Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1508.266ON29229215540.0
YLR091W (GEP5)8.266ON29329112391e-173
Skud_12.1598.266ON29429412141e-169
Suva_10.1758.266ON29929711581e-160
TDEL0F039308.266ON2802733342e-36
NDAI0B020108.266ON2812882695e-27
KAFR0B027408.266ON2562902572e-25
NCAS0B050408.266ON2732902545e-25
SAKL0H16940g8.266ON3032392513e-24
ZYRO0C01562g8.266ON2772132406e-23
KLTH0G13596g8.266ON2672252231e-20
Kwal_56.237778.266ON2672262213e-20
Kpol_392.48.266ON2812832118e-19
AGR082C8.266ON2662931993e-17
Ecym_43048.266ON2892921703e-13
KNAG0G020608.266ON2862901465e-10
KLLA0F19228g8.266ON3052831333e-08
CAGL0H04609g7.418ON276371910.008
TPHA0J007608.266ON24947810.075
Suva_10.3756.74ON78270760.56
CAGL0L12320g8.266ON27848730.79
KLTH0H14982gna 1ON349111731.1
KAFR0B03240singletonON25333702.1
TDEL0D010704.311ON427170693.3
Ecym_54372.618ON88442685.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.150
         (292 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...   603   0.0  
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...   481   e-173
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...   472   e-169
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...   450   e-160
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   133   2e-36
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   108   5e-27
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...   103   2e-25
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...   102   5e-25
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   101   3e-24
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...    97   6e-23
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...    91   1e-20
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...    90   3e-20
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...    86   8e-19
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...    81   3e-17
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...    70   3e-13
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    61   5e-10
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...    56   3e-08
CAGL0H04609g Chr8 complement(433499..441790) [8292 bp, 2763 aa] ...    40   0.008
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    36   0.075
Suva_10.375 Chr10 complement(657951..660299) [2349 bp, 782 aa] {...    34   0.56 
CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weak...    33   0.79 
KLTH0H14982g Chr8 (1298040..1299089) [1050 bp, 349 aa] {ON} cons...    33   1.1  
KAFR0B03240 Chr2 (669954..670715) [762 bp, 253 aa] {ON}                32   2.1  
TDEL0D01070 Chr4 (196096..197379) [1284 bp, 427 aa] {ON} Anc_4.3...    31   3.3  
Ecym_5437 Chr5 complement(896685..899339) [2655 bp, 884 aa] {ON}...    31   5.4  

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/292 (100%), Positives = 292/292 (100%)

Query: 1   MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ 60
           MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ
Sbjct: 1   MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ 60

Query: 61  DLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGK 120
           DLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGK
Sbjct: 61  DLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGK 120

Query: 121 LNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQYKF 180
           LNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQYKF
Sbjct: 121 LNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQYKF 180

Query: 181 LIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSP 240
           LIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSP
Sbjct: 181 LIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSP 240

Query: 241 ANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQWDH 292
           ANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQWDH
Sbjct: 241 ANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQWDH 292

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score =  481 bits (1239), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 229/291 (78%), Positives = 255/291 (87%)

Query: 1   MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ 60
           MAS+VN LLLPVI+S PLHQITK AL TTLT  QSDYKFKEIAVPLTK LQ++EKAQRRQ
Sbjct: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60

Query: 61  DLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGK 120
           DLR +LKALESIIYQTHF+WNNP PRHA LFQKHYHFLLTHWPFENHR LVDSIA + GK
Sbjct: 61  DLRASLKALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGK 120

Query: 121 LNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQYKF 180
           LNS  S++ WLKADW TLF VKNPWVQTPP+   LS TDLD FTPER FL+NSLGN YKF
Sbjct: 121 LNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFLINSLGNHYKF 180

Query: 181 LIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSP 240
           LIANSHLSYNHKKYPSPGVQIP+RNALGEVSP KQI++LF+RQL++IY SLF ENPPLSP
Sbjct: 181 LIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIENPPLSP 240

Query: 241 ANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQWD 291
            N++AL A+F D+T++RR +RLYMRACARAYT TNADST EPL F CT+W+
Sbjct: 241 ENELALTAVFYDETVERRLRRLYMRACARAYTTTNADSTTEPLMFHCTRWE 291

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score =  472 bits (1214), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 225/294 (76%), Positives = 253/294 (86%), Gaps = 3/294 (1%)

