Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1498.264ON46046021380.0
YLR090W (XDJ1)8.264ON45946017840.0
Suva_10.1748.264ON45646016620.0
Skud_12.1588.264ON45546016510.0
NDAI0B020008.264ON4334577833e-99
TDEL0F039108.264ON4294297702e-97
SAKL0H16984g8.264ON4354467451e-93
NCAS0B050308.264ON4334447251e-90
Kpol_543.408.264ON4144386952e-86
AGR084C8.264ON4274606822e-84
KLTH0G13640g8.264ON4144286717e-83
Ecym_43068.264ON4344706702e-82
Kwal_56.237828.264ON4144326385e-78
KLLA0F19184g8.264ON5124666431e-77
TPHA0A017908.264ON4394606302e-76
CAGL0L12276g8.264ON4524545902e-70
ZYRO0C01606g8.264ON4323215473e-64
KNAG0G020508.264ON4324675403e-63
TBLA0E038102.243ON4104033847e-41
Kpol_1003.122.243ON4084033714e-39
KAFR0J009402.243ON4113923663e-38
Skud_14.2682.243ON4104043592e-37
YNL064C (YDJ1)2.243ON4093893583e-37
ADL257C2.243ON4103913566e-37
Smik_14.2632.243ON4093893504e-36
SAKL0E08734g2.243ON4114523487e-36
CAGL0J09966g2.243ON4074053471e-35
ZYRO0A01496g2.243ON4124053461e-35
KLLA0F03333g2.243ON4093923433e-35
Kwal_23.48302.243ON4114033409e-35
Kwal_23.30612.218ON4584473211e-31
NDAI0D010302.243ON4114163066e-30
TDEL0C043502.218ON4623903061e-29
AER427W2.218ON4703832751e-25
TPHA0C031102.243ON4072742582e-23
SAKL0E09306g2.218ON4614212573e-23
TDEL0C046002.243ON4112752554e-23
Ecym_32812.243ON4092612502e-22
KLLA0C07260g8.730ON3683822473e-22
Kpol_1002.1222.218ON5032562503e-22
SAKL0H05258g8.730ON3683822446e-22
KNAG0I019002.243ON4092642432e-21
Suva_13.3978.730ON3753872412e-21
Suva_14.2772.243ON4092742413e-21
KLTH0G09394g2.243ON4112762394e-21
NCAS0G030002.243ON4102722387e-21
Ecym_62368.730ON3743712322e-20
NCAS0G028502.218ON4942492352e-20
Smik_14.2492.218ON5332582353e-20
Skud_14.2532.218ON5322472335e-20
YNL077W (APJ1)2.218ON5282412326e-20
CAGL0F03729g8.730ON3613672261e-19
KLLA0E07899g2.218ON4952602247e-19
Suva_14.2622.218ON5362462202e-18
ZYRO0C15048g2.218ON4913032112e-17
KNAG0G028808.730ON3783692075e-17
Ecym_53842.218ON5032992086e-17
TPHA0C029802.218ON5542362042e-16
KLTH0G08756g2.218ON4624062023e-16
CAGL0J10296g2.218ON4792511934e-15
NDAI0F024502.218ON5302651927e-15
KNAG0M020202.218ON4602481917e-15
TBLA0E036602.218ON4482591901e-14
NDAI0E008708.730ON3763851862e-14
CAGL0H03707g1.398ON349691791e-13
TBLA0C014801.398ON353711782e-13
NDAI0G042501.398ON363691754e-13
YNL007C (SIS1)1.398ON352691755e-13
AAL008W1.398ON349691747e-13
Suva_14.3411.398ON359691747e-13
Kpol_1064.408.730ON3872401731e-12
KAFR0A041608.730ON3782431721e-12
NDAI0C026101.398ON340691711e-12
TPHA0B037601.398ON355691711e-12
Kpol_457.151.398ON357681693e-12
KAFR0H031501.398ON359691693e-12
TPHA0G006308.730ON3932431693e-12
Kwal_0.2071.398ON353691683e-12
AER346W8.730ON3673771684e-12
ZYRO0E04598g1.398ON357691684e-12
NCAS0G036101.398ON327691674e-12
SAKL0D08778g1.398ON348691674e-12
NCAS0C048901.398ON367691675e-12
KLTH0H12100g1.398ON350691666e-12
KLLA0D04818g1.398ON354691666e-12
TDEL0B059601.398ON369691667e-12
TBLA0D042407.217ON389711668e-12
Skud_14.3201.398ON368691659e-12
Smik_14.3211.398ON366691651e-11
KLTH0A03740g7.217ON395671651e-11
TBLA0E024907.217ON366701641e-11
KNAG0H016801.398ON363691632e-11
Kwal_26.90248.730ON3752421632e-11
Ecym_12921.398ON347691613e-11
TDEL0H022907.217ON387711613e-11
NCAS0E029307.217ON387691604e-11
Smik_13.4228.730ON378691595e-11
ZYRO0A06226g8.730ON377691595e-11
NDAI0E045607.217ON394711595e-11
TPHA0C012607.217ON380711587e-11
Kpol_1070.227.217ON380711587e-11
YMR214W (SCJ1)8.730ON377691588e-11
TDEL0B037908.730ON373691579e-11
Ecym_43727.217ON579731599e-11
CAGL0J02750g7.217ON382711571e-10
Skud_13.3838.730ON3752491561e-10
NCAS0B005308.730ON375691561e-10
CAGL0J07370g2.15ON623641581e-10
Kwal_47.181337.217ON393691561e-10
KLLA0E04423g7.217ON428691562e-10
Smik_14.1062.15ON593641553e-10
Skud_5.1587.217ON391691533e-10
KLTH0D12496g8.730ON375671533e-10
TPHA0C045902.350ON233761475e-10
KNAG0L013307.217ON396711507e-10
Skud_13.3232.350ON224761458e-10
YMR161W (HLJ1)2.350ON224761458e-10
SAKL0F08052g7.217ON393711508e-10
YNL227C (JJJ1)2.15ON590641501e-09
KLLA0D19602g2.15ON620681491e-09
TDEL0G028002.350ON225731441e-09
KLTH0F09944g2.350ON233731441e-09
Smik_5.1737.217ON391691481e-09
YER048C (CAJ1)7.217ON391691472e-09
TPHA0G014808.698ON660711482e-09
ZYRO0A07502g2.350ON238731432e-09
TBLA0B034908.730ON3842451462e-09
Suva_12.1851.113ON168641392e-09
TPHA0L007907.157ON446671472e-09
ZYRO0F15400g2.15ON525641472e-09
SAKL0E06050g2.350ON232731423e-09
Smik_13.3612.350ON224761413e-09
Suva_14.1162.15ON600641473e-09
TBLA0J018707.157ON470671444e-09
ABL194C2.15ON552661454e-09
SAKL0E14234g2.15ON678751455e-09
NCAS0D009602.350ON224761395e-09
NDAI0F038002.15ON638661455e-09
Kpol_1072.48.698ON661701455e-09
Smik_9.2037.157ON432671435e-09
Suva_13.3402.350ON225761387e-09
Kwal_23.44202.15ON592641447e-09
NCAS0G013602.15ON616661447e-09
Kpol_529.212.15ON622661437e-09
Skud_14.1102.15ON596641438e-09
KNAG0F008602.15ON626641438e-09
KAFR0L007407.217ON364711418e-09
ZYRO0D16390g7.217ON398711428e-09
Skud_9.1817.157ON421671429e-09
Suva_9.2137.157ON431691429e-09
TBLA0G001702.15ON659641421e-08
Suva_8.3038.698ON664751421e-08
Kpol_526.62.350ON228761371e-08
KLLA0E01629g2.350ON231731371e-08
Suva_5.1507.217ON391691401e-08
KAFR0H023108.698ON655701411e-08
KAFR0A079502.15ON551641411e-08
ADR015W7.157ON436671392e-08
KNAG0I008602.350ON219711352e-08
KLTH0B08338g2.15ON590641402e-08
AFR507W8.61ON474661402e-08
CAGL0L00957g7.217ON373701382e-08
NDAI0D005001.113ON190801332e-08
YIR004W (DJP1)7.157ON432691392e-08
Skud_10.3191.113ON168641322e-08
CAGL0H04499g2.350ON232731352e-08
KNAG0J018408.698ON650701402e-08
Smik_15.4378.698ON663781392e-08
Kwal_23.3578singletonOFF85671252e-08
TBLA0B093802.350ON227761342e-08
NDAI0H031802.350ON229761343e-08
YOR254C (SEC63)8.698ON663781383e-08
TPHA0O019402.15ON598671383e-08
TPHA0D005508.61ON486671373e-08
TBLA0A011007.157ON434711373e-08
Skud_15.4208.698ON665751384e-08
TDEL0E005002.15ON581641374e-08
KNAG0I007407.157ON425671355e-08
NDAI0A028207.157ON482671356e-08
Ecym_56262.350ON243731317e-08
CAGL0G07469g8.698ON668701358e-08
AFL190C2.350ON235731309e-08
SAKL0F04444g7.157ON429671331e-07
Ecym_44697.157ON433691331e-07
KLLA0D13464g7.157ON433671321e-07
KNAG0G011308.61ON500641331e-07
TBLA0J009701.185ON586641331e-07
NCAS0C012208.698ON669701331e-07
AFR639W1.113ON156641251e-07
KAFR0B047807.157ON423671312e-07
CAGL0C04565g1.113ON175751252e-07
TDEL0H032107.157ON411671312e-07
ZYRO0F15972g1.113ON162641242e-07
ZYRO0D10934g8.698ON663701322e-07
KLLA0C09823g8.698ON669911312e-07
Smik_10.3851.113ON172641242e-07
KAFR0B048902.350ON220761262e-07
CAGL0J01936g7.157ON425671303e-07
KAFR0C031608.61ON4981241303e-07
KNAG0A056502.350ON175691233e-07
KAFR0A016201.297ON665661303e-07
NCAS0C039508.61ON5191071293e-07
SAKL0D06226g1.297ON615741294e-07
TPHA0B041901.113ON168741224e-07
TBLA0B037308.698ON693701294e-07
NCAS0A132107.157ON414671284e-07
KLTH0F13398g7.157ON419671275e-07
SAKL0C03476g1.113ON165661215e-07
KLLA0D06402g1.297ON631731277e-07
Kpol_499.307.157ON408671268e-07
Suva_6.448.61ON5071261268e-07
Kpol_1027.131.297ON641661269e-07
KNAG0B052401.297ON668731269e-07
NCAS0A093201.297ON635751269e-07
ADL111W7.217ON578671251e-06
KLTH0F03124g1.113ON162641181e-06
Kwal_55.209657.157ON421671241e-06
TPHA0A028101.185ON492651242e-06
ADR124C1.297ON611671242e-06
TBLA0C027201.297ON715671232e-06
TDEL0C058801.113ON159651162e-06
TDEL0A064308.698ON666701223e-06
KLLA0B07271g1.185ON653791223e-06
YJR097W (JJJ3)1.113ON172641153e-06
TBLA0D026008.61ON510671213e-06
Ecym_14508.61ON492671204e-06
Kwal_26.88798.698ON656701205e-06
Kwal_14.24521.297ON607661205e-06
KLLA0C02981g1.113ON162681135e-06
KLTH0H10032g1.297ON607661197e-06
YJL073W (JEM1)1.297ON645741197e-06
Suva_6.1481.297ON642681197e-06
TBLA0A055601.92ON312791177e-06
SAKL0H05984g8.698ON658701189e-06
Smik_10.1681.297ON649771189e-06
ZYRO0G03850g7.157ON418671171e-05
YJL162C (JJJ2)1.185ON583681171e-05
Kwal_33.138601.185ON578641171e-05
AAL103W8.698ON669701161e-05
CAGL0H02827g1.297ON656671161e-05
NCAS0H005501.113ON174771102e-05
Skud_10.1691.297ON644771162e-05
KLTH0D11770g8.698ON652701152e-05
KNAG0B018901.92ON370701142e-05
Ecym_11101.113ON156641092e-05
CAGL0I06226g1.185ON455641142e-05
TDEL0C008708.61ON4701281142e-05
NDAI0K012308.698ON680701143e-05
KAFR0F018101.185ON555641133e-05
TDEL0D016401.297ON604731133e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.149
         (460 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   828   0.0  
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   691   0.0  
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   644   0.0  
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   640   0.0  
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    306   3e-99
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   301   2e-97
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   291   1e-93
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    283   1e-90
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   272   2e-86
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   267   2e-84
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   263   7e-83
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   262   2e-82
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   250   5e-78
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...   252   1e-77
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   247   2e-76
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   231   2e-70
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   215   3e-64
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   212   3e-63
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   152   7e-41
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   147   4e-39
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   145   3e-38
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   142   2e-37
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   142   3e-37
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   141   6e-37
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   139   4e-36
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   138   7e-36
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   138   1e-35
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   137   1e-35
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   136   3e-35
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   135   9e-35
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   128   1e-31
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   122   6e-30
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   122   1e-29
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   110   1e-25
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   103   2e-23
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   103   3e-23
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   102   4e-23
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   100   2e-22
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   100   3e-22
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...   100   3e-22
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...    99   6e-22
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...    98   2e-21
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...    97   2e-21
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...    97   3e-21
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...    97   4e-21
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...    96   7e-21
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...    94   2e-20
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     95   2e-20
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    95   3e-20
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    94   5e-20
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    94   6e-20
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...    92   1e-19
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...    91   7e-19
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    89   2e-18
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...    86   2e-17
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...    84   5e-17
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    85   6e-17
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    83   2e-16
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...    82   3e-16
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...    79   4e-15
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    79   7e-15
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...    78   7e-15
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    78   1e-14
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...    76   2e-14
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    74   1e-13
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    73   2e-13
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    72   4e-13
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    72   5e-13
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    72   7e-13
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    72   7e-13
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    71   1e-12
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...    71   1e-12
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               70   1e-12
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    70   1e-12
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    70   3e-12
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    70   3e-12
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...    70   3e-12
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    69   3e-12
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    69   4e-12
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    69   4e-12
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      69   4e-12
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    69   4e-12
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     69   5e-12
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    69   6e-12
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    69   6e-12
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    69   7e-12
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    69   8e-12
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    68   9e-12
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    68   1e-11
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    68   1e-11
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    68   1e-11
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    67   2e-11
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    67   2e-11
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    67   3e-11
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    67   3e-11
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     66   4e-11
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...    66   5e-11
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...    66   5e-11
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             66   5e-11
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    65   7e-11
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    65   7e-11
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...    65   8e-11
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...    65   9e-11
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    66   9e-11
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    65   1e-10
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...    65   1e-10
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730       65   1e-10
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    65   1e-10
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    65   1e-10
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    65   2e-10
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    64   3e-10
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    64   3e-10
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...    64   3e-10
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    61   5e-10
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    62   7e-10
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    60   8e-10
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    60   8e-10
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    62   8e-10
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    62   1e-09
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    62   1e-09
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    60   1e-09
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    60   1e-09
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    62   1e-09
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    61   2e-09
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    62   2e-09
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    60   2e-09
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    61   2e-09
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    58   2e-09
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    61   2e-09
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    61   2e-09
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    59   3e-09
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    59   3e-09
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    61   3e-09
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    60   4e-09
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    60   4e-09
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    60   5e-09
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    58   5e-09
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      60   5e-09
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    60   5e-09
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    60   5e-09
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    58   7e-09
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    60   7e-09
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    60   7e-09
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    60   7e-09
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    60   8e-09
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    60   8e-09
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    59   8e-09
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    59   8e-09
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    59   9e-09
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    59   9e-09
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    59   1e-08
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    59   1e-08
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    57   1e-08
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    57   1e-08
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    59   1e-08
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    59   1e-08
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    59   1e-08
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    58   2e-08
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    57   2e-08
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    59   2e-08
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    59   2e-08
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    58   2e-08
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    56   2e-08
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    58   2e-08
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    55   2e-08
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    57   2e-08
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    59   2e-08
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    58   2e-08
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    53   2e-08
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    56   2e-08
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      56   3e-08
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    58   3e-08
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    58   3e-08
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    57   3e-08
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    57   3e-08
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    58   4e-08
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    57   4e-08
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    57   5e-08
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    57   6e-08
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    55   7e-08
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    57   8e-08
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    55   9e-08
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    56   1e-07
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    56   1e-07
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    55   1e-07
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    56   1e-07
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    56   1e-07
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     56   1e-07
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    53   1e-07
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               55   2e-07
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    53   2e-07
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    55   2e-07
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    52   2e-07
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    55   2e-07
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    55   2e-07
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    52   2e-07
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    53   2e-07
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    55   3e-07
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    55   3e-07
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    52   3e-07
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    55   3e-07
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    54   3e-07
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    54   4e-07
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    52   4e-07
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    54   4e-07
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    54   4e-07
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    54   5e-07
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    51   5e-07
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    54   7e-07
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    53   8e-07
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    53   8e-07
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    53   9e-07
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    53   9e-07
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    53   9e-07
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    53   1e-06
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    50   1e-06
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    52   1e-06
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    52   2e-06
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    52   2e-06
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    52   2e-06
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    49   2e-06
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    52   3e-06
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    52   3e-06
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    49   3e-06
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    51   3e-06
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    51   4e-06
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    51   5e-06
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    51   5e-06
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    48   5e-06
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    50   7e-06
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    50   7e-06
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    50   7e-06
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    50   7e-06
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    50   9e-06
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    50   9e-06
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    50   1e-05
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    50   1e-05
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    50   1e-05
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    49   1e-05
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    49   1e-05
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    47   2e-05
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    49   2e-05
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    49   2e-05
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    49   2e-05
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    47   2e-05
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    49   2e-05
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    49   2e-05
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    49   3e-05
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    48   3e-05
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    48   3e-05
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    48   4e-05
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    48   4e-05
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    47   5e-05
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    47   5e-05
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    47   7e-05
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    47   7e-05
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    47   7e-05
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    47   8e-05
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    47   8e-05
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    47   9e-05
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    46   9e-05
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    47   9e-05
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    46   9e-05
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    47   1e-04
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    46   1e-04
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    44   1e-04
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    46   1e-04
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    44   1e-04
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    46   2e-04
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         45   2e-04
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    45   2e-04
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    45   3e-04
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    45   3e-04
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    45   3e-04
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    45   4e-04
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    43   4e-04
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    44   5e-04
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    43   5e-04
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    44   5e-04
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    44   5e-04
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    44   6e-04
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    44   6e-04
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    44   6e-04
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    43   7e-04
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    44   8e-04
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    44   8e-04
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    43   0.001
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    42   0.001
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    43   0.001
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    43   0.001
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    43   0.001
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    43   0.001
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    43   0.002
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    42   0.002
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    42   0.002
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    42   0.002
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    43   0.002
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    42   0.002
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    42   0.003
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    41   0.003
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    42   0.003
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    41   0.003
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       42   0.003
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    40   0.005
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    41   0.006
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    40   0.007
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    40   0.007
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    40   0.008
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    40   0.008
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    40   0.009
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    39   0.013
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    39   0.014
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    40   0.014
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    40   0.014
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    39   0.015
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    39   0.015
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    39   0.021
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    39   0.025
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    38   0.037
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    38   0.048
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    38   0.054
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    38   0.055
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    38   0.060
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    38   0.060
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    37   0.10 
Ecym_7225 Chr7 complement(466300..466908) [609 bp, 202 aa] {ON} ...    35   0.17 
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    35   0.21 
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    35   0.24 
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    35   0.27 
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    35   0.30 
CAGL0K09416g Chr11 complement(931067..932143) [1077 bp, 358 aa] ...    34   0.53 
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    34   0.53 
Suva_7.50 Chr7 (88923..90002) [1080 bp, 359 aa] {ON} YGL211W (REAL)    34   0.58 
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    34   0.60 
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    34   0.74 
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    33   0.93 
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    33   0.94 
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    33   1.3  
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    33   1.4  
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    33   1.5  
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    32   1.6  
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    33   1.8  
KLLA0A04840g Chr1 complement(430541..431113) [573 bp, 190 aa] {O...    32   1.8  
Skud_7.57 Chr7 (97816..98934) [1119 bp, 372 aa] {ON} YGL211W (REAL)    33   1.8  
KLLA0B00737g Chr2 complement(58094..59209) [1116 bp, 371 aa] {ON...    33   1.9  
KAFR0F04170 Chr6 complement(820185..821306) [1122 bp, 373 aa] {O...    33   2.1  
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    32   2.3  
AER437C Chr5 complement(1473621..1474742) [1122 bp, 373 aa] {ON}...    32   2.3  
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    32   2.6  
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    32   2.6  
Kpol_1020.44 s1020 (98947..100761) [1815 bp, 604 aa] {ON} (98947...    32   2.7  
YGL211W Chr7 (92512..93591) [1080 bp, 359 aa] {ON}  NCS6Protein ...    32   3.0  
Smik_7.52 Chr7 (87317..88396) [1080 bp, 359 aa] {ON} YGL211W (REAL)    32   3.1  
NCAS0A01690 Chr1 (330511..331077) [567 bp, 188 aa] {ON} Anc_4.10...    32   3.2  
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    32   3.2  
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    32   3.2  
TDEL0B02670 Chr2 (479314..480627) [1314 bp, 437 aa] {ON} Anc_5.6...    32   3.6  
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    32   3.6  
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    32   3.7  
NDAI0I02920 Chr9 complement(689825..690928) [1104 bp, 367 aa] {O...    32   4.1  
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    31   4.3  
TPHA0A05830 Chr1 complement(1324010..1325143) [1134 bp, 377 aa] ...    32   4.3  
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    31   4.4  
KLTH0G01694g Chr7 (124053..125174) [1122 bp, 373 aa] {ON} simila...    32   5.0  
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    31   5.2  
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    31   5.3  
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    30   5.8  
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    31   6.0  
NCAS0E00590 Chr5 (101606..102700) [1095 bp, 364 aa] {ON} Anc_3.5...    31   6.8  
SAKL0F01848g Chr6 (154310..155434) [1125 bp, 374 aa] {ON} simila...    31   7.4  
Kwal_47.19072 s47 complement(1086331..1087452) [1122 bp, 373 aa]...    31   7.6  
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    30   9.3  
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    30   9.9  

