AGKFLGRV 583
             + L RV
Sbjct: 521 RIQILTRV 528

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 121/478 (25%), Positives = 200/478 (41%), Gaps = 47/478 (9%)

Query: 123 FPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSY-AQVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP Y FN    D+IAGI++    +P ++SY   +A +P   GLYS  I  + Y 
Sbjct: 105 LPCFSWLPEYTFNKLWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 164

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGF 241
              +   + +GP + +SL   + +  +T    +    ++   I+T +  + G I    G 
Sbjct: 165 ILGSVPQMIVGPESAISLVVGQAVESITLHKEN----VSLIDISTVITFVSGTILLFSGI 220

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
            R GFL  ++S   + GF++     ++   + + +  +  + +    Y    E +  L D
Sbjct: 221 SRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHTPFEKILFLID 280

Query: 302 ---------TKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYA 352
                    T + +   LI LFL  + K                   +L K  K   F+ 
Sbjct: 281 YAPAQYHIPTAIFSGCCLIVLFLTRLLKR------------------KLMKYHKSAIFFP 322

Query: 353 QASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVP-SGLMSKLGPN 411
                 +++VV   I  ++ +   K    ISI+G     +        P +    KL P+
Sbjct: 323 D-----ILLVVIVTILISM-KFNLKHRYGISIIGDF--SMDNFDELKNPLTRPRRKLIPD 374

Query: 412 L-PASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFS 467
           L  AS+IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A PA G + 
Sbjct: 375 LFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYG 434

Query: 468 RSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTT 527
           RS + A    ++ +SG+F G   L+ +  L     YIP   LS +       LL      
Sbjct: 435 RSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGD 494

Query: 528 WNF-WKMNPL-DFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRV 583
             F  +     +   F VT   T+F SIE GI     +S   ++   A    + L RV
Sbjct: 495 IKFHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILARV 552

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score =  112 bits (281), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 120/477 (25%), Positives = 198/477 (41%), Gaps = 47/477 (9%)

Query: 123 FPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP Y FN    D+IAGI++    +P ++SY   +A +P   GLYS  I  + Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGF 241
              +   + +GP + +SL   + +  +T  + D    I    I+  +  + G I    G 
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITL-HKDNVSLID---ISIVITFVSGAILLFSGI 210

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
            R GFL  ++S   + GF++     ++   + + +  +  + +    Y    E +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDKFLVSLPQHYHTPFEKVLFLID 270

Query: 302 ------TKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQAS 355
                  K  A+F      +L V +                   +L K  K   F+    
Sbjct: 271 YAPAQYHKPTAIFSGCCFIILIVMRLL---------------KKKLMKRHKSAVFFPD-- 313

Query: 356 RNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVP-SGLMSKLGPNL-P 413
              +++VV   I  ++ +   K    ISI+G     +        P +    KL P+L  
Sbjct: 314 ---ILLVVIVTILISM-KLSLKQRYGISIVGDF--SMDNFDKLKNPLTHSRRKLMPDLFS 367

Query: 414 ASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSA 470
           AS+IV +L   E    SKS G   +  V  ++EL+A+G  N+  + F A P+ G + RS 
Sbjct: 368 ASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGCINMFISLFGALPSFGGYGRSK 427

Query: 471 LKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF 530
           + A    ++ +SG+F G   L+ +  L     YIP   LS +       LL        F
Sbjct: 428 INALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIKF 487

Query: 531 WKM--NPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEI 585
                   +   F VT  +T+F SIE GI    C  C   +L +   + K   R++I
Sbjct: 488 HLQCGGYSELFVFAVTFGVTIFYSIESGI----CIGCVYSILNIIKHSAK--SRIQI 538

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 122/489 (24%), Positives = 211/489 (43%), Gaps = 55/489 (11%)

Query: 117 DYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFI 175
           D L    P  +WLP+YN +    DLIAG+++    +P ++S+A  VA +    GLYS   
Sbjct: 84  DVLPYYLPFFSWLPNYNISKCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAF 143

Query: 176 GAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGII 235
             + Y+   +   + +GP + +SL   + +  + +  PD    +    ++  +  + G  
Sbjct: 144 TPFIYAILGSVPQMIVGPESAISLVVGQAVEKMISHNPD----LHTLQLSAVITFISGGF 199

Query: 236 SAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIET 295
               G  RLGFL  ++S   + GF++              +G   ++N+  + +K+  + 
Sbjct: 200 LFFFGLCRLGFLGNVLSRALLRGFISS-------------VGLVMIINSMISEFKLD-KI 245

Query: 296 LKHLP---DTKLDAVFGLI---------PLFLLYVWKWWCGTYGPILNDRYNSKNPRLHK 343
           LK LP    T  + +  L+         P   L +  ++      I+  +     PR   
Sbjct: 246 LKDLPVHYHTPFEKILFLVTYAPNNYHGPTTALSLSCFFILIMTKIIKKKLM---PRC-- 300

Query: 344 ILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPS-GLKEV--GVFHV 400
             +W  F        +++++   I  +I + + K    IS +G   + GL ++   +   
Sbjct: 301 --RWIVFVPD-----ILLLIIGTIFLSI-KYRFKHNYSISTVGDFNTKGLDKLLNPLSAE 352

Query: 401 PSGLMSKLGPNLPASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFF 457
             GL+ +L   L A  I  +L   E    SKS G   D  +  ++EL+A+G  NL  +  
Sbjct: 353 NRGLIPQL---LSAGFITAMLGFFESTTASKSLGSSYDLAISSNRELVALGSMNLFSSIL 409

Query: 458 NAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAV 517
            + PA G + RS + A    +T +SG F G  VLL +  L     YIP   LS V     
Sbjct: 410 GSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPMIHYIPICVLSVVTTMVG 469

Query: 518 SDLL--ASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFP 575
             LL  A     ++F      + + F +TVL T+F S+E GI     +S   ++   A  
Sbjct: 470 ISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEVGICIGCGYSVISIIKHSAKS 529

Query: 576 AGKFLGRVE 584
             + L RV+
Sbjct: 530 RIQILARVQ 538

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score =  110 bits (274), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 147/589 (24%), Positives = 241/589 (40%), Gaps = 61/589 (10%)