Query: 1   MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ 60
           M SR+  +LLP I+S+PLH+ITK AL TTL   QSDYKFKEIAVPLT+ LQV+EKAQRRQ
Sbjct: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60

Query: 61  DLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGK 120
           DLRT+LKALESII+QTHF+WNNPRPRHALLFQKH++FLL+HWPFENHR LVDSI AH GK
Sbjct: 61  DLRTSLKALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGK 120

Query: 121 LNSIPSKTTWLKADWATLFQVKNPWVQTPP---TPKNLSETDLDAFTPERAFLVNSLGNQ 177
           LNS+ SK TWLKADW TLFQVKN WVQTPP   +P      +LDAFTPER FLVNSLGN 
Sbjct: 121 LNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLVNSLGNH 180

Query: 178 YKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPP 237
           YKFL+ANSHLSYNHKKYP P VQIPIRNALGE+S  KQI++LFSRQL  IYTSLF ENPP
Sbjct: 181 YKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSLFVENPP 240

Query: 238 LSPANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQWD 291
           LS  N++ALMA+F+D ++DRR KRLYMRACARAYT  N+DSTIEPLTFRCTQW+
Sbjct: 241 LSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFRCTQWN 294

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score =  450 bits (1158), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 223/297 (75%), Positives = 246/297 (82%), Gaps = 7/297 (2%)

Query: 1   MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ 60
           M S+ N LLLP I S+PLHQITK AL T LTD  SD+KFKEIAVPLT+ LQV+EKAQR Q
Sbjct: 1   MISQANSLLLPFIDSLPLHQITKTALTTRLTDIHSDFKFKEIAVPLTESLQVYEKAQRAQ 60

Query: 61  DLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGK 120
           DLRT+LKALESI+YQTHF+WNNPRPRHA LFQKHYHFLL+HWPFENHR LVDSI A  GK
Sbjct: 61  DLRTSLKALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGK 120

Query: 121 LNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNL-------SETDLDAFTPERAFLVNS 173
           L S+ SK  WLKADW TLFQVKNPWV+TPP P +        S  +LDAFT ER FLV S
Sbjct: 121 LISLTSKGNWLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAFTAERTFLVKS 180

Query: 174 LGNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFE 233
           LGN YKFL+ NSHLSYNHKKYPSP VQIPIRNALGE+SPPKQIS+LF+RQLA IYTSLF 
Sbjct: 181 LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV 240

Query: 234 ENPPLSPANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQW 290
           ENPPLS AN++ALM +F+D T++RR  RLYMRACARAYTI NADS  EPLTFRCT W
Sbjct: 241 ENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFRCTHW 297

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  133 bits (334), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 137/273 (50%), Gaps = 24/273 (8%)

Query: 9   LLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQDLRTALKA 68
           LL  ++ +PLH  T + L   L   +     K + +PL KL+   E + R +  R  +KA
Sbjct: 9   LLKALEKLPLHSKTLDLLACKLKGDE----LKTVIIPLAKLVSNLE-SSRAETQR--IKA 61

Query: 69  LESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLN---SIP 125
           LESIIY THF W +P P H  +FQ HY  +L HWP+E HR +++        L       
Sbjct: 62  LESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWEDS 121

Query: 126 SKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQYKFLIANS 185
           SKT    A+++     KNPW++     K L+         +R  L +S+ + Y FL AN 
Sbjct: 122 SKTVLSMAEYS-----KNPWIEDNILSKKLT-------IIQRDLLFHSVFSHYLFLKANP 169

Query: 186 HLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSPANDIA 245
            L  N +  P P V+IP+R  LG      +I  LF  ++A+ Y  L  ENP LS  ++  
Sbjct: 170 RLCNNGRNLPIPIVEIPMR-PLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENI 228

Query: 246 LMAIFNDKTMDRRFKRLYMRACARAYTITNADS 278
           L  I +D +  R+ +RLY  +C RAY +   D 
Sbjct: 229 LSEIISDAS-SRKQRRLYQASCKRAYVMEYDDG 260

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  108 bits (269), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 89/288 (30%), Positives = 133/288 (46%), Gaps = 38/288 (13%)

Query: 1   MASRVNDLLLPVIQSIPLH-----QITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEK 55
           + S++   LL  +Q++PLH     Q+ +  L   +  T+S   FK   +PL  L+  +EK
Sbjct: 4   LNSKLTKTLLSSLQNLPLHSNTLAQLERKCLTRNIKATKS---FK---IPLLTLINSYEK 57