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/460 (88%), Positives = 406/460 (88%)

Query: 1   MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAA 60
           MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAA
Sbjct: 1   MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDT 120
           YEILSDPEKKSHYDLYGDDY                            HEGNDFPREYDT
Sbjct: 61  YEILSDPEKKSHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDT 120

Query: 121 YEEXXXXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE 180
           YEE             FLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE
Sbjct: 121 YEEDKCKSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE 180

Query: 181 CESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK 240
           CESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK
Sbjct: 181 CESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK 240

Query: 241 EIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGS 300
           EIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGS
Sbjct: 241 EIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGS 300

Query: 301 AEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDD 360
           AEDLYTSATISLSEALTGFEK             SIKPGRVIRPGDVIKITNEGWPIMDD
Sbjct: 301 AEDLYTSATISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKITNEGWPIMDD 360

Query: 361 PRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNE 420
           PRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNE
Sbjct: 361 PRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNE 420

Query: 421 TISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSYCPMQ 460
           TISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSYCPMQ
Sbjct: 421 TISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSYCPMQ 460

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/460 (72%), Positives = 370/460 (80%), Gaps = 1/460 (0%)

Query: 1   MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAA 60
           MSGSDR  +LYDVLGVT DA+VQEIKTAYRKLALKHHPDKYVDQ+SKEVNEIKFKEITAA
Sbjct: 1   MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDT 120
           YEILSDPEKKSHYDLYGDD                             H+GN+FP EYD 
Sbjct: 61  YEILSDPEKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYDA 120

Query: 121 YEEXXXXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE 180
           YEE              LT+KDLYMGKKLKF+LKRQ++C+ CHGSGWK K+KIHVTH+VE
Sbjct: 121 YEEGNSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE 180

Query: 181 CESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK 240
           CESC GKGSKERLKRFGPGLVASQWV CEKC+GKGKY KRPKNPKNFCPDCAG+GL SKK
Sbjct: 181 CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKK 240

Query: 241 EIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGS 300
           EIITVNVAPGHHFNDVIT+KGMADEE+DK+ CGDLKFHL EKQENLEQKQIFLKNFD+G+
Sbjct: 241 EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGA 300

Query: 301 AEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDD 360
            EDLYTS TISLSEALTGFEK             S+KPGRV+RPGD IKI NEGWPI+D+
Sbjct: 301 GEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN 360

Query: 361 PRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNE 420
           P G+ GDLYVF+HIEFPPDNWFNEKSELLAIKT LPSSSSC    T NT EDD N  NNE
Sbjct: 361 PHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNT-EDDSNLTNNE 419

Query: 421 TISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSYCPMQ 460
           TISNF+II+ ++LPEG++ F  E+Q+SAHQKA+SSYC +Q
Sbjct: 420 TISNFRIIHTDDLPEGIRPFKPEAQDSAHQKARSSYCCIQ 459

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/460 (68%), Positives = 353/460 (76%), Gaps = 4/460 (0%)

Query: 1   MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAA 60
           MSGSD + +LYDVLGVT +ASVQEIKTAYRKLALKHHPDK VDQ+SKE+NE KFKEITAA
Sbjct: 1   MSGSDSKDRLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDT 120
           YEILSDPEKKSHYDLY                                HE NDFP E++ 
Sbjct: 61  YEILSDPEKKSHYDLY---GDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEM 117

Query: 121 YEEXXXXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE 180
           YE                T+KDLYMGKKLKFELKRQI+C  C GSGWK KKK+HVTHE+E
Sbjct: 118 YEGNETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVTHEME 177

Query: 181 CESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK 240
           CESCGGKGSKERLKRFGPGLVASQWV CEKCHGKGKY KRPKN KNFCPDC  VGLQ KK
Sbjct: 178 CESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGLQYKK 237

Query: 241 EIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGS 300
           E+ITVNV PGHHFNDV+T+KGMADEE+DK+ CGDL FHLVEK E+L+QKQ+ +K F  G+
Sbjct: 238 EVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKFGGGN 297