Query: 117 DYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFI 175
           D L    P  +WLP Y+   F  D IAG+++    +P +MSYA  +A +    GLY+   
Sbjct: 91  DVLPYYLPCFSWLPSYDLRKFFGDFIAGVSLASFQIPLAMSYATSIAHVEPLCGLYALAF 150

Query: 176 GAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGII 235
             + Y+ F +   + +GP + +SL   + I  +       DP+++   +   +  + G++
Sbjct: 151 TPFFYAIFGSVPQMIVGPESAISLVVGQAIEPMIRH----DPSLSSLDLCVIITFISGVV 206

Query: 236 SAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIET 295
               G  R GFL  ++S   + GF++          V  +M  NSL+       KV  + 
Sbjct: 207 LFTFGVFRFGFLDNVLSRAFLRGFISA---------VGVIMVINSLI-VELKLKKVFDDA 256

Query: 296 LKHLPDTKLDAVFGLI---------PLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILK 346
             H   +  + V  LI         P  LL +  +       IL      K   L +   
Sbjct: 257 PSHY-HSPFEKVLFLIKYAPANYHLPTSLLSLCCFL------ILMSLRLIKKKLLKRFRS 309

Query: 347 WTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMS 406
             +F        +++VV T I ++      K    I ++G +     E  VF      +S
Sbjct: 310 LVFF------PEILLVVVTVIFFSYN-FDLKHRYNIEVVGDI-----EASVFDKLRNPLS 357

Query: 407 K-----LGPNLPASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFN 458
           K      G    A  +V +L   E    SKS G   D  V  ++EL+A+G  NL+G+ F 
Sbjct: 358 KNKRPFYGDLFSAGFMVAMLGFFESTTASKSLGTAYDLAVSSNRELVALGSLNLIGSLFG 417

Query: 459 AYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVS 518
           A P+ G + RS + A    +T +SG   G+  +  +  L     YIP   LS +      
Sbjct: 418 ALPSFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGL 477

Query: 519 DLL--ASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPA 576
            LL  A     ++       + I FI+TVL T F S+E GI     +S   ++       
Sbjct: 478 SLLEEAPADLRFHIRCRGYNELISFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSR 537

Query: 577 GKFLGRVEIAEVTDAYIKANS-DAVSYTSENNNGIRTSE-EGDEYEKDSSTKYITNSSKK 634
            + LG++     T+ ++ A+  +  + TSE     +  E EG    +       TN+   
Sbjct: 538 IQILGKL---AGTNKFVNADEYEGKNSTSERRVNPQLEEIEGCLIVRIPEPLTFTNTDDL 594

Query: 635 IETNVQTKSFDSPSSLITQPRMKYH--TKWVPFD-HKYTRELNPDIQIL 680
                + + + S  +    PR +    TK+V FD H  T   +  IQIL
Sbjct: 595 KTRLNRLELYGSTKTHPAAPRSRDQEMTKYVIFDLHGMTTIDSSAIQIL 643

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score =  109 bits (273), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 129/527 (24%), Positives = 220/527 (41%), Gaps = 46/527 (8%)

Query: 76  FNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFN 135
           F+P+  ++ D+ ++Q    T  +++ YD    + LT      Y     P + WLP YN +
Sbjct: 73  FDPN--TMDDHDMNQNITITHRIRKTYDDG-ENELTFYQLIQYY---LPCLRWLPIYNCS 126

Query: 136 WFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPV 194
            F +D I+GI++    +P ++SYA  +A +    GLYS  I    Y    +   + +GP 
Sbjct: 127 DFFSDCISGISLASFQIPLALSYATSIAHVKPLCGLYSLAITPVIYGILGSVPPMIVGPE 186

Query: 195 AVMSLQTAKVIADVTAKY---PDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELI 251
             +SL   + +  +   Y      D  I+   I+ T+  L G++    G LRLGFL  ++
Sbjct: 187 GAISLVVGQAVDKLHGSYNLSSQEDDHISRMNISVTITFLSGLVLFICGLLRLGFLGSVL 246

Query: 252 SLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIE----TLKHLPDT--KLD 305
           S   +  F++     ++   +   M  N ++      Y    E     +K+ P+   K  
Sbjct: 247 SKPLLRSFISSVGGVMVIDALITEMKLNCILIDNDRHYHTAFEKIMFIIKYAPNNFHKPT 306

Query: 306 AVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFT 365
            V  ++   +LY  ++           +Y  K    HK L    F  +      I++V  
Sbjct: 307 TVLSVVCFSILYFVRYC--------KKKYIIK----HKSL---IFLPE------ILIVVI 345

Query: 366 CIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGLMS---KLGP---NLPASIIVL 419
             G        K    ISI+G V S    +   ++ + L S   +L P   N   +I  L
Sbjct: 346 STGILSASYNFKDNYGISIIGDVNSNNSNLIAGNLQNPLSSSNKELFPILMNTGFAIAAL 405

Query: 420 -LLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVR 478
              E    SKS G   +  +  ++EL+A+GV NL  +     P+ G + RS + A    +
Sbjct: 406 GFFESTTASKSLGTKFELSISSNRELVALGVMNLTASLLGGLPSFGGYGRSKINAFSGAK 465

Query: 479 TPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNPL- 536
           T +SG+  G   +L +  L     +IP   LS +       L+        F W+     
Sbjct: 466 TVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLSLIEEAPGEVKFHWRCKGYN 525

Query: 537 DFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRV 583
           + I F +T   T+F S+E GI     +S   ++   A    + LGR+
Sbjct: 526 ELIIFFMTACGTIFFSVEVGIIIGCSYSIISIIKFSAKSRIQILGRI 572

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score =  108 bits (270), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 119/504 (23%), Positives = 211/504 (41%), Gaps = 45/504 (8%)

Query: 94  STVSLKEYYDHSIRSHLTLKGARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVP 153
           ST SL+ Y    +   L L   + Y+    PI+ W P Y+      DL+AGI++    +P
Sbjct: 20  STPSLRSYRAIKVDQPLKLN-TKSYISYYLPILKWFPEYDRKKLGKDLLAGISLTAFQIP 78

Query: 154 QSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYP 213
            ++S + +A +    GL+S  I    Y+ F +   + +GP  V+SL   +     + K  
Sbjct: 79  FAISLSTMAHVSPYAGLFSLVIPPLIYAVFGSVPTMVVGPQTVVSLVVGQSCEAWSHK-- 136