Query: 56  AQRRQDLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIA 115
           AQ     + + K LESIIY T+F+W N    H   FQ+ Y  LLT WP   H        
Sbjct: 58  AQASGQSKLSNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPHIYH-------- 109

Query: 116 AHKGKLNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDL-DAFTPERA---FLV 171
                 + I SK   +   W      KN   +       LS  +   +  P++     + 
Sbjct: 110 ------SKIDSKKNSIILTWNKSSNSKNMLREL------LSHLNYTQSLVPQKKDFQVIF 157

Query: 172 NSLGNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSL 231
             +   Y FL  N  L  N K+ PSP V+IP+ NA+G   P K+I+ L   ++A  +  L
Sbjct: 158 KKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPM-NAMGYDIPKKRINNLLRSKIARTWNYL 216

Query: 232 FEENPPLSPANDIALMAIFNDKTM--DRRFKRLYMRACARAYTITNAD 277
              NP L+  N+  L  I N  +    R+ ++LY RAC+ +Y I N D
Sbjct: 217 AITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYVIKNED 264

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score =  103 bits (257), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 129/290 (44%), Gaps = 45/290 (15%)

Query: 1   MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ 60
           +   V D +   I+ +PLHQ T   L  TL    +      +A+PL + +  +E   +  
Sbjct: 12  VTKEVRDKITNAIEGLPLHQKTLLQLQDTLKRNDA------LAIPLLRDVVSYETTGKS- 64

Query: 61  DLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGK 120
                 K LESIIY+ +F+W N  P H       Y  L ++WP E H             
Sbjct: 65  ------KFLESIIYRLYFQWLNEVPSHLKPLLNQYEHLKSNWPIERH------------- 105

Query: 121 LNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQYKF 180
              I  K    +A       ++N W++   T  +LS +D          ++  + N +++
Sbjct: 106 ---IKFKNAEPEA-----ISLRNAWMRNKATAVDLSTSD---------GVIKPILNHFRY 148

Query: 181 LIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSP 240
           L  N       KK   P +++P+ N  G   P  +++ L  +++A++  SL E+NP LSP
Sbjct: 149 LRVNED-RLCKKKVGLPILEVPL-NVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSP 206

Query: 241 ANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQW 290
             +  L +I ND    R  KR+Y+R+C+RAYT  +       +TF    W
Sbjct: 207 KLEDTLHSIINDSKNTRALKRVYLRSCSRAYTGESNPKDSSNITFHIIDW 256

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score =  102 bits (254), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 85/290 (29%), Positives = 132/290 (45%), Gaps = 32/290 (11%)

Query: 1   MASRVNDLLLPVIQSIPLHQITKNAL---VTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQ 57
           M   V   LL  + ++PLH+ T + L   + T  D  + + FK   VPL +LL  +E+  
Sbjct: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFK---VPLLQLLCKYERYN 57

Query: 58  RRQDLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAH 117
            ++D R   K LESI Y T+F WNNP P H  +FQK+   L  +WP   HR         
Sbjct: 58  IQEDKRGIEKVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHR-------GM 110

Query: 118 KGKLNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQ 177
             K +SI  +  W K++      +K       P             + E   +   +   
Sbjct: 111 DTKRDSIIVQ--WAKSNNGDAL-LKGTMNHIQP-----------GASAEELLMFKKIFQH 156

Query: 178 YKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPP 237
           Y FL  N+ ++ N K+   P V +P+ N++GE  P  ++  LF +++++   +L   NP 
Sbjct: 157 YIFLTLNARITSNAKRLQPPLVGVPM-NSMGETIPQVRVKNLFRKKVSWTANALCALNPV 215

Query: 238 LSPANDIALMAIFND--KTMDRRFKRLYMRACARAYTITNADSTIEPLTF 285
           L+  N   L  I N   +   R  +RLY RA   A+ I  A  + E + F
Sbjct: 216 LNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHVI--AGESPESIQF 263

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  101 bits (251), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/239 (30%), Positives = 112/239 (46%), Gaps = 30/239 (12%)

Query: 67  KALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNSIPS 126
           K+LE I+Y T+F WNN  P H   F+++YH L  HWP+E HR L+   A  +  +  + +
Sbjct: 53  KSLEWIVYNTYFHWNNTTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWN 112