Query: 301 AEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDD 360
            +DLY S T+SLSEALTGFEK             SIKPG+VIRPGD+IKITNEGWPI+D 
Sbjct: 298 LQDLYVSITVSLSEALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWPILDH 357

Query: 361 PRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNE 420
           PRGQ GDLYVF+ IEFPPDNWFNEKSELLAIKT LPSS+S    TT NTG D+ +PIN+E
Sbjct: 358 PRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDN-SPINSE 416

Query: 421 TISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSYCPMQ 460
           T+SNFQII+ ++LPEGMK FN + Q SAHQKA SSYCPMQ
Sbjct: 417 TVSNFQIIHSDDLPEGMKTFNPKPQTSAHQKASSSYCPMQ 456

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/460 (69%), Positives = 355/460 (77%), Gaps = 5/460 (1%)

Query: 1   MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAA 60
           MS SDR  +LY VLGVT DA VQEIKTAYRKLALKHHPDKYVDQ+SK+VNEIKFKEITAA
Sbjct: 1   MSDSDRNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAA 60

Query: 61  YEILSDPEKKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDT 120
           YEILSDPEKKSHYDLYGDD                             HEGN F  EY  
Sbjct: 61  YEILSDPEKKSHYDLYGDDNGTANGGGTDGFGNDDFMNFFNNFFNDGGHEGNGFSNEYKM 120

Query: 121 YEEXXXXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE 180
           YE+              LT+KDLYMGKKL+F+LKRQ+VCM CHGSGWK KK++HVTHEVE
Sbjct: 121 YEDNDSASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVE 180

Query: 181 CESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK 240
           CESCGGKGSKERLKRFGPGLVASQWV CEKCHGKGKY K PKNPKNFCPDCAGVGLQSKK
Sbjct: 181 CESCGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKK 240

Query: 241 EIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGS 300
           E+ITV VAPGHHFNDVITI+GMADEE+ K+ACGDL+FHL E+QE+   KQ+FLKNF +G+
Sbjct: 241 EVITVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGN 300

Query: 301 AEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDD 360
            ED Y S TISLSEALTGFEK             SIKPGRVIRPGDV+KITNEGWPI+DD
Sbjct: 301 MEDSYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDD 360

Query: 361 PRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNE 420
            RG+ GDLYVFIHIEFPPDNWFNEKSELL IKT LPSSSS +  +      D  + INNE
Sbjct: 361 ARGRCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASG-----DANDLINNE 415

Query: 421 TISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSYCPMQ 460
           T+SNFQII+ ++LPEG+K F  + QN AH+KA+S+YCPMQ
Sbjct: 416 TVSNFQIIHTDDLPEGVKTFKPKPQNPAHKKARSAYCPMQ 455

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  306 bits (783), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 179/457 (39%), Positives = 255/457 (55%), Gaps = 48/457 (10%)

Query: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
           LY +LGVTS A+  EIK AYRKLAL++HPDK +D N +E NEIKFKEIT+AYEILSD EK
Sbjct: 4   LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63

Query: 70  KSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDF------PREYDTYEE 123
           ++HYDLYGD                                 NDF        +YD+Y  
Sbjct: 64  RAHYDLYGD----------------------ANENEYNNQNANDFFNFETDQPDYDSYAF 101

Query: 124 XXXXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVT--HEVEC 181
                         L++++LY GK  KF+ KR I+C+ C G GW+ +K  +VT  HE+EC
Sbjct: 102 DNDKSKDVKIPLK-LSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIEC 160

Query: 182 ESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKE 241
           + C G G KER +   PG V +  + CE CHGKG+   +P + KN C +C G GL S+ +
Sbjct: 161 KKCNGLGYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENK 220

Query: 242 IITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSA 301
            + V+V  G    D I I+  AD+E+ KS  GD+   ++E+   +     F++       
Sbjct: 221 QLLVSVPRGLQNKDTIRIENEADQEIGKSKTGDI-ILVIEEDTTMPSDVHFIR-----KG 274

Query: 302 EDLYTSATISLSEALTGF-EKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDD 360
            D     ++SL+EALTGF +K             S+  G+VIRPG++IKI  EGWP+  +
Sbjct: 275 TDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPV--N 332

Query: 361 PRGQR-GDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINN 419
           P+  + GDLYV I IEFPPDNWF+EKS++  ++ +LPS          N+ + D +P+N 
Sbjct: 333 PQASKFGDLYVIIKIEFPPDNWFSEKSDIQLLRNVLPSG----INGMMNSWKID-DPLNT 387

Query: 420 ETISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSY 456
           ET++ F I  +EELP+ +   N+ S      ++ ++Y
Sbjct: 388 ETVTTFDI--LEELPDTLNESNNRSAYDTGDQSDANY 422

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  301 bits (770), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 170/429 (39%), Positives = 239/429 (55%), Gaps = 30/429 (6%)

Query: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
           LY++LGV  DA+  EIK AYRK AL+HHPDK  D++ +E +E++FKEI AAYE+L D EK
Sbjct: 4   LYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEEK 63

Query: 70  KSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHE-GNDFPREYDTYEEXXXXX 128
           ++ YD YGD                              H  G++    YD Y E     
Sbjct: 64  RARYDKYGD--------ADGSDFFNGPNEFEDAAFMNFFHSFGSNPQNAYDHYGEQKVDR 115

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTH--EVECESCGG 186
                    +++ D Y GK  KF+ KR +VC  C GSGW+ ++  HV    +VEC+ CGG
Sbjct: 116 SADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWR-RRNDHVVPPPQVECKKCGG 174

Query: 187 KGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVN 246
           +G K+R++R  PG   ++ +TC  C GKGK   +P N KN C  C G G+ ++ + +TV+
Sbjct: 175 QGFKQRIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLTVS 234

Query: 247 VAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYT 306
           +  G   +D I +KG AD+E+ KS  G+L F + E  E  E   +    F      DL T
Sbjct: 235 LPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGF------DLIT 288

Query: 307 SATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRG 366
             T+SL+EA+TGF K              I PG+VIRPG++I+I +EGWPI        G
Sbjct: 289 HLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPI---DTTTSG 345

Query: 367 DLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNFQ 426
           DLYV +HIEFPPDNWF+E+S+L  +K +LP       +T  N   +D +P N ET++N  
Sbjct: 346 DLYVVVHIEFPPDNWFSERSDLTQVKNVLPG------ETNNNAAVED-DPGNTETVTNIN 398

Query: 427 IINMEELPE 435
           I+  EE+P+
Sbjct: 399 IV--EEIPD 405

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  291 bits (745), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 176/446 (39%), Positives = 246/446 (55%), Gaps = 29/446 (6%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           +LY+VLGV  DAS  EIK AYRKLAL+HHPDK  D+  +E +E+KFKEITAAYEILSD +
Sbjct: 3   KLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDED 62

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
            +  YD+YGDD                             +   D PR+    EE     
Sbjct: 63  SRKKYDVYGDDAPGASGGGGDPFGDDDFMNFFRTYAGGGFY---DEPRQPYPEEENRSVR 119

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKG 188
                    L++K+LY GK  KF  KR ++C  C GSG + K + H    V C+SC G G
Sbjct: 120 TSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGHG 179

Query: 189 SKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248
            KER+KR   G V  + V CE+C+GKG+    P  P++ C  C G  + S+++ +TV + 
Sbjct: 180 HKERIKRVAQGFVIRETVKCERCNGKGRTT--PTKPEDHCKKCHGKCVISEEKTLTVYIP 237

Query: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE---NLEQKQIFLKNFDEGSAEDLY 305
            G    D++ ++G AD+E DK   GDL F + E  E   NLE++            +DL+
Sbjct: 238 RGSRNGDIVKLEGEADQEPDK-VTGDLLFVIEENPETSTNLERR-----------GDDLH 285

Query: 306 TSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQR 365
           T   ISLSEA+TGFEK              I  G+VIRPG+ I++ NEGWP +DD   + 
Sbjct: 286 TRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWP-LDDSGNKF 344

Query: 366 GDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNF 425
           GD+YV +HIEFPPDNWF+EKS++  ++T+LP   +      A+TG  D N  N ET+ ++
Sbjct: 345 GDMYVQVHIEFPPDNWFSEKSDVEVLRTLLPEVPNA---RVADTG--DLN--NTETVIDY 397

Query: 426 QII-NMEELPEGMKIFNSESQNSAHQ 450
            ++ + +ELP+ +     E Q    +
Sbjct: 398 SVVKSADELPDYLSYEKGEYQGQEQE 423

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  283 bits (725), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 172/444 (38%), Positives = 247/444 (55%), Gaps = 36/444 (8%)

Query: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNS--KEVNEIKFKEITAAYEILSDP 67
           LY VLGV S+A+  +IK AYRKLAL+HHPDK V+ NS  +E +EIKFKEI+AAYEILSD 
Sbjct: 4   LYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDE 63

Query: 68  EKKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXX 127
           +K++HYDLYG                                E ++ P  +  YE+    
Sbjct: 64  DKRAHYDLYG-----------SEEEQQRQQRQYDPFESFFNFEQDEEPSRH--YEDPKRS 110

Query: 128 XXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKK--KIHVTHEVECESCG 185
                     +T+++LY GK  KF+ KR ++C  C G GW+ +K  ++ V  EVEC+ C 
Sbjct: 111 PDVKIPLK--MTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168

Query: 186 GKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITV 245
           G+G  E+++   PG    +   C++C GKGK+  +  + KN C  C G GL ++ +++TV
Sbjct: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228

Query: 246 NVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLY 305
           +V  G    D I +   AD+EL K   GDL F + E Q   +  Q+      E    +  
Sbjct: 229 SVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQL------ERKGSNFM 282

Query: 306 TSATISLSEALTGF-EKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQ 364
           T   ISL+EALTGF +K             SI PG+VIRPG++IKI  EGWP+  +   +
Sbjct: 283 TELNISLAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPLNGEAT-K 341

Query: 365 RGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISN 424
            GDLY+ ++IEFPPDNWF EKS+L  IK +LP S+S   + +     DD  P+N E +  
Sbjct: 342 FGDLYISVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLS-----DD--PLNTELLLK 394

Query: 425 FQIINMEELPEGMKIFNSESQNSA 448
           F++  +E LP+ +K    + +N+A
Sbjct: 395 FEV--LETLPDTLKEGQDQGENNA 416

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  272 bits (695), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 170/438 (38%), Positives = 225/438 (51%), Gaps = 52/438 (11%)

Query: 2   SGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAY 61
           S  DR Y  Y++LGV  DA+ +EIK  YRKLAL++HPDK +D+  K +NEIKFK+ITAAY
Sbjct: 7   SSEDRDY--YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAY 64

Query: 62  EILSDPEKKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTY 121
           + LSD +K++ YD                                  H+GN        Y
Sbjct: 65  QTLSDEDKRNEYD------------------NKKNFEPYFESDFANNHDGN--------Y 98

Query: 122 EEXXXXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKK--KIHVTHEV 179
                           L   +LY GK +KF   R  +C  C+G GW+ KK  K +V  E+
Sbjct: 99  NSRYRSRSKDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEI 158

Query: 180 ECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSK 239
           EC+ C G+G K    +  PG   +Q V C  C G GKY K+P +PKNFC DC G  L   
Sbjct: 159 ECQKCNGQGYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKI 218

Query: 240 KEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFD-E 298
            + I V++  G    D I +KG ADEEL K   GDL F + E         I   N D E
Sbjct: 219 DDPIVVSIPRGSSNGDNIILKGEADEELGKKNAGDLIFEINE---------IIDSNNDLE 269

Query: 299 GSAEDLYTSATISLSEALTGFE-KXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPI 357
                L     ISL+EA+TGFE K             S   G+VIRPGD++++ NEGWP 
Sbjct: 270 RYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP- 328

Query: 358 MDDPRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPI 417
           MD      G+LYV + IEFPPDNW NEK++++ I+ +LP+      +T  N   D   PI
Sbjct: 329 MDKYGASFGNLYVILEIEFPPDNWINEKNDIIKIRNILPNE-----KTKRNNIVD---PI 380

Query: 418 NNETISNFQIINMEELPE 435
           N+E IS F+I+  + LP+
Sbjct: 381 NSEYISTFEIV--KSLPQ 396

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  267 bits (682), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 169/460 (36%), Positives = 240/460 (52%), Gaps = 46/460 (10%)

Query: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
           LY+VLG+ S AS QE+K AYR+LAL++HPDK  D++ +E +E KFKEI+AAY +LSD +K
Sbjct: 5   LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64

Query: 70  KSHYDLYGD-DYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
           ++ YD +G  D                             HE +DF     T +      
Sbjct: 65  RAEYDQFGTVDGGYGHDEFGHGDDDFMNFFRYGAGRHGYQHEEDDFEEVGRTADSTVPLK 124

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKG 188
                    LT K LY+GK  +F+ +R+++C  C GSG  L+K+      + CE C G+G
Sbjct: 125 ---------LTTKQLYLGKTFQFKARRKVLCPRCGGSG--LRKRAAARPMIRCEGCEGQG 173