Query: 214 DGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVP 273
             D  +T  VIA T     G I  ++G  R+GF+   IS   + GF+   A  +L  ++ 
Sbjct: 137 SVDSLVTVAVIACT----SGFILLSMGLFRMGFIDNAISKAFLRGFIFALAIMMLITELL 192

Query: 274 ALMGYNSLVNTRAATYKVVIET-------LKHLPD------TKLDAVFGLIPLFLLYVWK 320
             +    L     A       T       LK+ P+       KL  +   I +   YV K
Sbjct: 193 PELQLEDLYRDEVAQGNAGTTTWDKFNFILKYGPEHADSFSMKLSFIAFSILMVCKYVKK 252

Query: 321 WWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSER 380
           ++    G  L   +      +   +  +Y+   +S  G  I+        +   K+  + 
Sbjct: 253 YFTEKRGSKLCRFFPDLLLVVAGFIYLSYYNDWSSTMGTRII------GNLPPNKNHFKV 306

Query: 381 PISILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVP 440
           PI+         KE       S L++ LG          L +     K+ G   D  +  
Sbjct: 307 PIT-------SFKEFKELFDISFLVAILG----------LFDSATAFKAIGEKFDIDISS 349

Query: 441 DQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGA 500
           ++EL+++G+ N++ + F+A PA G + RS L   C+ +TP++G+      +  +  + GA
Sbjct: 350 NRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAIFCMNYMMGA 409

Query: 501 FFYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNPL-DFICFIVTVLITVFASIEDGIY 558
           F Y+P   L+ +I +   +LL    +   F W +    + + F+  V+ T+  S + G+ 
Sbjct: 410 FHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTLVWSPQFGVS 469

Query: 559 FAMCWSCAMLLLKMAFPAGKFLGR 582
             +  +   LL        + LGR
Sbjct: 470 IGVGLTMIRLLKHTTQSRVQILGR 493

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 118/492 (23%), Positives = 212/492 (43%), Gaps = 36/492 (7%)

Query: 116 RDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSF 174
           ++ L    P ++W+PHY++  F  DL+AGI++    +P ++SYA  +A +    GLYS  
Sbjct: 67  QELLPYYLPCMSWIPHYSWEIFFGDLVAGISLASFQIPLALSYATSIAHVEPLCGLYSLA 126

Query: 175 IGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGI 234
           I    Y+ F +   + +GP + +SL    V+   T K+   D  I+   I   +  + G+
Sbjct: 127 ITPLIYAIFGSVPQMIVGPESAISL----VVGQATEKFSAHDSEISTVTITMMITFISGV 182

Query: 235 ISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVV-I 293
           +   +G +RLGFL  ++S   + GF++          V  +M  NSL+      +K+  +
Sbjct: 183 VLFFLGSVRLGFLGNILSKALLRGFIS---------SVGLVMIINSLIIELKLNHKLADV 233

Query: 294 ETLKHLPDTKLDAVFGLIPLFL---LYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYF 350
               H P  K+  +F     +      +    C  +  +++ R   K  +L    ++  F
Sbjct: 234 AGHYHTPVGKIMFLFRYASEYYHKPTAILSLIC--FLVLISTRIAKK--KLMNRYRFLIF 289

Query: 351 YAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPS-GLKEVG--VFHVPSGLMSK 407
             +     +++VV   I  ++ +   K    IS +G   + G   +G  + +    L S 
Sbjct: 290 VPE-----ILLVVSVTILLSL-KYDFKHSYGISTIGEFNADGFGSIGNPLSNENRALYSS 343

Query: 408 LGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFS 467
           L     A  ++   E    SKS G   +     ++ELIA+G  N++G+ F A P+ G + 
Sbjct: 344 LWNEGLAVAMLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSLFGALPSFGGYG 403

Query: 468 RSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTT 527
           RS +      +T +SG   G   LL    L     Y P   LS +       LL    + 
Sbjct: 404 RSKVNVFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVITTVIGISLLEEVPSD 463

Query: 528 WNFWKMNP--LDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEI 585
             F        +   F +T + T+  S+E G+     +S  +++   A    + L ++E 
Sbjct: 464 IKFHIHCSGYSELTVFTLTFIATLSQSVELGVTVGCIYSLILIVKHSALSRIQILAKLEG 523

Query: 586 AEV---TDAYIK 594
           ++     D YIK
Sbjct: 524 SDEFVNVDDYIK 535

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 165/642 (25%), Positives = 253/642 (39%), Gaps = 83/642 (12%)

Query: 54  NSVAKPNAVGNGKGAKGSKIEYFNPSDVSLYDNSVSQFEESTVSLKEYYDHSIRSHLTLK 113
            S +K    G+  GA  S    FN  DV     S    + STVS  E         +TLK
Sbjct: 20  TSPSKKYGTGSCIGADTS----FN--DVQSTSTSTVGLKFSTVSFPE------NERVTLK 67

Query: 114 GARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYS 172
              D +    P  +W+P Y+      D IAG+++    +P +MSYA  VA +P   GLYS
Sbjct: 68  ---DTIPYYLPCFSWIPTYSVKKCMGDFIAGLSLASFQIPLAMSYATSVAHVPPLCGLYS 124

Query: 173 SFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLC 232
                  Y+   +   + +GP + +SL   + I    ++    DP +    I   +  + 
Sbjct: 125 LVFSPAVYTVLGSVPQMIVGPESAISLILGQAIEARLSE----DPKLKAINICLVITFIS 180

Query: 233 GIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATY--- 289
           G++    G LRLGFL  ++S   + GF++G    ++   +   +  N +  TR   Y   
Sbjct: 181 GLVLLTGGLLRLGFLENVLSRALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSP 240

Query: 290 -KVVIETLKHLPDT--KLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILK 346
            + V+  +K+ P+   K  A+  L+   +L   +        I   RY  K        K
Sbjct: 241 FEKVLFIMKYGPENYHKPTAILSLVAFVILMSLR--------IFKKRYGKK-------FK 285

Query: 347 WTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPISILGSVPSG----LKE------VG 396
           W            I+VV     +   +   KS   I I+  +P      LK       V 
Sbjct: 286 WLVLLPD------ILVVVALSIFVSYKMHLKSRYGIEIINDIPKDSMKHLKNPFSNVNVA 339