Query: 127 KTTWLKADWATLFQVKNPWVQTPPTPK----NLSET-DLDAFTPER-------------- 167
                K   +++   +NPW +  P  +    N+++  +  A   E+              
Sbjct: 113 DNN--KKVLSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQ 170

Query: 168 ---AFLVNSLGNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQL 224
                L + +   Y FL  N  L    KK P P V+IP++  LG+  P  +I  LF R+ 
Sbjct: 171 LELTLLFHEIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMK-PLGQDIPLVRIRNLFKRKA 229

Query: 225 AYIYTSLFEENPPLSPANDIALMAIF-----NDKTMDRRFKRLYMRACARAYTITNADS 278
           A  +  L EENP LS  N+  L+ I      +    +R+ KRLY RAC  +Y I    S
Sbjct: 230 AATWKLLAEENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRS 288

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score = 97.1 bits (240), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 107/213 (50%), Gaps = 20/213 (9%)

Query: 67  KALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNSIPS 126
           K LE++I +THF W+NP P     FQ ++  L  HWP+E  R L+      K     +  
Sbjct: 58  KYLEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYL-- 115

Query: 127 KTTWLKADWATLFQV---KNPWVQTPPTPKNLSETDLDAFTPERAF-LVNSLGNQYKFLI 182
              W       L  +   K+ W           E  ++  +PE+   L++S+ +QY FL 
Sbjct: 116 ---WRDGKELALSNLRFEKHRWA---------DENIIERLSPEQGTQLLHSIFHQYFFLK 163

Query: 183 ANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSPAN 242
           +++ L YN++K P P V+IP+R    +V+  + I  LF R+ A ++  L  EN PLS  N
Sbjct: 164 SHARLCYNNRKIPVPIVEIPLRPMGNDVADCR-IRNLFKRKTAVVWNLLAWENRPLSTRN 222

Query: 243 DIALMAIFNDKTMDRRFKRLYMRACARAYTITN 275
           +  L  I   K+  R  +RLY RA  RAY +TN
Sbjct: 223 EQLLGEIIT-KSETRSMRRLYQRASRRAYVVTN 254

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score = 90.5 bits (223), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 106/225 (47%), Gaps = 41/225 (18%)

Query: 67  KALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNSIPS 126
           K+LESI++ T+F W N    H   F++HY  L  HWP+E HR +          L+    
Sbjct: 47  KSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSI----------LSMDTP 96

Query: 127 KTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAF---TPERAFLVNSLG-------- 175
           KT  ++  W++             +PK LS+   + +   T ER   +  L         
Sbjct: 97  KTQSIRFLWSS------------NSPKVLSKMSYEKYAHDTEERPSRLTELQRTVQFHEV 144

Query: 176 -NQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEE 234
              + FL +  HL    K    P V+IP++  LG+  P  ++  LF R++AY++  L  +
Sbjct: 145 FQHFLFLKSRPHLCKTRKGLAVPIVEIPMK-PLGQNIPEVRVRNLFKRKIAYVWKVLALD 203

Query: 235 NPPLSPANDIALMAIFN------DKTMDRRFKRLYMRACARAYTI 273
           +P LS  N+++L  I +      D +  R  KRLY RAC  AYTI
Sbjct: 204 SPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAYTI 248

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score = 89.7 bits (221), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 103/226 (45%), Gaps = 25/226 (11%)

Query: 58  RRQDLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAH 117
           R+ + +   K LE+II+ T+F W N  P+H   F++HY+ L   WP+E HR ++      
Sbjct: 38  RQYEAKKDYKTLENIIHHTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILG----- 92

Query: 118 KGKLNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLS---ETDLDAFTP-ERAFLVNS 173
              + S  S++         L+   NP V       +     E   +  T  ER    + 
Sbjct: 93  ---MQSPKSQSIRF------LWSAGNPRVLAAMRYGSYGWNREGGGERLTELERTLRFHE 143

Query: 174 LGNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFE 233
           +   + FL     L  N K    P V+IP++  LG+     +I  LF R++AY++  L  
Sbjct: 144 IFQHFLFLQRRPQLCKNRKHLSVPIVEIPMK-PLGQNIADVRIKNLFKRKVAYVWRILAV 202

Query: 234 ENPPLSPANDIALMAIFN------DKTMDRRFKRLYMRACARAYTI 273
           +NP LS  N+  LM I         +T  R  KRLY RAC  AY I
Sbjct: 203 DNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGAYVI 248