Query: 189 SKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248
            KER+ R GPGL++ + V+C  C GKGK +  P    + C  C G  +  ++ II+V V 
Sbjct: 174 YKERISRIGPGLISRERVSCADCGGKGKRI--PTTAADNCKKCTGKCVVQEESIISVYVP 231

Query: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE---NLEQKQIFLKNFDEGSAEDLY 305
            G    D +   G +D E  K   GDL F + E+ +   +LE+K             DLY
Sbjct: 232 RGSQHGDRLRYPGQSDMEPGKET-GDLVFVIDEQTDVSSSLERK-----------GTDLY 279

Query: 306 TSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQR 365
            +  ISL+EALTGF +             +I  G+V+RPG+ +K TNEGWPI D  R   
Sbjct: 280 CTMKISLAEALTGFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGAR--F 337

Query: 366 GDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNF 425
           GD+YV + IEFP DNWFNEK+EL AI+ +LP  +      T        +P N E +  +
Sbjct: 338 GDMYVQVLIEFPKDNWFNEKAELDAIRNILPGLADAPSTKT-------EDPSNTEEVRAY 390

Query: 426 QII-NMEELPEGMKIFNSESQNSAHQKAKSSY----CPMQ 460
            II N   LP+     + E+Q  + Q+ +S+     CPMQ
Sbjct: 391 SIIANHTGLPD---YLDRENQGYSRQQHESTAGTPECPMQ 427

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  263 bits (671), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 155/428 (36%), Positives = 227/428 (53%), Gaps = 35/428 (8%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y+ LGV  DA+  EIK AYR+LAL+HHPDK  D++ ++ +EIKFKE+ AAYE+LS+ EK+
Sbjct: 4   YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63

Query: 71  SHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXXXX 130
            +YD YGD                                 N +  EY+  +        
Sbjct: 64  QNYDTYGD--------TNGFSGDYSGFQDGDFASFFGNFASNRYQDEYEA-QSPPSPRTD 114

Query: 131 XXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSK 190
                  LT+++LY GK ++F+ KR +VC  C G+G + + +    H   C  C G G K
Sbjct: 115 DAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRRAR----HASACSQCEGHGVK 170

Query: 191 ERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPG 250
           +RL+R GPG V  + V C+KC G GK ++     ++ C  C G  +  + + + V +  G
Sbjct: 171 QRLRRLGPGFVTREIVQCDKCKGLGKNLRS----EDMCKKCHGKRVTPESKNLNVYIPRG 226

Query: 251 HHFNDVITIKGMADEELDKSACGDLKFHLVEKQ--ENLEQKQIFLKNFDEGSAEDLYTSA 308
               D + +KG ADEE  K   GDL F + E     +LE++             DLY   
Sbjct: 227 SRHGDRVVLKGEADEEPGKIP-GDLVFDIAENSASSSLERR-----------GSDLYAKI 274

Query: 309 TISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDL 368
           TISLS+ALTGFEK              +  G+V+RPG+ ++I NEGWP +DD   + GD+
Sbjct: 275 TISLSDALTGFEKEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWP-LDDQGSKFGDM 333

Query: 369 YVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNFQII 428
           YV I IEFPPD+WF+E+S++ +++ +LP + S +  +  N    D  P N ET   F I+
Sbjct: 334 YVQIDIEFPPDHWFSERSDVKSLQNLLPQAVSSSATSDFNASASD--PANTETPLKFSIV 391

Query: 429 -NMEELPE 435
            + EELP+
Sbjct: 392 KSAEELPQ 399

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  262 bits (670), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 170/470 (36%), Positives = 243/470 (51%), Gaps = 59/470 (12%)

Query: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
           LY VLG+ S+A+ QE+K AYR LAL +HPDK  D++ +  +E KFKEI+AAY+ILSD +K
Sbjct: 5   LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64

Query: 70  KSHYDLYG-------------DDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPR 116
           +S YD YG             DDY                              G     
Sbjct: 65  RSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFFRY-----------------GAGRYG 107

Query: 117 EYDTYEEXXXXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVT 176
           +Y+  E+              L+ K LY+GK  +F+LKR ++C  C G G  L+K+    
Sbjct: 108 QYEDAEQKTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLG--LRKRAAHC 165

Query: 177 HEVECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGL 236
             ++C  C G+G KER+ R  PG ++ + V C++C GKG  V R  +P + C  C G  +
Sbjct: 166 MPMKCGICDGRGFKERVSRISPGFISRERVPCDECDGKGTVVSR--DPSDNCKKCHGKCV 223

Query: 237 QSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE---NLEQKQIFL 293
             +  I+T+ V  GH   D I I G AD E  K   GDL F + E  +    LE+K    
Sbjct: 224 IVENSILTLYVPRGHRHADTIRIDGQADMEAGKET-GDLVFEIDEITDPDAELERK---- 278

Query: 294 KNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNE 353
                    DL+ S TISL+EALTGF +             +I  G+V+RPG+ +K TNE
Sbjct: 279 -------GTDLHCSITISLAEALTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNE 331

Query: 354 GWPIMDDPRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGE-D 412
           GWPI +  R   GDLYV ++IEFP DNW NEKSEL AIK +LP       + ++N+ + D
Sbjct: 332 GWPINNGSR--FGDLYVKVNIEFPKDNWLNEKSELEAIKHILPG-----LKNSSNSHQGD 384

Query: 413 DRNPINNETISNFQII-NMEELPEGMKIFNSESQNSAH-QKAKSSYCPMQ 460
             +P N E I+++ +I +   LP+ +     +  N  + ++  +S CP+Q
Sbjct: 385 GDDPANTEDINSYYVIQDSSRLPDYLAQEGQQRSNQQYGERNTASECPVQ 434

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  250 bits (638), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 161/432 (37%), Positives = 230/432 (53%), Gaps = 46/432 (10%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           YD LGV  DA+  EIK AYR+LAL+HHPDK  D++ +E +EIKFKE+ AAYE+LS+ EK+
Sbjct: 4   YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63

Query: 71  SHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDF-----PREYDTYEEXX 125
            +YD YGD                               E  DF     PR  D +    
Sbjct: 64  RNYDTYGDTNGYSDSYGGFQDGDFASFFGNFASGRYEDEE--DFRAHARPRTDDAH---- 117

Query: 126 XXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCG 185
                       LT++DLY GK ++F+  R +VC  C G+G + + +    H   C  C 
Sbjct: 118 --------VSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKRAR----HASACTHCE 165

Query: 186 GKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITV 245
           G G K+RL+R GPG V  + V C KC G GK ++     ++ C  C G  +  + + + V
Sbjct: 166 GHGVKQRLRRLGPGFVTRETVQCTKCRGLGKNLR----SEDLCKKCHGKRVTPETKNLNV 221

Query: 246 NVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQ--ENLEQKQIFLKNFDEGSAED 303
            +  G   ND I ++G ADEE  K   GDL F + E     NLE++             D
Sbjct: 222 YIPRGSRHNDRIVLEGEADEEPGK-LTGDLVFDISEDSTTSNLERR-----------GSD 269

Query: 304 LYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRG 363
           L+T   ISLS+ALTGFEK              I  G+VIRPG+ I + NEGWP +DD   
Sbjct: 270 LHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWP-LDDEGK 328

Query: 364 QRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETIS 423
           + G++YV I+IEFPPD+W++E+ E+ A++ ++P S+S +  +++ + E D  P+N E + 
Sbjct: 329 KFGNMYVQINIEFPPDHWYSERGEIEALRNIIPQSTSSSAASSSASAEPD--PVNTE-MP 385

Query: 424 NFQII-NMEELP 434
            F I+ + EELP
Sbjct: 386 TFDILKSAEELP 397

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score =  252 bits (643), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 163/466 (34%), Positives = 233/466 (50%), Gaps = 66/466 (14%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           YDVLGV  DA+  EI+ AYRKLALK+HPDK +D+  +E +E  FKE+TAAYEILSDPE K
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133

Query: 71  SHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYE-------- 122
           S YD+YGD                              HE +DF   +  Y+        
Sbjct: 134 SRYDMYGD----------------SAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHA 177

Query: 123 ---------EXXXXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKI 173
                    E              +T + LYMGK + F+LKR+ +C  C G+G  L+KK 
Sbjct: 178 SYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTG--LRKKH 235

Query: 174 HVTHEVECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAG 233
               E+ C SC G+G KER+ R   G +      C+ C GKG+Y  R K+  + C  C+G
Sbjct: 236 FQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRY--RKKSASDTCKHCSG 293

Query: 234 VGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVE--KQENLEQKQI 291
            GL ++++  TV +  G    D   +  MAD E  K   GD+   + E   + +LE+K  
Sbjct: 294 KGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKET-GDVIIVIDEDSSKSHLERK-- 350

Query: 292 FLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKIT 351
                    + DL+T+  ISL +ALTGF               ++  G+VIRPG+  K  
Sbjct: 351 ---------SNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFK 401

Query: 352 NEGWPIMDDPRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGE 411
            EGWP+ +      GD+YV I+IEFP DNWFNEKSE+ A++ +LP   S           
Sbjct: 402 GEGWPLSNG--DSFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKS--------KDT 451

Query: 412 DDRNPINNETISNFQIINM-EELPEGM----KIFNSESQNSAHQKA 452
            D +P+N E + ++ +++  +ELP+ +    + +N + Q   H  A
Sbjct: 452 KDPDPLNTEDVLSYSVLHSHDELPDYLAEEKEKYNRKQQEEPHASA 497

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  247 bits (630), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 156/460 (33%), Positives = 236/460 (51%), Gaps = 48/460 (10%)

Query: 10  LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVN-----EIKFKEITAAYEIL 64
           LY +L V    +  E+K  YRKLALK+HPDK    +  E +     E+KFKEI +AYEIL
Sbjct: 12  LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71

Query: 65  SDPEKKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEX 124
           SD EK+  YDL                                 ++G+D+    +T    
Sbjct: 72  SDEEKRKQYDL--------------------------QKNFRDANQGSDYGDGINT--AF 103

Query: 125 XXXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKK--KIHVTHEVECE 182
                        +T+KDLY GK +++++KR ++C  C G GW+ +K  K +V    EC+
Sbjct: 104 GNQTSKDISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNGKQYVPPLTECK 163

Query: 183 SCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEI 242
           +C G G K+  ++  PG    Q + C+ C GKG+Y K+P + KNFC  C G G+    E 
Sbjct: 164 TCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKCNGKGIIEISES 223

Query: 243 ITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAE 302
           ITVN+  G    D I I   AD+EL K   GDL F L    E ++ +Q  LK + +   +
Sbjct: 224 ITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVL----EEIDDEQTALKRYGD---K 276

Query: 303 DLYTSATISLSEALTGF-EKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDP 361
           DL T  TISL++A+TGF EK             SI  G+VIR GD++K+  EGWP+  + 
Sbjct: 277 DLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNA 336

Query: 362 RGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDD--RNPINN 419
             + GDLY+  +IEFP DNW +E ++++ I+ +LP+ S        +  +DD     +N+
Sbjct: 337 T-RSGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNITMNS 395

Query: 420 ETISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSYCPM 459
           E ISN+  +  ++LP+ +   ++      H    +++  M
Sbjct: 396 EDISNYDFV--KDLPDIIDTSHNNGAEYGHNGDSANFTEM 433

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  231 bits (590), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 154/454 (33%), Positives = 229/454 (50%), Gaps = 58/454 (12%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYV-----DQNSKEVNEIKFKEITAAYEILS 65
           Y +LGV  DAS  EIK AYRKLAL+HHPDK       + +S ++ ++ FKE+TAAY++LS
Sbjct: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63

Query: 66  DPEKKSHYDL--------YGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPRE 117
           D   ++ YD         YGDD                             H G+     
Sbjct: 64  DASLRAEYDQKLAFEAQPYGDD----------------DFMNFFSGFNGGSHPGH--RSG 105

Query: 118 YDTYEEXXXXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWK-----LKKK 172
           +D+                 +   +LY GKK+ F LKR+  C  C G+GWK     +KKK
Sbjct: 106 FDSGRGARRYKSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKK 165

Query: 173 IHVTHEVECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDC- 231
                   CE C G+G ++RL++  PG V ++ + C +C GKGK    PK+ KN CPDC 
Sbjct: 166 TAKFFWNVCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCI 225

Query: 232 --AGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQK 289
               VG+  + +++T+N+  G    D I +KG ADE+L+ +  GDL   +++ QE  E +
Sbjct: 226 TSGTVGMVEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDL---VIKIQEVKEPQ 282

Query: 290 QIFLKNFDEGSAEDLYTSATISLSEALTGF-EKXXXXXXXXXXXXXSIKPGRVIRPGDVI 348
              ++N       DL     I L++A+ GF EK             S K G+VIRP D++
Sbjct: 283 YDIVRN-----GYDLIIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIV 337

Query: 349 KITNEGWPIMDDPRG-----QRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTF 403
           +I NEGWP  +D        + GDLYV + I FPPDNW  E ++  A++ ++P  S+   
Sbjct: 338 RIQNEGWPRREDANDNNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIP--STINK 395