Query: 397 VFH--VPSGLM-SKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLL 453
            F     +G M + LG            E    SKS G   +  +  ++ELIA+G  N++
Sbjct: 340 TFKDLFSTGFMVAMLG----------FFESATASKSLGTSYNLAISSNRELIALGSMNVV 389

Query: 454 GTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVI 513
           G+ F   PA G + RS + A    +T +SG F G   L  +  L     YIP   LS + 
Sbjct: 390 GSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTIQFLLPIIRYIPVCILSVIT 449

Query: 514 IHAVSDLLASYQTTWNF-WKMNPL-DFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLK 571
                 LL        F W+     +   F VT+L T+F S+E GIY     S   ++  
Sbjct: 450 TVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTLLATLFYSLEAGIYIGCACSIINVIKH 509

Query: 572 MAFPAGKFLGRVEIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKYITNS 631
            A    + LGRV     T+ +I A+    +      N      EG    K +     TN+
Sbjct: 510 SAKSRIQILGRV---PGTETFINADDYQANAAGYFINPQIEEIEGFLIVKIAEPLTFTNA 566

Query: 632 SKKIETNVQTKSFDSPSSLITQP-----RMKYHTKWVPFDHK 668
               +  ++    +   S +T P     R K  T+ V FD K
Sbjct: 567 D---DLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENVIFDMK 605

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 143/569 (25%), Positives = 238/569 (41%), Gaps = 61/569 (10%)

Query: 123 FPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P  +W+P Y +    +D +AGI++    +P ++SYA  +A +    GLYS  I  + Y+
Sbjct: 89  LPCFSWIPQYTWFKLISDFLAGISLASFQIPLALSYATSIAHVEPLCGLYSLAITPFIYA 148

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGF 241
            F +   + +GP + +SL    V+          D A+    I+  L  + G     +G 
Sbjct: 149 VFGSVPQMIVGPESAISL----VVGQSVELLKSHDSALEIINISVVLTFISGAALLILGI 204

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLK---- 297
           LRLGFL  ++S + + GF++     ++   +   +  N L+           E ++    
Sbjct: 205 LRLGFLGNVLSRSLLRGFISSIGLVMIIDSLITELKLNKLLAGLKVHCHTSFEKVQFLIK 264

Query: 298 ------HLPDTKLDAVFGLIPLFLLYVWK-WWCGTYGPILNDRYNSKNPRLHKILKWTYF 350
                 H P   L A+   + LF + + K  W   +      R+ +  P +  ++  + +
Sbjct: 265 YAPTNYHKPTALLSAI-AFVTLFSIRLLKKRWMAKH------RWLAFIPEILMVVIISIY 317

Query: 351 YAQA----SRNGVIIVVFTCIGWAITRGKSKSERPISILG-SVPSGLKEVGVFHVPSGLM 405
            +       + G++IV     G   T    K + PIS     +   L   GV      L+
Sbjct: 318 LSATWEFKKQYGILIV-----GDFNTHAIDKLKNPISKENRKIMPQLLNTGV------LI 366

Query: 406 SKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGS 465
           S LG            E +  SKS G   D  +  ++EL+A+G  N++ + F A P+ G 
Sbjct: 367 SLLG----------FFESMTASKSLGTTYDLAISSNRELVALGSMNVIASLFGALPSFGG 416

Query: 466 FSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--AS 523
           + RS + A    +T +SG+F GS  L+ +  L     YIP   LS +       LL  A 
Sbjct: 417 YGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPLIHYIPLCILSVITSIVGISLLEEAP 476

Query: 524 YQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRV 583
            +  ++F      +   F +TVL T+  S+E GI     +S   ++   A    + LGRV
Sbjct: 477 SELKFHFRCKGYDELFVFAITVLATLLYSVEMGICIGCGYSIISIVKHSAKSRIQILGRV 536

Query: 584 ----EIAEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNV 639
               E A + D Y+  +SD +    E N  +    EG    K       TN+    E   
Sbjct: 537 QGTREFANI-DEYL--DSDPIG-DIETNKFVLEEIEGCLIVKIPEPLTFTNTDDLKERLN 592

Query: 640 QTKSFDSPSSLITQP--RMKYHTKWVPFD 666
           + + F S  +    P  R K +TK V FD
Sbjct: 593 RLERFGSVKAHPGGPGGRSKDYTKCVIFD 621

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 139/594 (23%), Positives = 230/594 (38%), Gaps = 50/594 (8%)

Query: 123 FPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP Y+ +    D IAG ++    +P +MSY+  VA +P   GL +     + Y+
Sbjct: 70  LPCFSWLPTYDTSKLLRDFIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPFVYA 129

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGF 241
            F +   + +GP + +SL    V+     K    D ++    +   L  + G I    G 
Sbjct: 130 VFGSVPHMIVGPESAISL----VVGQAIEKQMKHDKSLDVVNLCLILTFISGAILFCFGI 185

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
           +R G+L  ++S   + GF++     ++   +   +    + N     Y        H P 
Sbjct: 186 MRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVFNDAPGHY--------HAPF 237

Query: 302 TKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVII 361
            KL  +F   P    +V           +         RL ++ K   F  +      I+
Sbjct: 238 QKLIFLFHYAP-GNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKVIFVPE------IL 290

Query: 362 VVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPSGL--MSKLGPNLPASIIVL 419
           +V   +         K    I I+G +  G  +   F  P     +S       A  +V 
Sbjct: 291 IVVALVTLGSYHFSFKLRYNIDIVGDIEVG--DTSKFRNPLSKKNLSLFSELFHAGFMVA 348

Query: 420 LL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCN 476
           LL   E    SKS G   +  V  ++EL+A+G  NL+G+ F A P+ G + RS + A   
Sbjct: 349 LLGFFESTTASKSLGSSYELSVSSNRELVALGSLNLVGSIFGALPSFGGYGRSKINAYSG 408

Query: 477 VRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--ASYQTTWNFWKMN 534
             T +SG+F G    +    L  A  +IP   LS +       L   A     ++F    
Sbjct: 409 AATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITLFEEAPADLRYHFRCRG 468

Query: 535 PLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEIAEVTDAYIK 594
             + + F +TVL T F S+E GI     +S   ++        + L RV     TD ++ 
Sbjct: 469 YNELLIFALTVLTTFFYSVEAGITLGCGYSVIRVIKNSTKSKIQILRRV---SGTDQFVN 525