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score = 85.9 bits (211), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 132/283 (46%), Gaps = 27/283 (9%)

Query: 1   MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ 60
           +  R+  +LL  ++ +PLH+ T + L   +    +D  F E  V +   L  +E ++   
Sbjct: 7   LGKRLKPILLESLERLPLHKPTLDILERRIH--VADLPFMEEYVGI---LNEYEISKINS 61

Query: 61  DLRTALKALESIIYQTHFKWNNPR-PRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKG 119
            +    +ALE I+ +TH  WNN + P H   F+ HY  LL HWP+E H  +++      G
Sbjct: 62  KVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTG 121

Query: 120 KL-----NSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSL 174
            L     N+      + K+      Q+ N W  +    K   E        +R  + N +
Sbjct: 122 SLIYLCLNNDDRFFNFYKS------QINNKWFNSVDQYKLTDE--------QRVSIYNDI 167

Query: 175 GNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEE 234
             Q  FL  ++ +S  +K    P V++P++  +G   P  +I  LF++++ YI+  L   
Sbjct: 168 FKQIFFLKRHTTISEVNKNM-VPIVEVPLK-PIGCDIPACRIKNLFNKKVDYIWKLLSLS 225

Query: 235 NPPLSPANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNAD 277
           +P +S +++  +M I  D   +RR  RLY R+   +Y   + +
Sbjct: 226 SPAISLSHEKIIMNILEDTKDNRRINRLYRRSLKNSYVFDDTN 268

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score = 81.3 bits (199), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 133/293 (45%), Gaps = 34/293 (11%)

Query: 5   VNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFK--EIAVPLTKLLQVHEKAQRRQDL 62
           +N+ +  ++  +PLH+ T   ++  L+  Q+ Y  +  E+  PL   L+           
Sbjct: 1   MNEHIQRIVSRLPLHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLR----------- 49

Query: 63  RTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLN 122
           +   + L+ +++  HF+     P H  L ++H   L   WP+E H  L+         + 
Sbjct: 50  KGGHQGLQRLVFHVHFQLMLRAPEHLRLLRRHREELQRFWPYERHHSLLAL-----SDVR 104

Query: 123 SIPSKTTWLKADWATLFQV---KNPWVQTPPTPKNLSETDLDAFTPERAFLVNSLGNQYK 179
           S   +  W       L Q+   ++ W++    P+  + T       +R  +++ +  QY 
Sbjct: 105 SQSLRRLWEDGQEEVLQQMQYCRHHWLREGDVPERYALTQ-----AQREEVLHRVFAQYM 159

Query: 180 FLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLS 239
           FL     L ++ ++ P P V+I +   LG   P  ++  LF  +   +   L+ E+P L+
Sbjct: 160 FLKQRPAL-WSVRRLPIPVVEIGM-TPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALT 217

Query: 240 PANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPLTFRCTQWDH 292
           PA +  ++ I  +    R  +R+Y+RAC RAY + +AD+ +    FR ++  H
Sbjct: 218 PAAEEDMLRIIAE-CPTRAMRRIYLRACRRAYVL-DADAQL----FRVSRLRH 264

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 120/292 (41%), Gaps = 45/292 (15%)

Query: 5   VNDLLLPVIQSIPLHQITKNALVTTLTDT-QSDYKFKEIAVPLTKLLQVHEKAQRRQDLR 63
           +N  +L ++  +PLH  TK  +   +    + ++K  ++  P+ + L           L 
Sbjct: 4   MNRKVLEIVSRLPLHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYL-----------LS 52

Query: 64  TALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNS 123
             +  L  +I+  +F+  NP+  H   F+++   L   WP+E H  L+     +K     
Sbjct: 53  GEVSYLRRVIFDVYFRILNPKAEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARY 112

Query: 124 IPSKTT-------------WLK---------ADWATLFQVKNPWVQTPPTPKNLSETDLD 161
           + S+               WL+         + +   F  +  +++       L ET   
Sbjct: 113 LWSRNNAKVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGET--- 169

Query: 162 AFTPERAFLVNSLGNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFS 221
               ER  L+  + + Y F+ +   L   HK  P P V++ + + LGE  P  +I  LF 
Sbjct: 170 ----ERIALLKLIFSHYLFVKSRPTLC-GHKNLPIPIVEVGM-SPLGEDMPDVRIDNLFR 223