Query: 404 QTTANTGEDDRNPINNETISNF--QIINMEELPE 435
           + ++ +GE   N + N  +S    +I N +ELP+
Sbjct: 396 RESSTSGESILN-VENINVSEIVKEIPNCDELPK 428

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  215 bits (547), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 121/321 (37%), Positives = 179/321 (55%), Gaps = 21/321 (6%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFG 197
           +++ D Y GK  KF+ KR+IVC  C GSGW+ ++      +  C+SC G+G KE+L+R  
Sbjct: 123 VSMADCYNGKVFKFQSKRKIVCEKCEGSGWR-RRSGGPPPQTNCKSCQGRGYKEQLRRVA 181

Query: 198 PGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVI 257
           PG+VA Q V+C  CHGKGKYV +P + KN C  C G G+  + + +TV++  G    D I
Sbjct: 182 PGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRGSRHGDRI 241

Query: 258 TIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSEALT 317
             +G AD+E+ KS  GDL F + E  E  E  ++  + +      DL T+ +ISL+EA+T
Sbjct: 242 VFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGY------DLITNISISLAEAIT 295

Query: 318 GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
           G ++             S   G+VI PG +IK+  EGWP ++    + GDLYV + I FP
Sbjct: 296 GLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWP-LNSHATKFGDLYVLVDIVFP 354

Query: 378 PDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNFQIINMEELPEGM 437
            DNWF EKS+LL I+ +LPS         A   +   +P N E +S+ ++++  +LP+ M
Sbjct: 355 RDNWFAEKSDLLKIRNILPSE--------AANNDVKADPGNTEQVSDMKLVD--QLPDYM 404

Query: 438 KIFNSESQNSAHQKAKSSYCP 458
               S     AH+   S   P
Sbjct: 405 ---GSNGDQYAHEGHASGAFP 422

 Score = 99.4 bits (246), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 46/69 (66%), Positives = 56/69 (81%)

Query: 10 LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
          LYD LGV+ DA+  EIK AYRKLAL+HHPDK  D + +E +E++FKEITAAYE+LSD EK
Sbjct: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 70 KSHYDLYGD 78
          +S YD YGD
Sbjct: 63 RSKYDTYGD 71

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  212 bits (540), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 150/467 (32%), Positives = 228/467 (48%), Gaps = 58/467 (12%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           YD+LGV  D++  EI+ AYRKLALK HPDK +D   K  NE+KFKEIT AYEILS+ E  
Sbjct: 7   YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNGEYV 66

Query: 71  SHYDL----------YGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFP-REYD 119
              +           +GDD+                            H     P RE +
Sbjct: 67  EEMEEEYEGQGYGFNFGDDFMNFFNEGRNA------------------HPMGGHPQREDE 108

Query: 120 TYEEXXXXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKK--IHVTH 177
           +  E              +T+KDLY GK +KF+L R ++C +C G+ W+ +K   ++   
Sbjct: 109 STNEATQIEIE-------VTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPP 161

Query: 178 EVECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQ 237
            + C  C G G  ERL    P     Q ++C KC GKG+Y  +P + KN C  C G GL 
Sbjct: 162 VLSCTKCKGAGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLI 221

Query: 238 SKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHL-VEKQENLEQKQIFLKNF 296
            +K+ + V +  G   ++ I  K   DE+L     GD+ F L +  + N     I +   
Sbjct: 222 KEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTK- 280

Query: 297 DEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKP-GRVIRPGDVIKITNEGW 355
            EG+  DL+ +  I L EA++G +                 P G+V+RPGD I I  EGW
Sbjct: 281 -EGT--DLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGW 337

Query: 356 PIMDDPRGQR-GDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDR 414
           P    P G   GD++V +++EFPPDNW +E++++  +  +LP+  S      A TG+ + 
Sbjct: 338 P--KTPNGTEFGDMFVHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGH--AQTGDAN- 392

Query: 415 NPINNETISNFQIINMEELPEGMKIFNSESQNSAHQKAKSSY-CPMQ 460
              N E + +++I+   +  EG +  +S ++ ++   A+  Y C +Q
Sbjct: 393 ---NAEFVKDYEILKATD--EGTR--SSNTKTASRPPAQGLYKCSIQ 432

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  152 bits (384), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 123/403 (30%), Positives = 176/403 (43%), Gaps = 38/403 (9%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           + YD+LGV+  AS  EIK  YRK ALK+HPDK     + E    KFKE +AAYE+LSDPE
Sbjct: 6   KFYDILGVSPTASESEIKKGYRKAALKYHPDKNPTAEAAE----KFKECSAAYEVLSDPE 61

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
           K+  YD YG++                                +  PR      +     
Sbjct: 62  KRDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPRGPQKGRDIKHEI 121

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKG 188
                     T+++LY G+  K  L +QI+C  C G G K           +C SCGG+G
Sbjct: 122 AA--------TLEELYKGRTAKLALNKQILCKSCEGRGGK------ADAVKKCSSCGGQG 167

Query: 189 SKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248
            K   K+ GP ++      C+ CHG G  +    +PK  C  C G  + ++++I+ V + 
Sbjct: 168 IKFVTKQMGP-MIQRFQTECDVCHGTGDII----DPKGRCKSCHGKKIANERKILEVKIE 222

Query: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSA 308
           PG      I  KG +D+  D    GD+ F + EK     Q+          S  DL   A
Sbjct: 223 PGMKDGQRIVFKGESDQAPDIIP-GDVVFVVNEKPHKHFQR----------SGNDLVYLA 271

Query: 309 TISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDL 368
            I L  A+ G E              +I  G VI PG    I  +G PI+    G  G+L
Sbjct: 272 EIDLLTAIAGGE-FALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILK--YGGYGNL 328

Query: 369 YVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGE 411
            +  +I+F P+N F ++S L  ++ +LP  +  T    A   E
Sbjct: 329 IIQFNIKF-PENHFTDESNLKKLEEILPPRNKVTIPAKAEVEE 370

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  147 bits (371), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 120/403 (29%), Positives = 184/403 (45%), Gaps = 46/403 (11%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           + YD+LGV+ +AS  EIK  YRK ALK+HPDK     + E    KFKE + AYE+LSD +
Sbjct: 6   KFYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAE----KFKECSGAYEVLSDSQ 61

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
           K+  YD YG++                               G   PR     ++     
Sbjct: 62  KREIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFFGGA--GASRPRGPQRGKDIRHEI 119

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWK---LKKKIHVTHEVECESCG 185
                     T+++LY G+  K  L +QI+C  C G G K   +KK         C SCG
Sbjct: 120 QN--------TLEELYKGRTAKLALNKQILCKGCEGRGGKEGAVKK---------CSSCG 162

Query: 186 GKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITV 245
           G+G K   ++ GP ++      C+ CHG G  +    +PK+ C +C G  + ++++++ V
Sbjct: 163 GQGVKFVTRQMGP-MIQRFQTECDVCHGSGDII----DPKDRCKECKGNKVANERKVLEV 217

Query: 246 NVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLY 305
           +V PG      +T KG AD+  D    GD+ F + EK           K+F   S +DL 
Sbjct: 218 HVEPGMREGQKVTFKGEADQAPDIIP-GDVIFVVTEKPH---------KHFKR-SGDDLL 266

Query: 306 TSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQR 365
             A + L  A+ G +              +I PG VI PG    I  +G P+     G  
Sbjct: 267 YEAEVDLLTAIAGGD-FAIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQK--YGGY 323

Query: 366 GDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTAN 408
           G+L +   I+F P+N F ++++L A++ +LP  +       A+
Sbjct: 324 GNLIITFKIKF-PENHFADEAKLKALEDILPPRTEVKIPPKAH 365

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  145 bits (366), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 121/392 (30%), Positives = 176/392 (44%), Gaps = 40/392 (10%)

Query: 6   RRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILS 65
           R  +LYD+LGV+  AS  EIK AYRK ALK+HPDK   + + E    KFKE ++AYE+LS
Sbjct: 3   RETKLYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAE----KFKEASSAYEVLS 58

Query: 66  DPEKKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXX 125
           D EK+  YD +G D                               G   PR      +  
Sbjct: 59  DSEKRDIYDQFGQD--GLSGNGGMPGGAGGFGFGEDLFSQFFGGAGASRPRGPQRGRDIK 116

Query: 126 XXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCG 185
                       +++++LY GK  K  L +QI+C  C G G K K  +      +C SC 
Sbjct: 117 HEIS--------VSLEELYKGKTSKLALNKQILCKTCEGRGGK-KGAVK-----KCSSCN 162

Query: 186 GKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITV 245
           G+G K   ++ GP ++      C+ CHG G  +    + K+ C DC G  + ++++I+ V
Sbjct: 163 GQGIKFVTRQMGP-MIQRFQTECDVCHGTGDII----DAKDRCKDCHGKKIANERKILQV 217

Query: 246 NVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLY 305
           NV PG      +  KG AD+  D    GD+ F + EK     Q+            +DL 
Sbjct: 218 NVDPGMKNGQKVVFKGEADQAPDIIP-GDVIFVISEKPHKHFQR----------VGDDLI 266

Query: 306 TSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQR 365
             A I L  A+ G E              SI PG VI P     +  +G PI     G  
Sbjct: 267 YEAEIDLLTAVAGGE-FALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQK--YGGY 323

Query: 366 GDLYVFIHIEFPPDNWFNEKSELLAIKTMLPS 397
           G+L +   I+F P+N F ++  L  ++ +LP+
Sbjct: 324 GNLIIKFSIKF-PENHFADEDTLKKLEEILPA 354

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  142 bits (359), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 121/404 (29%), Positives = 180/404 (44%), Gaps = 40/404 (9%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           + YD+LGV+  A+  EIK AYRK ALK+HPDK   + + E    KFKE ++AYEILSD E
Sbjct: 6   KFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASSAYEILSDSE 61

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
           K+  YD +G+D                               G   PR     ++     
Sbjct: 62  KRDVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGGAQRPRGPQRGKDIKHEI 121

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKG 188
                     ++++LY G+  K  L +QI+C  C G G K K  +      +C SC G+G
Sbjct: 122 SA--------SLEELYKGRTAKLALNKQILCKGCEGRGGK-KGAVK-----KCSSCNGQG 167

Query: 189 SKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248
            K   ++ GP ++      C+ CHG G  V    +PK+ C  C G  ++++++I+ V+V 
Sbjct: 168 IKFVTRQMGP-MIQRFQTECDVCHGTGDIV----DPKDRCKSCNGKKVENERKILEVHVE 222

Query: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSA 308
           PG      I  KG AD+  D    GD+ F + E+           K+F     +DL   A
Sbjct: 223 PGMKDGQRIVFKGEADQAPD-VIPGDVVFLVSERPH---------KSFKR-DGDDLVYEA 271

Query: 309 TISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPR-GQRGD 367
            I L  A+ G E               I PG VI PG    I  +G P+   P+ G  G+
Sbjct: 272 EIDLLTAIAGGE-FALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPV---PKYGGYGN 327

Query: 368 LYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGE 411
           L +   ++F P+N F  +  L  ++ +LP  +       A   E
Sbjct: 328 LIIKFTVKF-PENHFTAEENLKKLEEILPPRTVPAIPKKATVDE 370

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  142 bits (358), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 122/389 (31%), Positives = 177/389 (45%), Gaps = 41/389 (10%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           + YD+LGV   A+  EIK AYRK ALK+HPDK   + + E    KFKE +AAYEILSDPE
Sbjct: 6   KFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASAAYEILSDPE 61

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
           K+  YD +G+D                               G   PR     ++     
Sbjct: 62  KRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAG-GAQRPRGPQRGKDIKHEI 120

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKG 188
                     ++++LY G+  K  L +QI+C  C G G K K  +      +C SC G+G
Sbjct: 121 SA--------SLEELYKGRTAKLALNKQILCKECEGRGGK-KGAVK-----KCTSCNGQG 166

Query: 189 SKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248
            K   ++ GP ++      C+ CHG G  +    +PK+ C  C G  ++++++I+ V+V 
Sbjct: 167 IKFVTRQMGP-MIQRFQTECDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVE 221

Query: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSA 308
           PG      I  KG AD+  D    GD+ F + E+           K+F     +DL   A
Sbjct: 222 PGMKDGQRIVFKGEADQAPD-VIPGDVVFIVSERPH---------KSFKR-DGDDLVYEA 270

Query: 309 TISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPR-GQRGD 367
            I L  A+ G E               I PG VI PG    I  +G PI   P+ G  G+
Sbjct: 271 EIDLLTAIAGGE-FALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPI---PKYGGYGN 326

Query: 368 LYVFIHIEFPPDNWFNEKSELLAIKTMLP 396
           L +   I+F P+N F  +  L  ++ +LP
Sbjct: 327 LIIKFTIKF-PENHFTSEENLKKLEEILP 354