Query: 595 ANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIETNVQTKSF---------D 645
           A+     + S  N  +      D+ E     K     +     +++T+ +          
Sbjct: 526 AD----DFNSSTNTCVVIPPRLDDIEGSLIVKIPERLTFMNTEDLKTRLYRLEKYGSVKT 581

Query: 646 SPSSLITQPRMKYHTKWVPFDHKYTRELNPDI-QILPPPEGVLVYRLSESYTYL 698
            P+S   +PR +  TK + FD     E++    QIL   E VL  R      YL
Sbjct: 582 HPAS--PKPRNRNQTKHMIFDMNGMTEIDSSASQIL--QEIVLSLRKRGVRVYL 631

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 116/478 (24%), Positives = 196/478 (41%), Gaps = 49/478 (10%)

Query: 123 FPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSY-AQVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP Y FN    D+IAGI++    +P ++SY   +A +P   GLYS  I  + Y 
Sbjct: 95  LPCFSWLPEYTFNKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGF 241
              +   + +GP + +SL   + +  +T  + D    I    I+  +  + G I    G 
Sbjct: 155 ILGSVPQMIVGPESAISLVVGQAVESITL-HKDNVSLID---ISVVITFVSGAILLFSGI 210

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPD 301
            R GFL  ++S   + GF++     ++   + + +  +  + +    Y    E +  L D
Sbjct: 211 SRFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDKFLLSLPQHYHTPFEKVLFLID 270

Query: 302 ------TKLDAVFGLIPLFLLYVWKWWCGTYGPILNDRYNSKNPRLHKILKWTYFYAQAS 355
                  K  A+F    L +L+  +                 +  L              
Sbjct: 271 YAPAQYHKPTAIFSGCCLIVLFSMRLLKKKLVKHHKSAIFFPDILLV------------- 317

Query: 356 RNGVIIVVFTCIGWAITRGKSKSERPISILG--SVPSGLKEVGVF-HVPSGLMSKLGPNL 412
              VI+ +F  + +++     K    I+I+G  S+ +  K    F H    L+  L    
Sbjct: 318 ---VIVAIFISMKFSL-----KHRYGITIIGDFSMDNFDKLKNPFTHSRRKLIPDL---F 366

Query: 413 PASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRS 469
            AS+IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A P+ G + RS
Sbjct: 367 SASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPSFGGYGRS 426

Query: 470 ALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWN 529
            + A    ++ +SG+F G   L+ +  L     YIP   LS +       LL        
Sbjct: 427 KINALSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDIK 486

Query: 530 FWKM--NPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRVEI 585
           F        +   F VT  +T+  SIE GI    C  C   +L +   + K   R++I
Sbjct: 487 FHLRCGGYSELFVFAVTFGVTILCSIEAGI----CIGCVYSILNIIKHSAK--SRIQI 538

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 102/444 (22%), Positives = 179/444 (40%), Gaps = 44/444 (9%)

Query: 154 QSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYP 213
            S+S + +A LP   GLYS  I    Y    T     +GP  V+SL   +     + +  
Sbjct: 1   MSISLSTLAHLPPSTGLYSLVIPPLIYCILGTVPTTVVGPQTVVSLVVGQSCEWWSHR-- 58

Query: 214 DGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVP 273
             +P  T  VI      + G I  A+G  R+GF+   +S   + GF++  A  +L  ++ 
Sbjct: 59  SLEPLSTVAVIGC----VSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELL 114

Query: 274 AL----------MGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWC 323
                       +    +  T    ++ ++E      DT              + W    
Sbjct: 115 PELKLEELYAHYVAQGYIGTTTWEKFRFILEKAPENSDT--------------FTWNLSL 160

Query: 324 GTYGPILNDRYNSKNPRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSERPIS 383
            T+  ++  RY  ++       K   F+ +     ++IVV   I  + T+ K    + I 
Sbjct: 161 FTFILLMTIRYLKRHLAEKCGWKKCIFFPE-----ILIVVVGSITLSNTQ-KWSELKGIK 214

Query: 384 ILGSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLL---EHIAISKSFGRINDYKVVP 440
           I+G +P     +    VP    S+       S ++ +L   E   + KS    ++     
Sbjct: 215 IIGDIPPNSDHI---KVPVQTFSEFKELFGTSALIAMLGLFESTIVFKSVCSNSNVDASS 271

Query: 441 DQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGA 500
           ++EL+++GV NL+ + F+A PA G + RS +   C  +T  SG+F     ++ +  L  A
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 501 FFYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNPL-DFICFIVTVLITVFASIEDGIY 558
           F ++P   L+ +I      LL        F W +    +   FI+ V+ T+  S + G+ 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVT 391

Query: 559 FAMCWSCAMLLLKMAFPAGKFLGR 582
             MC +   LL        + LGR
Sbjct: 392 MGMCLTMIRLLKHSTRSRVQILGR 415

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 79/175 (45%), Gaps = 5/175 (2%)

Query: 414 ASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSA 470
           A  +V LL   E    SKS G   D  +  ++EL+A+G  NL+G+ F A P+ G + RS 
Sbjct: 358 AGFLVALLGFFESTTASKSLGTNYDLAISSNRELVALGSLNLVGSLFGALPSFGGYGRSK 417

Query: 471 LKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLL--ASYQTTW 528
           + A     T +SG+F G   L+    L  A  +IP   LS +       L   A     +
Sbjct: 418 INAYSGAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKF 477

Query: 529 NFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFLGRV 583
           +F      + + F +TVL T F S+E GI     +S    +        + LGR+
Sbjct: 478 HFRCRGYNELLTFAITVLTTFFYSVEAGITLGCGYSIIRAIKNSTQSGIQILGRI 532

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 76/162 (46%), Gaps = 14/162 (8%)

Query: 123 FPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSYA-QVATLPAQYGLYSSFIGAYSYS 181
            P  +WLP Y+   F  DLIAG ++    +P +MSY+  VA +P   GL +       Y+
Sbjct: 85  LPCFSWLPTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGF 241
            F +   + +GP + +SL   + I  +T      D ++    +   L  + G I  + G 
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEKLTKH----DASLNVTNLCVVLTFISGSILFSFGL 200