Query: 222 RQLAYIYTSLFEENPPLSPANDIALMAIFNDKTMDRRFKRLYMRACARAYTI 273
           ++      +L  + PPLS   +  L +I   K  DR   RLY  +C  AYT+
Sbjct: 224 KRSKATLKTLLHDFPPLSREVESLLHSII--KECDRSMGRLYKWSCNGAYTM 273

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 60.8 bits (146), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 114/290 (39%), Gaps = 47/290 (16%)

Query: 5   VNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQDLRT 64
           V   LL  ++S+PLH +T   L   +  T+S  + K +A  L     V    +  Q    
Sbjct: 4   VRTGLLRELRSLPLHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQ---- 59

Query: 65  ALKALESIIYQTHFKWNNPRPR------HALLFQKHYHFLLTHWPFENHRLLVDSIAAHK 118
             K L +++ Q + +W+N   R      H   F++ +  L+  WP E+H  L  S   H 
Sbjct: 60  -YKILTTLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGH- 117

Query: 119 GKLNSIPSKTTWLKADWAT----LFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSL 174
                       LK  W T      Q+        PT  N+          E    +  +
Sbjct: 118 ----------ATLKHAWVTNNKHALQMSFDAAAANPTSGNI----------ELRGSLRQI 157

Query: 175 GNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEE 234
            + Y+ L  N  + +   K   P  +IP+ N  GE  P  + + L  R++ Y+   L EE
Sbjct: 158 LSHYQLLYNNMRM-FGKIKLQVPVAEIPL-NVFGEEIPACRTANLLQRKVGYVKRVLIEE 215

Query: 235 NPPLSPANDIA-LMAIF--------NDKTMDRRFKRLYMRACARAYTITN 275
            P L     IA L AI         +     R+ +RLY RA A  YT+ +
Sbjct: 216 LPALYNTECIAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCYTLAS 265

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 117/283 (41%), Gaps = 34/283 (12%)

Query: 18  LHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQDLRTALKALESIIYQTH 77
           LH ITK+A+  +  DT    K  E    L +L   +E   R        K LE ++Y  H
Sbjct: 15  LHSITKDAI--SKVDTFPKNKQHET---LHRLNSFNENPTR--------KTLEKLVYSVH 61

Query: 78  FKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNSIPSKTTWLKADWAT 137
           F   N  P+H  + +++ + L   WP+E    +++    +      + S+      D+ +
Sbjct: 62  FHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFLS 121

Query: 138 LFQVKNPWV-----QTPPTPKNLSETDLDAFTPERAFLV------------NSLGNQYKF 180
             + K  W+     QTP        T +D     +   V              +   Y F
Sbjct: 122 FNRHK--WLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYF 179

Query: 181 LIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSP 240
           L  N  L    KK  +P V+I ++    +++  + I  LF +++  I   L+ +NP L+ 
Sbjct: 180 LKTNPKLCAT-KKLQAPIVEIGMKPDGFDIADIR-IDNLFKKKVKLISDLLYSQNPVLTS 237

Query: 241 ANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPL 283
             +  L +I ND  ++RR KRLY    +R+Y   +    I  L
Sbjct: 238 DAESILTSIVNDPDLNRRTKRLYKNVASRSYLFKDGKFEISEL 280

>CAGL0H04609g Chr8 complement(433499..441790) [8292 bp, 2763 aa] {ON}
            similar to uniprot|P38110 Saccharomyces cerevisiae
            YBL088c TEL1
          Length = 2763

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 7/71 (9%)

Query: 51   QVHEKAQRRQDLRTALKALESIIYQTHFKWNNPRPRHALLFQKHYHFLLTHWPFENHRLL 110
            Q+ EK +  +  R  LK +ES++     K +N      L+ QKHYH L TH   EN RL 
Sbjct: 2129 QLKEKQKSYRRTRQELKDIESVV-----KSSNLSNEELLVGQKHYHNLKTH--MENDRLA 2181

Query: 111  VDSIAAHKGKL 121
            +++I   + KL
Sbjct: 2182 IENICLTRKKL 2192

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 35.8 bits (81), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 66  LKALESIIYQTHFKWNNPRPR--HALLFQKHYHFLLTHWPFENHRLL 110
           LK L+ II++TH  +NN      H   F+  Y++L  +WP+E H +L
Sbjct: 72  LKCLQRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERHDIL 118

>Suva_10.375 Chr10 complement(657951..660299) [2349 bp, 782 aa] {ON}
           YLR277C (REAL)
          Length = 782