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  141 bits (356), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 118/391 (30%), Positives = 181/391 (46%), Gaps = 38/391 (9%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           +LYD+LGV+ DA+  +IK AYRK ALK+HPDK    N  E    KFK+IT AYEILSD +
Sbjct: 6   KLYDLLGVSPDANDAQIKKAYRKSALKYHPDK----NPSEEAADKFKQITGAYEILSDSQ 61

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
           K+  YD +G++                               G   PR      +     
Sbjct: 62  KREMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFFGGGGASRPRGPQKGRDIRHDI 121

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKG 188
                     T+++LY G+  K  L + ++C  C G G K           +C SC G+G
Sbjct: 122 S--------CTLENLYKGRAAKLALNKTVLCKRCEGRGGK------AGSVKKCTSCNGQG 167

Query: 189 SKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248
            K   +  GP ++     TCE C+G+G  +       + C DC G  + S+++I+ VN+ 
Sbjct: 168 VKFVTRHMGP-MIQRFQTTCEVCNGEGDVIP----AADRCKDCDGKKIASERKILEVNIQ 222

Query: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSA 308
           PG      I  +G AD++  +   GD+ F +V +QE+      F++N D     +L+  A
Sbjct: 223 PGMKHGQKIVFQGEADQQPGQIP-GDVVF-VVNEQEHPR----FVRNGD-----NLHYEA 271

Query: 309 TISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDL 368
            I L  A+ G +               I PG VI PG V  I  +G PI     G  GDL
Sbjct: 272 EIDLLTAIAGGQ-FALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQK--YGSYGDL 328

Query: 369 YVFIHIEFPPDNWFNEKSELLAIKTMLPSSS 399
            +  +++FP  ++ +E++ L  ++ +LP  +
Sbjct: 329 LIKFNVKFPKSHFADEEA-LKKLEAILPPKT 358

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  139 bits (350), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 120/389 (30%), Positives = 177/389 (45%), Gaps = 41/389 (10%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           + YD+LGV+  A+  EIK AYRK ALK+HPDK   + + E    KFKE ++AYEILSD E
Sbjct: 6   KFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAE----KFKEASSAYEILSDSE 61

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
           K+  YD +G++                               G   PR     ++     
Sbjct: 62  KREVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQFFGAG-GAQRPRGPQRGKDIKHEI 120

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKG 188
                     ++++LY G+  K  L +QI+C  C G G K K  +      +C SC G+G
Sbjct: 121 SA--------SLEELYKGRTAKLALNKQILCKGCEGRGGK-KGAVK-----KCSSCNGQG 166

Query: 189 SKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248
            K   ++ GP ++      C+ CHG G  +    +PK+ C  C G  ++++++I+ V+V 
Sbjct: 167 IKFVTRQMGP-MIQRFQTECDVCHGTGDII----DPKDRCKSCNGKKVENERKILEVHVE 221

Query: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSA 308
           PG      I  KG AD+  D    GD+ F + E+           KNF     +DL   A
Sbjct: 222 PGMKDGQRIVFKGEADQAPD-VIPGDVVFIVSERPH---------KNFKR-DGDDLVYEA 270

Query: 309 TISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPR-GQRGD 367
            I L  A+ G E               I PG VI PG    I  +G PI   P+ G  G+
Sbjct: 271 EIDLLTAIAGGE-FALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPI---PKYGGYGN 326

Query: 368 LYVFIHIEFPPDNWFNEKSELLAIKTMLP 396
           L +   I+F P+N F  +  L  ++ +LP
Sbjct: 327 LVIKFTIKF-PENHFTTEENLKKLEEILP 354

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  138 bits (348), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 123/452 (27%), Positives = 188/452 (41%), Gaps = 46/452 (10%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           +LYD++GV+  A   +IK AYRK ALK+HPDK    N  E    KFKEI++AYEILSD +
Sbjct: 6   KLYDLIGVSPGADDAQIKKAYRKAALKYHPDK----NPTEEAAEKFKEISSAYEILSDSQ 61

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
           K+  YD +G++                               G+  PR      +     
Sbjct: 62  KREMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQFFGGAGGSSRPRGPQKGRDIRHEI 121

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKG 188
                     T+++LY G+  K  L +QI+C  C G G K           +C SC G+G
Sbjct: 122 SA--------TLEELYKGRTAKLALNKQILCKSCEGRGGK------AGAVKKCSSCNGQG 167

Query: 189 SKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248
            K   ++ GP ++      C+ C+G G  +    + K+ C  C G  + ++++I+ V++ 
Sbjct: 168 FKFITRQMGP-MIQRFQAECDACNGTGDII----DAKDRCKACNGKKIANERKILEVHIE 222

Query: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSA 308
           PG      I  +G AD+  D      +        E   +K            +DLY  A
Sbjct: 223 PGMKDGQKIVFQGEADQAPDVVPGDVVFVVSERPHERFNRK-----------GDDLYYEA 271

Query: 309 TISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDL 368
            + L  A+ G E               I PG VI PG    I  +G P+     G  G+L
Sbjct: 272 EVDLLTAIAGGE-FAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQK--YGGFGNL 328

Query: 369 YVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPINNETISNFQII 428
            V   I+FPP N F +++ L  ++ +LP     T    A         I +  +++F + 
Sbjct: 329 IVKFKIKFPP-NHFADEASLKQLENILPPRVKPTIPKGAQ--------IEDCVLADFDLS 379

Query: 429 NMEELPEGMKIFNSESQNSAHQKAKSSYCPMQ 460
                    K  N +S +  HQ A+   C  Q
Sbjct: 380 KHSGKSSQSKGQNYDSDDEEHQGAEGVQCASQ 411

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  138 bits (347), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 174/405 (42%), Gaps = 49/405 (12%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           +LYD LGV+  AS  EIK AYRK ALK+HPDK   + + E    KFKE+++AYEILSD +
Sbjct: 6   KLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAE----KFKEVSSAYEILSDSQ 61

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFP-REYDTYEEXXXX 127
           K+  YD +G++                                   P R  D   E    
Sbjct: 62  KREVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGRPRGPQRGRDIKHEMAA- 120

Query: 128 XXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWK---LKKKIHVTHEVECESC 184
                      ++++LY G+  K  L +QI+C  C G G K   +KK         C SC
Sbjct: 121 -----------SLEELYKGRTAKLALNKQILCKSCEGRGGKEGAVKK---------CSSC 160

Query: 185 GGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIIT 244
            G+G K   ++ GP ++      C+ CHG G  +    + K+ C  C G  + ++++I+ 
Sbjct: 161 NGQGIKFVTRQMGP-MIQRFQTECDVCHGTGDII----DAKDRCKSCNGKKVDNERKILE 215

Query: 245 VNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDL 304
           V + PG      I  KG AD+  D    GD+ F + EK     Q+          + +DL
Sbjct: 216 VRIEPGMKDGQKIVFKGEADQAPD-VIPGDVVFVISEKPHKHFQR----------AGDDL 264

Query: 305 YTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQ 364
              A I L  AL G +               I PG VI PG    +  +G PI     G 
Sbjct: 265 IYEAEIDLLTALAGGQ-FALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQK--YGG 321

Query: 365 RGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANT 409
            G+L +  +I+F P+N F  +  L  ++ +LP          A  
Sbjct: 322 YGNLLIKFNIKF-PENHFTSEENLKKLEEILPPRRQINIPAKAQV 365

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  137 bits (346), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 120/405 (29%), Positives = 179/405 (44%), Gaps = 45/405 (11%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           + YD+LGV++ AS  EIK AYRK ALK+HPDK   + + E    KFKE ++AYE+L D E
Sbjct: 6   KFYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAE----KFKEASSAYEVLMDAE 61

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGN-DFPREYDTYEEXXXX 127
           K+  YD +G++                               G    PR      +    
Sbjct: 62  KREAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASRPRGPQRGRDIKHE 121

Query: 128 XXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWK---LKKKIHVTHEVECESC 184
                     +T+++LY G+  K  L +QI+C  C G G K   +KK         C SC
Sbjct: 122 IT--------VTLEELYKGRTSKLALNKQILCKTCEGRGGKEGAVKK---------CTSC 164

Query: 185 GGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIIT 244
            G+G K   ++ GP ++      C+ C G G  +    NPK+ C  C+G  + ++++I+ 
Sbjct: 165 NGQGVKFITRQMGP-MIQRFQTECDACDGTGDII----NPKDRCKACSGKKVANERKILE 219

Query: 245 VNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDL 304
           V+V PG      I  KG AD+  D    GD+ F + E+           K+F   S +DL
Sbjct: 220 VHVDPGMKDGQKIVFKGEADQAPDIIP-GDVIFVVSERPH---------KHFRRDS-DDL 268

Query: 305 YTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQ 364
              A I L  A+ G E               I PG VI PG    I  +G P++    G 
Sbjct: 269 VYEADIDLLTAIAGGE-FAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLK--YGG 325

Query: 365 RGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANT 409
            G+L V  +I FP D+ F     +  ++ +LP     +  + A+ 
Sbjct: 326 FGNLLVKFNIVFPKDH-FTSLENMKKLEEILPPRKKTSIPSKAHV 369

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  136 bits (343), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 114/392 (29%), Positives = 178/392 (45%), Gaps = 50/392 (12%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           +LYD+LGV+  A   +IK AYRK ALK HPDK   + + E    KFKEIT+AYEILSD +
Sbjct: 6   KLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAE----KFKEITSAYEILSDSQ 61

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
           K+  YD     +                              G+  PR      +     
Sbjct: 62  KREVYD----QFGLEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSSRPRGPQKGRDIRHEI 117

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWK---LKKKIHVTHEVECESCG 185
                     T++ L+ G+  K  L +Q++C  C G G K   +KK         C +C 
Sbjct: 118 PA--------TLEQLFKGRTAKLALNKQLICKSCEGRGGKEGSVKK---------CTACS 160

Query: 186 GKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITV 245
           G+G K   ++ GP ++    V CE CHG G+ +    +PK  C  C+G  + ++++++ V
Sbjct: 161 GQGFKFVTRQMGP-MIQRFQVECESCHGAGEII----DPKGRCKVCSGKKVVNERKVLEV 215

Query: 246 NVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLY 305
           N+ PG      I  +G AD+       GD+ F + E+   + ++             DL+
Sbjct: 216 NIEPGMKDGQRIVFQGEADQS-PGIIPGDVVFVVSEQPHPVFKR----------DGNDLH 264

Query: 306 TSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPR-GQ 364
             A I L  A+ G +               I PG VI PG V  I  +G PI   P+ G 
Sbjct: 265 YDAEIDLLSAIAGGQ-FAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPI---PKYGG 320

Query: 365 RGDLYVFIHIEFPPDNWFNEKSELLAIKTMLP 396
            G+L +  +I+FPP ++ ++++ L  ++ +LP
Sbjct: 321 YGNLLIKFNIKFPPAHFTDDET-LKKLEEILP 351

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  135 bits (340), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 118/403 (29%), Positives = 177/403 (43%), Gaps = 38/403 (9%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           + YD+LGV+ DA+  +IK AYRK ALK HPDK    N  E    KFKE+T AYEILSD +
Sbjct: 6   KFYDLLGVSPDANDAQIKKAYRKQALKFHPDK----NPSEEAADKFKELTVAYEILSDSQ 61

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
           K+  YD  G++                               G+  PR      +     
Sbjct: 62  KRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPRGPQKGRDIKHEM 121

Query: 129 XXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKG 188
                     ++++LY G+  K  L +QI+C  C G G K           +C SC G+G
Sbjct: 122 SA--------SLEELYKGRTAKLALNKQILCKTCEGRGGK------AGAVKKCSSCNGQG 167

Query: 189 SKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248
            K   ++ GP ++      C+ C G G  +    +PK+ C  C G  + ++++I+ V++ 
Sbjct: 168 IKFITRQMGP-MIQRFQAECDVCSGTGDII----DPKDRCKSCNGKKIDNERKILEVHIE 222

Query: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSA 308
           PG      I  +G AD +      GD+ F + ++           K+F E   +DL   A
Sbjct: 223 PGMKDGQKIVFQGEAD-QAPGIIPGDVVFVISQRPH---------KHF-ERKGDDLLYQA 271

Query: 309 TISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDL 368
            + L  A+ G E              SI PG VI PG    I  +G PI     G  G+L
Sbjct: 272 EVDLLSAIAGGE-FAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQK--YGGYGNL 328

Query: 369 YVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGE 411
            V   I FP +++ +E+S L  ++ +LP  S  +   +A   E
Sbjct: 329 IVTFKINFPTNHFADEES-LKKLEEILPPRSKPSIPKSAEVEE 370

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  128 bits (321), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 123/447 (27%), Positives = 181/447 (40%), Gaps = 58/447 (12%)

Query: 3   GSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYE 62
           GS     LYD LGV ++AS QEIK AYR  ALKHHPDK       E +++KF++I  AYE
Sbjct: 2   GSAMNNDLYDTLGVAANASRQEIKKAYRLKALKHHPDK---NGHSEQSKLKFQQICKAYE 58

Query: 63  ILSDPEKKSHYDLYG---------DDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGND 113
           IL D +K+  YD +G         +                               EG D
Sbjct: 59  ILGDDKKREMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFSEGMD 118