Query: 242 LRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYNSLVN 283
           +R GFL  ++S   + GF++          V  +M  NSL++
Sbjct: 201 MRFGFLDSVLSRALLRGFISA---------VGLIMVINSLIS 233

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 85/183 (46%), Gaps = 6/183 (3%)

Query: 407 KLGPNL-PASIIVLLL---EHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPA 462
           KL P+L  AS+IV +L   E    SKS G   +  V  ++EL+A+G  N++ + F A P+
Sbjct: 360 KLIPDLFSASLIVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPS 419

Query: 463 TGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLA 522
            G + RS + A    ++ +SG+F G   L+ +  L     YIP   LS +       LL 
Sbjct: 420 FGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGISLLE 479

Query: 523 SYQTTWNFWKM--NPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLLKMAFPAGKFL 580
              +   F        +   F VT  +T+F SIE GI     +S   ++   A    + L
Sbjct: 480 EVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGICIGCVYSILNIIKHSAKSRIQIL 539

Query: 581 GRV 583
            RV
Sbjct: 540 ARV 542

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 68/140 (48%), Gaps = 5/140 (3%)

Query: 123 FPIINWLPHYNFNWFTADLIAGITIGCVLVPQSMSY-AQVATLPAQYGLYSSFIGAYSYS 181
            P   WLP Y F+    D+IAGI++    +P ++SY   +A +P   GLYS  I  + Y 
Sbjct: 95  LPCFAWLPEYTFSKLWGDIIAGISLASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYG 154

Query: 182 FFATSKDVCIGPVAVMSLQTAKVIADVTAKYPDGDPAITGPVIATTLALLCGIISAAIGF 241
            F +   + +GP + +SL   + +  +T  + D    I    I+  +  + G I    G 
Sbjct: 155 VFGSVPQMIVGPESAISLVVGQAVESITL-HKDNVSLID---ISIVITFVSGAILLFSGI 210

Query: 242 LRLGFLVELISLNAVAGFMT 261
            R GFL  ++S   + GF++
Sbjct: 211 SRFGFLGNVLSKALLRGFIS 230

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 87/176 (49%), Gaps = 9/176 (5%)

Query: 94  STVSLKEYYDHSIRSHLTLK-GARDYLKSVFPIINWLPHYNFNWFTADLIAGITIGCVLV 152
           ST+SL+ Y   +I+    L+   + Y+    PI+ WLP Y++     D++AG+T+    +
Sbjct: 20  STMSLRSY--RAIKVDKPLRHDTKSYVSYYLPILRWLPEYSWGKMAKDMLAGLTLTSFQI 77

Query: 153 PQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKY 212
           P ++S   +A +    GLY+  I    Y+ F +   + +GP  V SL   +   D  A +
Sbjct: 78  PLAISLTTMAHVSPYAGLYALVIPPLIYAVFGSVPTMVVGPQTVASLVVGQS-CDAWA-H 135

Query: 213 PDGDPAITGPVIATTLALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNIL 268
              +P +T  VI      + G++  A+G  RLGF+   IS   + GF +  A  +L
Sbjct: 136 KSLEPLMTVAVIGC----ISGVLVFAMGIFRLGFIDNAISKAFLKGFTSALAVVML 187

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 75/155 (48%), Gaps = 2/155 (1%)

Query: 417 IVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCN 476
           I+ L E     KS     D  V  ++EL+++G+ N++G+ F++ PA G + RS L   C 
Sbjct: 326 ILGLFESATAFKSISATFDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCG 385

Query: 477 VRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNF-WKMNP 535
            +TP++G+F     +  +  L G F Y+P   L+ +I     +LL        F W ++ 
Sbjct: 386 AQTPMAGIFVSLSAIFCMRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSG 445

Query: 536 L-DFICFIVTVLITVFASIEDGIYFAMCWSCAMLL 569
             + I F   VL T+  S + G+   +  +   LL
Sbjct: 446 YQELITFSAVVLSTLIWSPQFGLVMGLGLTMIRLL 480

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
           YGR125W
          Length = 1020

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 87/204 (42%), Gaps = 28/204 (13%)

Query: 396 GVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455
           G+ HVP         N+PA         +A+S    +++ Y V  D+ELIA G+SNL+  
Sbjct: 484 GILHVP--------INVPA---------LAMSV---QMDKYDV--DKELIAHGLSNLVSG 521

Query: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515
            F +      ++ S L  +    +P +G       ++ +        +IP   + ++I  
Sbjct: 522 MFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFL 581

Query: 516 AVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLL---K 571
              +LL  +   TW+  K+   +++  +V VL         GI   +  +C   L+   K
Sbjct: 582 LGYELLVEALLDTWD--KLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSK 639

Query: 572 MAFPAGKFLGRVEIAEVTDAYIKA 595
           +    G+F G+V  + V    I++
Sbjct: 640 LQTINGEFSGKVAKSTVNRDLIQS 663

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1060

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 78/379 (20%), Positives = 155/379 (40%), Gaps = 56/379 (14%)

Query: 396 GVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455
           G+ HVP         N+PA         +A+S +   ++ Y V  D+ELIA G SNL+  
Sbjct: 538 GILHVPI--------NVPA---------LAMSLN---VDKYDV--DKELIAHGYSNLISG 575

Query: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515
           F  +      ++ S L  +    +P++G+       + +        +IP   + ++I  
Sbjct: 576 FLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTIGTFIVMVIGPVIISFIPICIVGSLIFL 635

Query: 516 AVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLL---K 571
              +L+  +   TW   K+ P +++   + V+         GI   +  +C   L+   +
Sbjct: 636 LGYELIQEAVIDTWG--KLQPFEYLTIWIIVITMGVVDFVIGIIVGILLACFSFLVNSTQ 693

Query: 572 MAFPAGKFLGRVEIAEVTDAYIKA----NSDAVSYTSENNN-----GIRTSEEG-----D 617
           +    G++ G+V  + V   YI++    N     Y  +  N      I + EE      +
Sbjct: 694 LQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIYVLKLQNILFFGTIISIEEKVNSLLE 753

Query: 618 EYEKDSSTKYITNSSKKIETNVQTKSFD-SPSSLITQPRMKYHTKWVPFDHKYTRELNPD 676
             E DSS K I       + N++ KS D S +    + +     + +   H     ++ +
Sbjct: 754 ICESDSSKKRIKYLILDFK-NIRAKSIDYSAAEGFNRIKRFLEKERI---HLIISSIDKE 809