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 1/70 (1%)

Query: 199 VQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSPAND-IALMAIFNDKTMDR 257
           VQ  ++  + EVS  KQISRLF  Q    +T L +++   +   D I  +      T   
Sbjct: 689 VQSFVQTKMDEVSKAKQISRLFKEQFGECFTLLLDKDEDTNSKQDTINGIVTIGKNTAKI 748

Query: 258 RFKRLYMRAC 267
            F  + +  C
Sbjct: 749 DFNNMKILEC 758

>CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q12393 Saccharomyces cerevisiae
           YLR091w
          Length = 278

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 22/48 (45%)

Query: 82  NPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNSIPSKTT 129
           N  P H   +Q  YH L+  WP    R ++D++   KG    IP   T
Sbjct: 70  NELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRIPHNKT 117

>KLTH0H14982g Chr8 (1298040..1299089) [1050 bp, 349 aa] {ON}
           conserved hypothetical protein
          Length = 349

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 48/111 (43%), Gaps = 5/111 (4%)

Query: 36  DYKFKEIAVPLTKLLQVHEKAQRRQDLRTALKALESIIYQTHFKWNNPRPRHALLFQKHY 95
           D+  +E+ +  T   Q  E+     D+++     ++ I  THF      PR A  F++ Y
Sbjct: 37  DFTQEEVDILFTLSKQFFEETP--DDVKSQYSINKNNIGYTHFTNEQLDPRKARDFKEGY 94

Query: 96  HFLLTHWPFENHRLLVDSIAAHKGKLNSIPSKTTWLKADWATLFQVKNPWV 146
           +F   ++      +  D    + GK N+   +T+  K D  T FQ K   +
Sbjct: 95  NFGFINFKTGQFNINEDE---YMGKENTDSQRTSGSKNDVPTFFQSKQELI 142

>KAFR0B03240 Chr2 (669954..670715) [762 bp, 253 aa] {ON} 
          Length = 253

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 22/33 (66%)

Query: 196 SPGVQIPIRNALGEVSPPKQISRLFSRQLAYIY 228
           +PG+ +PI + +G+    K ++R+F   ++YIY
Sbjct: 153 NPGIDLPIHSGIGDFYDYKPLARIFQSLISYIY 185

>TDEL0D01070 Chr4 (196096..197379) [1284 bp, 427 aa] {ON} Anc_4.311
           YLR431C
          Length = 427

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 66/170 (38%), Gaps = 22/170 (12%)

Query: 12  VIQSIP-LHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ--DLRTALKA 68
           V+QS+  LH    N L       QS  + KE+   +TK     EK  + Q   +R    A
Sbjct: 150 VLQSVKVLHSCHDNVL-------QSVKQLKELLNDITKDQAFIEKEMKAQVARIRRETSA 202

Query: 69  LESIIYQTHFKWNNPRPRHALLF-------QKHYHFLLTHWPFENHRLLVDSIAAHKG-- 119
           ++  + +   K  N   +  L         QK +H  L     +   L  + IA+H    
Sbjct: 203 IDDELRKNSSKRKNLLAKVGLALPDETSTAQKLFHLKLNDQRDKQLELEQEDIASHANEF 262

Query: 120 ---KLNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPE 166
              K+ S+  + T  K D   L  V++ W     + KNL +    A T +
Sbjct: 263 LDMKIASLQDQLTHRKDDSYQLIHVRDSWSDCVDSVKNLEDRLRSALTGD 312

>Ecym_5437 Chr5 complement(896685..899339) [2655 bp, 884 aa] {ON}
           similar to Ashbya gossypii ADR128C
          Length = 884

 Score = 30.8 bits (68), Expect = 5.4,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 37  YKFKEIAVPLTKLLQVHEKAQRRQDLRTALKALESIIYQTHF 78
           Y  KE     +KL Q++   + R+ L+T L  LES++Y T +
Sbjct: 594 YSSKEKINARSKLAQLNRSDKEREQLQTQLNHLESLLYDTMY 635

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.133    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,675,982
Number of extensions: 1353877
Number of successful extensions: 3322
Number of sequences better than 10.0: 36
Number of HSP's gapped: 3381
Number of HSP's successfully gapped: 40
Length of query: 292
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 183
Effective length of database: 40,982,805
Effective search space: 7499853315
Effective search space used: 7499853315
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)