Query: 114 F---PREYDTYEEXXXXXXXXXXXXXFL--TVKDLYMGKKLKFELKRQIVCMVCHGSGWK 168
           F    R +                  +L  T++++Y GK+ K  LKR  +C  C G G K
Sbjct: 119 FFGSSRGFRAQGSRRSAPQRGPDIKHYLKCTLEEMYNGKRAKLALKRTRLCQTCQGEGSK 178

Query: 169 LKKKIHVTHEVECESCGGKGSKERLKRFGPGLVASQW-VTCEKCHGKGKYVKRPKNPKNF 227
                       C +C GKG + + KR GP  +   W  TC  C G G  VK    P + 
Sbjct: 179 --------KATSCYACRGKGMQTQTKRQGP--IMQTWSSTCGTCGGSGTIVK----PSDI 224

Query: 228 CPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEEL------DKSACGDLKFHLVE 281
           C  C G G   +++I  + V  G      + +   ADE +      ++   GD+   L  
Sbjct: 225 CNGCHGQGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPGDVIIIL-- 282

Query: 282 KQENLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRV 341
             E L  +   LK   + S   L +   + L  +L G                 + PG +
Sbjct: 283 --EQLPHRS--LKRGHDSSL--LLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGEL 336

Query: 342 IRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPS-SSS 400
           ++PG +  + + G P     +G  GDL++   + F PDN   +      I+TM  +    
Sbjct: 337 LKPGAIKCVQSMGMP---KSKGGYGDLFIKFKVIF-PDNLKPD-----TIQTMQAALDKE 387

Query: 401 CTFQTTANTGE--DDRNPINNETISNF 425
            + QT+A T    D+  P+     +NF
Sbjct: 388 PSMQTSATTQPEIDEGIPVEEHVFTNF 414

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  122 bits (306), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 115/416 (27%), Positives = 175/416 (42%), Gaps = 49/416 (11%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           + YD+LGV+  AS  EIK AYRK ALK+HPDK    N  E    KFK            E
Sbjct: 6   KFYDILGVSPSASSSEIKKAYRKFALKYHPDK----NPSEEAAEKFK------------E 49

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
             + Y++  DD                                + F + +          
Sbjct: 50  ASAAYEVLSDDEKREMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRP 109

Query: 129 XXXXXXXXF-----LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECES 183
                          T+++LY G+  K  L +QI+C  C G G K K  +      +C S
Sbjct: 110 RGPQRGRDIKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGK-KGAVK-----KCSS 163

Query: 184 CGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEII 243
           C G+G K   ++ GP L   Q   CE CHG G  +    +PK+ C  C    + ++++I+
Sbjct: 164 CNGQGVKFVTRQMGPMLQRFQ-AECEVCHGTGDII----DPKDRCKTCNAKKVTNERKIL 218

Query: 244 TVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAED 303
            V++ PG      +  KG AD+  D    GD+ F + +K     Q+          + +D
Sbjct: 219 EVHIEPGMKDGQKVVFKGEADQAPDIIP-GDVIFVVSQKPHEHFQR----------AGDD 267

Query: 304 LYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPR- 362
           L   A I L  A+ G E              +I PG VI PG    I+++G PI   P+ 
Sbjct: 268 LVYEAEIDLLTAIAGGE-FAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPI---PKY 323

Query: 363 GQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGEDDRNPIN 418
           G  G+L V  +I+FPP+++ +E+S L  ++ +LP  +       A   E   +P +
Sbjct: 324 GGYGNLIVKFNIKFPPNHFTDEES-LKKLEEILPPRTKTNIPEGAVIDECVLSPFD 378

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  122 bits (306), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 105/390 (26%), Positives = 158/390 (40%), Gaps = 44/390 (11%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           +LYDVL V+ +AS  EI+ AYR LALKHHPDK    N  E ++ KF E+  AYEIL D +
Sbjct: 6   RLYDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSKFLEVNEAYEILIDEK 62

Query: 69  KKS---HYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXX 125
           K+S    Y    ++                               G+ F   +D      
Sbjct: 63  KRSLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMSSPS 122

Query: 126 XXXXXXXXXXXF---------LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVT 176
                                 T+  LY GK  K  L R+ VC  C G G     K+   
Sbjct: 123 FGGKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRG---SMKVRT- 178

Query: 177 HEVECESCGGKGSKERLKRFGPGLVASQWV-TCEKCHGKGKYVKRPKNPKNFCPDCAGVG 235
               C++C G+G + R ++ GP  +   W  TC  C+G G + K      + C DC G G
Sbjct: 179 ----CKACRGRGQQSRSRQMGP--MMQTWTQTCSDCNGMGTFTK----DSDVCRDCEGEG 228

Query: 236 LQSKKEIITVNVAPGHHFNDVITIKGMADEEL------DKSACGDLKFHLVEKQENLEQK 289
              +++I  V V PG      I + G ADE +      +    GD+   +++ ++   Q+
Sbjct: 229 CIRERKIFDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKDPKFQR 288

Query: 290 QIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIK 349
                  +    + +  +  I L  +L G +              +I PG +I+P     
Sbjct: 289 ------VNRNGCDLMVRNCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNHFKS 342

Query: 350 ITNEGWPIMDDPRGQR--GDLYVFIHIEFP 377
           I N G P  ++ R     G+LY+   +EFP
Sbjct: 343 IENLGMPRYEEKRAPEGYGNLYIQFQVEFP 372

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  110 bits (275), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 96/383 (25%), Positives = 146/383 (38%), Gaps = 39/383 (10%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           +LYDVLGV    S  E+K +Y+  AL++HPDK       E ++ +F++I  AY +L D  
Sbjct: 6   RLYDVLGVQPGVSAAELKKSYKLAALRYHPDK---NGHSEASKQRFQQIADAYRVLGDER 62

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
            +  YD YG                                +G      +  + E     
Sbjct: 63  LRKIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGLG-SFAIFGESGASS 121

Query: 129 XXXXXXXXFLTVK--------DLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE 180
                      +K        +LY GK ++  L R  +C +C G G         +    
Sbjct: 122 ARCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGG--------SRAST 173

Query: 181 CESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK 240
           C +C G+G   + KR G  LV +   TC  C G G  VK      + C  C G G   ++
Sbjct: 174 CTACSGQGICSQTKRQGS-LVQTWSSTCRVCSGSGTIVK----DCDTCTSCGGAGYLRER 228

Query: 241 EIITVNVAPGHHFNDVITIKGMADEEL------DKSACGDLKFHLVEKQENLEQKQIFLK 294
           ++  V + PG      +   G ADE +      ++   GDL          +E+     +
Sbjct: 229 KVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAI-------TIEEATPATR 281

Query: 295 NFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEG 354
               G A  L T   + L  +L G                 I PG ++ PG +  I + G
Sbjct: 282 YQCRGDANLLLTELHVDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLG 341

Query: 355 WPIMDDPRGQRGDLYVFIHIEFP 377
            P  DDP  Q G L++  H++FP
Sbjct: 342 MPHPDDP-SQYGHLFIKFHVDFP 363

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  103 bits (258), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 81/274 (29%), Positives = 129/274 (47%), Gaps = 28/274 (10%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY G+  K  L +QI+C  C G G K           +C SC G+G K   ++ GP
Sbjct: 122 TLEELYKGRTAKLALNKQILCKTCEGRGGK------AGAVKKCTSCNGQGIKFVTRQMGP 175

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            ++      C+ CHG G  +    +PK+ C DC G  + ++++++ V+V PG      I 
Sbjct: 176 -MIQRFQTECDVCHGSGDII----DPKDRCKDCKGKKIANERKVLEVHVEPGMREGQKIV 230

Query: 259 IKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSEALTG 318
            KG AD+  D    GD+ F +VEK           K+F   + +DL   A I L  A+ G
Sbjct: 231 FKGEADQAPD-VIPGDVIFVVVEKPH---------KHFKR-AGDDLLYEAEIDLLTAIAG 279

Query: 319 FEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPR-GQRGDLYVFIHIEFP 377
            E              ++ PG VI  G    I  +G P+   P+ G  G+L V   I+FP
Sbjct: 280 GEFAIQHVSGDWLKVSTV-PGEVISSGMKKVIEGKGMPV---PKYGGYGNLIVTFKIKFP 335

Query: 378 PDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGE 411
            +N+  E  +L  ++ +LP+ +  +    A+  E
Sbjct: 336 ENNFATE-DKLKELENILPARTPVSIPAKASIDE 368

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV+ +AS  EIK  YRK ALK+HPDK   + + E    KFKE +AAYE+LSD +
Sbjct: 6  KFYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAE----KFKECSAAYEVLSDSQ 61

Query: 69 KKSHYDLY 76
          K+  YD Y
Sbjct: 62 KREVYDQY 69

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  103 bits (257), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 109/421 (25%), Positives = 169/421 (40%), Gaps = 73/421 (17%)

Query: 4   SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
           S +  +LYD L ++ DA+ QEIK AYR  ALK HPDK    N  E ++ KF+EI  AYEI
Sbjct: 3   SVKNTELYDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKRKFQEICKAYEI 59

Query: 64  LSDPEKKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEE 123
           L D +KK  YD YG                               + G+      D + +
Sbjct: 60  LGDAKKKLLYDRYG----------------TVDESVIQEQQQEGVYYGSSGMSAGDLFSQ 103

Query: 124 XXXXXXXXXXXXXFLTVKDLYMGKKLKF-------ELKRQIVCM---VCHGSGWKLKKKI 173
                        F      + GKK          ++K  + C    + HG     K K+
Sbjct: 104 FFGGGSTTSASSFFNDDTMFFTGKKNSQRRVSRGPDIKHNLRCSLEELYHGK----KSKL 159

Query: 174 HVTHEVECESCGGKGSKE--------------RLKRFGPGLVASQWVTCEKCHGKGKYVK 219
            +     C++C G G                 + +R GP +V +   TC+ C G G +V+
Sbjct: 160 RLDRTRLCKTCKGNGGTSSSACRACNGQGFYTQTRRHGP-MVQTWSTTCQDCGGSGTFVR 218

Query: 220 RPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEEL------DKSACG 273
           R    K+ C +C G G   +++I  + V PG H    I +   ADE +      ++   G
Sbjct: 219 R----KDVCSECKGQGCIKERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPG 274

Query: 274 DLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXX 333
           D+   + + +  L Q    + N  +    D +    + L  +L G E             
Sbjct: 275 DVIIIVQQVKHPLFQ----IHNDTDLVMNDCH----VDLKTSLCGGEVLIENHPCGSALK 326

Query: 334 XSIKPGRVIRPGDVIKITNEGWPIMDDPRGQR-GDLYVFIHIEFPPD---NWFNEKSELL 389
             + PG +++PG V  + + G P    P+ Q  G+LY+   ++FP        N+ SELL
Sbjct: 327 IEVLPGEILKPGCVKCVESMGMP---HPQSQGFGNLYIRFQVDFPDKLQLETINKVSELL 383

Query: 390 A 390
            
Sbjct: 384 G 384

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  102 bits (255), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 85/275 (30%), Positives = 124/275 (45%), Gaps = 32/275 (11%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWK---LKKKIHVTHEVECESCGGKGSKERLK 194
           +T+++LY G+  K  L +QI+C  C+G G K   +KK         C SC G+G K   +
Sbjct: 123 VTLEELYKGRTAKLALNKQILCKGCNGRGGKEGAVKK---------CSSCNGQGYKFVTR 173

Query: 195 RFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFN 254
           + GP ++      CE C G G  +    +PK+ C  C G  + ++++I+ V+V PG    
Sbjct: 174 QMGP-MIQRFQTECEACAGTGDII----DPKDRCKSCNGKKVANERKILEVHVDPGMKDG 228

Query: 255 DVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSE 314
             I  KG AD+  D    GD+ F + EK           KNF     +DL   A I L  
Sbjct: 229 QKIVFKGEADQAPDVIP-GDVIFVVSEKPH---------KNFQR-VGDDLVYEAEIDLLT 277

Query: 315 ALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHI 374
           A+ G E              +I PG VI PG    +  +G PI     G  G+L V   I
Sbjct: 278 AVAGGE-FSLEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAK--FGGYGNLLVTFKI 334

Query: 375 EFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANT 409
            FPP N F     L  ++ +LP  +  T  + A+ 
Sbjct: 335 NFPP-NHFTSDENLKKLEEILPPRAKTTIPSKAHV 368

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 49/72 (68%), Gaps = 6/72 (8%)

Query: 5  DRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEIL 64
          D +Y  YD+LGV+  A+  EIK AYRK ALK+HPDK     + E    KFKE+++AYE+L
Sbjct: 4  DSKY--YDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAAE----KFKEVSSAYEVL 57

Query: 65 SDPEKKSHYDLY 76
          SD EK+  YD +
Sbjct: 58 SDSEKRQVYDQF 69

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/261 (29%), Positives = 131/261 (50%), Gaps = 32/261 (12%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWK---LKKKIHVTHEVECESCGGKGSKERLKR 195
           T+++LY G+  K  L + ++C  C G G K   +KK         C SCGG G K   ++
Sbjct: 123 TLENLYKGRTAKLALNKTVLCKSCEGRGGKSGSVKK---------CSSCGGHGVKFVTRQ 173