Query: 677 IQILPPPEGVLVYRLSESYTYLN-----CSRHYNIITEKVKEVTRRGQLIRHRKKSDR-- 729
            QI    + V ++   E ++ LN     C   + +  ++++  TR  +L + +K  +R  
Sbjct: 810 DQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRYKRIRTKTRARKLAQLKKSQNRMS 869

Query: 730 --PWNDPGPWEAPAFLKNL 746
             P N P   +  + ++N+
Sbjct: 870 KLPVNTPRNHQFVSEVRNI 888

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1024

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 84/414 (20%), Positives = 148/414 (35%), Gaps = 75/414 (18%)

Query: 214 DGDPAITGPVIATTL------ALLCGIISAAIGFLRLGFLVELISLNAVAGFMTGSAFNI 267
           D  P     +I TT+      +++ GI    +G LRLG +V     + + G + G  + +
Sbjct: 280 DAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFL 339

Query: 268 LWGQVPALMGYNSLVNTRAATYKVVIETLKHL-PDTKLDAVFGLIPLFLLYVWKWWCGTY 326
           L      + G    V TR A  +   E LK L  DT +             +WKW     
Sbjct: 340 L------ITGLG--VTTRLAKIEYTWEFLKKLFLDTDI-------------LWKWLLPVV 378

Query: 327 GPIL--NDRYNSKN----PRLHKILKWTYFYAQASRNGVIIVVFTCIGWAITRGKSKSE- 379
             IL  N +   +N    P  + +    + +  A    + +     +GW      SK   
Sbjct: 379 LTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRW 438

Query: 380 ---------RPIS---ILGSVPS--GLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIA 425
                      +    +L  +P+   L   G+ HVP         N+PA  I L ++   
Sbjct: 439 FDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVP--------INVPALAISLHMDKFD 490

Query: 426 ISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLF 485
           +              D+ELIA G SN +     +      ++ S L  +    +P +G  
Sbjct: 491 V--------------DKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYM 536

Query: 486 SGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTV 545
                   +        +IP   + ++I     +LL          K+   ++I  ++ V
Sbjct: 537 LAILTFAVMVIGPVIVSFIPICIVGSLIFLLGYELLVEALLDTR-GKVTNFEYITIVIIV 595

Query: 546 LITVFASIEDGIYFAMCWSCAMLLL---KMAFPAGKFLGRVEIAEVTDAYIKAN 596
           L         G+   +  +C   L+   K+    G+F G+V  + V   Y+++N
Sbjct: 596 LTMGIYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSN 649

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
           protein of unknown function; deletion mutant has
           decreased rapamycin resistance but normal wormannin
           resistance; green fluorescent protein (GFP)-fusion
           protein localizes to the vacuole
          Length = 1036

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 86/217 (39%), Gaps = 30/217 (13%)

Query: 384 ILGSVPS--GLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPD 441
           +L  +P+   L   G+ HVP         N+PA  + L            +++ Y V  D
Sbjct: 467 VLQQIPTMMALTFFGILHVP--------INVPALAMSL------------QMDKYDV--D 504

Query: 442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAF 501
           +ELIA G SN       +      ++ S L  +    +P +G    +  +  +       
Sbjct: 505 RELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICIMIIGPVII 564

Query: 502 FYIPKATLSAVIIHAVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFA 560
            +IP   + ++I     +LL  +   TWN  K+N  +++  ++ V          GI   
Sbjct: 565 SFIPICIVGSLIFLLGYELLVEALVDTWN--KLNRFEYLTVVIIVFTMGIFDFVLGIIVG 622

Query: 561 MCWSCAMLLL---KMAFPAGKFLGRVEIAEVTDAYIK 594
           +  +C   L+   K+    G++ G V  + V   Y++
Sbjct: 623 ILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQ 659

>KLTH0G15752g Chr7 (1373153..1376047) [2895 bp, 964 aa] {ON} similar
           to uniprot|Q12252 Saccharomyces cerevisiae YOL084W PHM7
           Protein of unknown function expression is regulated by
           phosphate levels green fluorescent protein (GFP)-fusion
           protein localizes to the cell periphery and vacuole
          Length = 964

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 76/170 (44%), Gaps = 8/170 (4%)

Query: 267 ILWGQVPALMGYNSLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVWKWWCGTY 326
           I W    A++G+ S +N    T K  +E +K LP   L  + GL+P   L +       +
Sbjct: 400 IFWAIPVAVVGFISNINFLIETLKF-LEFIKKLPKVLLGLITGLLPTVALAILMSLVPIF 458

Query: 327 GPILNDRYNSKNPRLHKILKWTYFYAQASRNGV-IIVVFTCIGWAITRGKSKSERPISIL 385
              L       + +  ++    ++YA    N V + +VFTC   A++  KS  + P S +
Sbjct: 459 IKKLGSISGCMSIQEQELYCQAWYYA---FNVVQVFIVFTCASSAVSTIKSIMDDPSSAM 515

Query: 386 GSVPSGLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRIND 435
             + + L +   F++   ++  L     +S  +  L ++ +S+  GRI D
Sbjct: 516 TLLAANLPKSSNFYINYYILQGLS---FSSGTLAQLVNLILSRFLGRILD 562

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON}
           Anc_3.485 YGR125W
          Length = 1150

 Score = 36.2 bits (82), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 84/204 (41%), Gaps = 28/204 (13%)

Query: 396 GVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455
           G+ HVP         N+PA         +A+S    +++ Y V  D+ELIA G SNL+  
Sbjct: 606 GILHVP--------INVPA---------LAMSV---QMDKYDV--DKELIAHGYSNLISG 643

Query: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515
            F +      ++ S L  +    T  +GL       + L+       +IP   + ++I  
Sbjct: 644 LFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFL 703

Query: 516 AVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLL---K 571
              +L+  +   TW   K+   ++I  ++ V          GI   +  +C   L+   K
Sbjct: 704 LGWELIVEALLDTWG--KVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTK 761

Query: 572 MAFPAGKFLGRVEIAEVTDAYIKA 595
           +    G+F G V  + V   Y+++
Sbjct: 762 LQTVNGEFNGTVAKSTVYRDYVQS 785

>Suva_6.257 Chr6 (455656..457485) [1830 bp, 609 aa] {ON} YJL176C
           (REAL)
          Length = 609

 Score = 35.4 bits (80), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 66/138 (47%), Gaps = 23/138 (16%)

Query: 586 AEVTDAYIKANSDAVSYTSENNNGIRTSEEGDEYEKDSSTKYITNSSKKIE--TNVQTKS 643
           +E++DA+     D ++ T   N  +  SEEG+E+ K+S   +  +   KI+  T  + ++
Sbjct: 30  SEISDAHKDVQEDTINKTEGINEKVGVSEEGNEHAKESINGHPEDVETKIKPTTKTEPET 89

Query: 644 FDSPSS-LITQPRMKYHTKWVPFDHKYTRELNPDIQILPP----------PEGVLVYR-- 690
           FD P +  I  P    ++KW   D  ++ E    IQ LP           PE  + YR  
Sbjct: 90  FDIPQAHEIVIPS---YSKWFNLDKIHSIE----IQSLPEFFTNRIPSKTPEVYMRYRNF 142

Query: 691 LSESYTYLNCSRHYNIIT 708
           +  SY  LN + ++++ T
Sbjct: 143 MVNSY-RLNPNEYFSVTT 159

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa]
           {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1050

 Score = 35.4 bits (80), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 89/217 (41%), Gaps = 30/217 (13%)

Query: 384 ILGSVPS--GLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPD 441
           +L  VP+   L   G+ HVP         N+PA           ++ S G ++ + V  D
Sbjct: 511 VLKQVPTMLALTFFGILHVP--------INVPA-----------LAMSIG-MDKFDV--D 548

Query: 442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAF 501
           +ELIA G SNLL  F  +      ++ S L  +    +  +G        + +       
Sbjct: 549 KELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALGTFVVMIIGPVII 608

Query: 502 FYIPKATLSAVIIHAVSDLLASYQTTWNFW-KMNPLDFICFIVTVLITVFASIEDGIYFA 560
            +IP   + ++I     +L+   +  ++ W K+N  ++I  ++ V          GI   
Sbjct: 609 SFIPICIVGSLIFLLGYELIK--EALFDTWGKLNRFEYITIVIIVFTMGVFDFVLGIIVG 666

Query: 561 MCWSCAMLLL---KMAFPAGKFLGRVEIAEVTDAYIK 594
           +  +C   L+   K+    G+F G+V  + V   YI+
Sbjct: 667 ILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQ 703

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON}
           similar to uniprot|P53273 Saccharomyces cerevisiae
           YGR125W Hypothetical ORF
          Length = 1010

 Score = 35.4 bits (80), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 83/219 (37%), Gaps = 30/219 (13%)

Query: 384 ILGSVPS--GLKEVGVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPD 441
           +L  VP+   L   G+ HVP         N+PA  + + L+ + +              D
Sbjct: 472 VLKQVPTMLALTFFGILHVPI--------NVPALAMSIGLDKLDV--------------D 509

Query: 442 QELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAF 501
           +ELIA G SN L     +      ++ S L  K      L+GL   +     +       
Sbjct: 510 KELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAAATFGIMVIGPVIV 569

Query: 502 FYIPKATLSAVIIHAVSDLL-ASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFA 560
            YIP   + ++I     +LL  +   TW   K+N  ++   +  V          GI   
Sbjct: 570 AYIPVCIVGSLIFLLGYELLKEALVDTWG--KLNNFEYATVVAIVFTMGAFDFVLGIIVG 627

Query: 561 MCWSCAMLLL---KMAFPAGKFLGRVEIAEVTDAYIKAN 596
           +  +C   L+   K+    G+F G+V  + V   YI+  
Sbjct: 628 ILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQ 666

>NDAI0D03940 Chr4 (930509..930576,930647..931172) [594 bp, 197 aa]
           {ON} Anc_4.167 YGR029W
          Length = 197

 Score = 32.7 bits (73), Expect = 3.0,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 28/72 (38%)

Query: 624 STKYITNSSKKIETNVQTKSFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPP 683
           S K      +K++      S   P +   Q R    T  +P    YTRE  PD+Q L   
Sbjct: 43  SVKTFMQDHEKVDPKSPPPSISLPINATVQTRQPIETDLIPGSRTYTREDPPDVQNLGAS 102

Query: 684 EGVLVYRLSESY 695
               ++ ++  Y
Sbjct: 103 SWTFLHAMTAKY 114

>Smik_7.6 Chr7 (15678..16796) [1119 bp, 372 aa] {ON} YGL255W (REAL)
          Length = 372

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 4/93 (4%)

Query: 38  KNNENNDAFKDNDLESNSVAKP-NAVGNGKGAKGSKIEYFNPSDVSLYDNSVS---QFEE 93
            ++  +D  KD  + +  V+ P N   NG     + +EYF  SDVS  D   S   QF  
Sbjct: 158 SHDHTHDDVKDTVVNNEVVSSPENCTANGSHDSKNGVEYFEESDVSSLDVVQSFQAQFYA 217

Query: 94  STVSLKEYYDHSIRSHLTLKGARDYLKSVFPII 126
             +       HS+   L L    +   +++P++
Sbjct: 218 FLILEFGVIFHSVMIGLNLGSTGEEFATLYPVL 250

>KAFR0E00850 Chr5 complement(178580..184180) [5601 bp, 1866 aa] {ON}
           Anc_8.555 YPL082C
          Length = 1866

 Score = 32.3 bits (72), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 643 SFDSPSSLITQPRMKYHTKWVPFDHKYTRELNPDIQILPPPEGVLVYRLS-ESYTYLNCS 701
           SFD  SSL+   + K+  K    DH +++ L P + +L  P G      S ES   L  S
Sbjct: 606 SFDVYSSLLEHYKSKHTEK--SLDHVFSKHLQPILHLLNTPIGENGKNYSMESQFILKPS 663

Query: 702 RHYNIITEKVKEVTR 716
           +HY +  EK + ++ 
Sbjct: 664 QHYQLHPEKKRSISE 678

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,932,886
Number of extensions: 4470834
Number of successful extensions: 16036
Number of sequences better than 10.0: 84
Number of HSP's gapped: 16390
Number of HSP's successfully gapped: 97
Length of query: 893
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 774
Effective length of database: 39,836,145
Effective search space: 30833176230
Effective search space used: 30833176230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)