Query: 196 FGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFND 255
            GP ++     TCE C+G+G  +    +PK+ C +C+G  + ++++I+ VN+ PG     
Sbjct: 174 MGP-MIQRFQTTCEACNGEGDVI----DPKDRCRECSGKKISNERKILEVNIEPGMKNGQ 228

Query: 256 VITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSEA 315
            +  +G AD++  +   GD+ F +V +QE+ +    F++N D     +L+  A I L  A
Sbjct: 229 KVVFQGEADQQPGQIP-GDVVF-VVNEQEHPK----FVRNGD-----NLHYEAQIDLLTA 277

Query: 316 LTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHIE 375
           + G +               I PG VI PG V  I  +G PI     G  G+L +  +++
Sbjct: 278 VAGGQ-FALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQK--YGSYGNLLIKFNVK 334

Query: 376 FPPDNWFNEKSELLAIKTMLP 396
           F P + F   ++L  ++ +LP
Sbjct: 335 F-PKSHFASDADLKKLEEILP 354

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 49/66 (74%), Gaps = 4/66 (6%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV++DA+  +IK AYRK ALK+HPDK     + +    KFK++TAAYEILSD +
Sbjct: 6  KLYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAAD----KFKQMTAAYEILSDSQ 61

Query: 69 KKSHYD 74
          K+  YD
Sbjct: 62 KREVYD 67

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 99.8 bits (247), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 98/382 (25%), Positives = 157/382 (41%), Gaps = 57/382 (14%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y +LGV   AS +EIK+AYR+L+ K+HPDK  +  + E +   F E+  AY++LSDPEK+
Sbjct: 22  YAILGVDKQASEKEIKSAYRQLSKKYHPDK--NPGNDEAHH-HFIEVGEAYDVLSDPEKR 78

Query: 71  SHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXXXX 130
             YD +G D                               GN F   +D +E+       
Sbjct: 79  QIYDRHGAD-------------------ALKNGHPGGPGGGNGFHDPFDLFEQMFGSNMY 119

Query: 131 XXXXXXF----------LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE 180
                            +++K  Y+G + +F L    +C  C GSG +  K         
Sbjct: 120 NRARGKPRGQNLQVNHDISLKTFYLGTEFEFTLNLNDICDACDGSGSEDGKT------ET 173

Query: 181 CESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK 240
           C  CGG G   ++ R GP +       C +C G+G+ +K      + C  C GV +  K 
Sbjct: 174 CPDCGGSGQIMKVFRAGP-IEQRVRQPCSRCQGRGQLIK------HVCKKCKGVKVVQKS 226

Query: 241 EIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGS 300
           ++ T  V PG   N +  ++G +++  D    GDL  +  E +++    +          
Sbjct: 227 KVFTAKVEPGMERNHIHVMQGQSEKHPDIEP-GDLYQYFRESEKDSMGYR--------RR 277

Query: 301 AEDLYTSATISLSEALT-GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMD 359
              LY +  +S  EAL  G+E+             S   G  ++ G+   I + G PI  
Sbjct: 278 GNTLYRTEILSFKEALQGGWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPI-P 336

Query: 360 DPRGQRGDLYVFIHIEFPPDNW 381
               + GDL +  ++   P  W
Sbjct: 337 SATDKFGDL-IIDYVILLPGEW 357

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score =  100 bits (250), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/256 (28%), Positives = 115/256 (44%), Gaps = 42/256 (16%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           ++KDLY GKK K  L R  +C++C G G   K K        C +C G GS  + +R GP
Sbjct: 174 SLKDLYYGKKTKLRLDRTRLCVLCMGQGSMKKSK--------CFTCNGLGSLTQTRRMGP 225

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            ++ +   +C  C G G +VKR     + C  C+G G   +++I  V + PG     VI 
Sbjct: 226 -MIQTFSQSCPDCQGSGMFVKR----SDTCQSCSGNGYVEERKIFDVEIQPGMVNGQVII 280

Query: 259 IKGMADEELDKS------ACGDLKFHLVEKQEN----LEQKQIFLKNFDEGSAEDLYTSA 308
           + G ADE ++ S        GD+   + + ++N    +    + L NF            
Sbjct: 281 LPGEADEVVNTSFGKQKVIAGDIVLTINQLKDNNFEVINDCDLLLDNF------------ 328

Query: 309 TISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMD--DP----- 361
           +++LS+AL G                 I PG ++ PG +  + N G P  +  DP     
Sbjct: 329 SVNLSKALCGGTIFISNHPSGNLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSII 388

Query: 362 RGQRGDLYVFIHIEFP 377
              +G+LYV   I+FP
Sbjct: 389 NISKGNLYVKFDIKFP 404

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+L ++S+A  ++IK AYR LALK+HPDK    N  E +++ F++I+ AYE+L D E
Sbjct: 6  ELYDILNISSNADAKDIKKAYRVLALKYHPDK---NNHSEESKVMFQKISEAYEVLIDVE 62

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 63 KRKLYDQYG 71

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 98.6 bits (244), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 106/382 (27%), Positives = 152/382 (39%), Gaps = 58/382 (15%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y +LGV+  A  ++IK+AYR+L+ K+HPDK  D +S      KF E+  AYE+LSDPEK+
Sbjct: 22  YSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDDDSAHN---KFIEVGEAYEVLSDPEKR 78

Query: 71  SHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXXXX 130
             YD YG                                 G  F   +D +E+       
Sbjct: 79  KIYDQYG----------------AEALKNNGGQGGGQGPRGGGFHDPFDIFEQMFGGGGG 122

Query: 131 XXXXXXFLTVKDL-----------YMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEV 179
                      +L           Y G  + F L     C  C GSG +  K   VT   
Sbjct: 123 GQRQRRRARGHNLETREELTLKEYYRGTSIDFNLNLNDFCEHCEGSGSQDGK---VT--- 176

Query: 180 ECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSK 239
           +C  C G G   ++ R GP     Q + C KC G+G  +      KN C  C G  +  K
Sbjct: 177 KCPDCKGHGVVVQIVRMGPVTQQIQQM-CGKCQGRGSTI------KNKCKHCHGEKVVRK 229

Query: 240 KEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVE-KQENLEQKQIFLKNFDE 298
            +   V+V PG   N V   +G +D+  D  A GDL     E  ++NL  ++        
Sbjct: 230 PKSFHVDVPPGAPRNFVEVKQGESDKGPDFDA-GDLFIKFSETSRDNLGYRR-------- 280

Query: 299 GSAEDLYTSATISLSEALT-GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPI 357
              +DL+ +  +SL EAL  G+E+                   V   G++ +I   G P 
Sbjct: 281 -RGDDLFRTEALSLREALKGGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMP- 338

Query: 358 MDDPRGQRGDLYVFIHIEFPPD 379
                 + GDLY+   +  P D
Sbjct: 339 --KEHNKFGDLYIDYVVIVPDD 358

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 123/264 (46%), Gaps = 30/264 (11%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFG 197
           +T+++LY GK  K  L +QI+C  C G G K K  +      +C SC G+G K   ++ G
Sbjct: 121 VTLEELYRGKTSKLALNKQILCKTCEGRGGK-KGAVK-----KCSSCNGQGIKFVTRQMG 174

Query: 198 PGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVI 257
           P ++      C+ CHG G  V    +PK+ C  C G  + S+++I+ V+V PG      +
Sbjct: 175 P-MIQRFQTECDVCHGAGDIV----DPKDRCKSCNGKKVASERKILEVHVDPGMKNGQKV 229

Query: 258 TIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSEALT 317
             KG AD+  D    GD+ F + EK     Q+          S ++L   A + L  A+ 
Sbjct: 230 VFKGEADQAPD-VIPGDVVFVINEKPHKHFQR----------SGDNLVYEAEVDLLTAIA 278

Query: 318 GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
           G E              +I PG VI PG    I  +G P+     G  G+L +   ++FP
Sbjct: 279 GGE-FAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAK--YGGYGNLIIKFTVKFP 335

Query: 378 PDNWFNEKS-----ELLAIKTMLP 396
             ++  E++     E+L  +T LP
Sbjct: 336 EPHFTTEENLKKLEEILPQRTPLP 359

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 49/69 (71%), Gaps = 4/69 (5%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYDVLGV+  A+  EIK AYRK+ALK HPDK   + + E    KFKE ++AYE+LSD +
Sbjct: 6  KLYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAE----KFKEASSAYEVLSDAD 61

Query: 69 KKSHYDLYG 77
          K+  YD +G
Sbjct: 62 KRDTYDQFG 70

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 110/387 (28%), Positives = 160/387 (41%), Gaps = 70/387 (18%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y +L +  DAS +EIK+AYR+L+ K+HPDK  +  S E +  KF EI  AYE+LSDPEKK
Sbjct: 25  YAILDIGKDASEKEIKSAYRQLSKKYHPDK--NAGSDEAHH-KFIEIGEAYEVLSDPEKK 81

Query: 71  SHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGND-FPREYDTYEEXXXXXX 129
             YD +G D                             H+  D F R +   +       
Sbjct: 82  KIYDQFGAD------------AVKNGGGGAGGPGGGGFHDPFDIFERMFQGGQGGPGGGF 129

Query: 130 XXXXXXXFLTVK--------DLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVEC 181
                    T+K          Y G  ++F L     C  CHGSG    K        +C
Sbjct: 130 GQRQRQRGPTIKVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSGSADGKL------AQC 183

Query: 182 ESCGGKGSKERLKRFGPGLVASQWV--TCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSK 239
             C G+G   ++ R G   + +Q +   C +C G G+ +      KN C  C G  +  K
Sbjct: 184 PDCQGRGIIVQVVRMG---IMTQQIQQICGRCAGTGQVI------KNQCKTCHGKKVTKK 234

Query: 240 KEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVE-KQENLEQKQIFLKNFDE 298
            +   V+V PG   N + T  G A++  D  A GDL     E   EN+  ++        
Sbjct: 235 NKFFHVDVPPGAPRNYMDTRAGEAEKGPDFDA-GDLVIEFREMDTENMGYRR-------- 285

Query: 299 GSAEDLYTSATISLSEAL-TGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNE---- 353
               +LY +  +S +EAL  G+E+               KP ++ RP   +  T E    
Sbjct: 286 -RGHNLYRTEVLSAAEALYGGWERTIEFLDEN-------KPVKLSRPAHAVVSTGEIEVV 337

Query: 354 -GWPIMDDPRGQR--GDLYVFIHIEFP 377
            G+ +   P+G R  GDLY+   +  P
Sbjct: 338 KGFGM---PKGSRDHGDLYIDYVVVMP 361

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score = 97.4 bits (241), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 82/274 (29%), Positives = 126/274 (45%), Gaps = 28/274 (10%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           ++++LY G+  K  L +QI+C  C G G K K  +      +C  C G+G K   ++ GP
Sbjct: 123 SLEELYKGRTAKLALNKQILCKECEGRGGK-KGAVK-----KCTGCNGQGIKFVTRQMGP 176

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            ++      C+ CHG G  V    +PK+ C  C G  ++++++I+ V+V PG      I 
Sbjct: 177 -MIQRFQTECDACHGTGDIV----DPKDRCKSCNGKKIENERKILEVHVEPGMKDGQKIV 231

Query: 259 IKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSEALTG 318
            KG AD+  D    GD+ F + E+           K+F     +DL   A I L  A+ G
Sbjct: 232 FKGEADQAPD-VIPGDVVFLVSERPH---------KHFKR-DGDDLVYEAEIDLLTAIAG 280

Query: 319 FEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPR-GQRGDLYVFIHIEFP 377
            E               I PG VI PG    I  +G P+   P+ G  G+L V   I+F 
Sbjct: 281 GE-FALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPV---PKYGGYGNLIVKFTIKF- 335

Query: 378 PDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGE 411
           P+N F  +  L  ++ +LP  ++ T    A   E
Sbjct: 336 PENHFTTEENLKKLEEILPPRATPTIPKKATVDE 369

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 50/74 (67%), Gaps = 4/74 (5%)

Query: 6  RRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILS 65
          +  + YD+LGV+  A+  EIK AYRK ALK HPDK   + + E    KFKE ++AYE+LS
Sbjct: 3  KETKFYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAE----KFKEASSAYEVLS 58

Query: 66 DPEKKSHYDLYGDD 79
          D EK+  YD +G+D
Sbjct: 59 DSEKREVYDQFGED 72

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score = 96.7 bits (239), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 129/276 (46%), Gaps = 32/276 (11%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWK---LKKKIHVTHEVECESCGGKGSKERLKR 195
           ++++LY G+  K  L +Q++C  C G G K   +KK         C SC G+G K   ++
Sbjct: 123 SLEELYKGRTAKLALNKQVLCKTCEGRGGKEGAVKK---------CASCNGQGVKFITRQ 173

Query: 196 FGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFND 255
            GP ++      C+ C+G G  V    +PK+ C  C G  + ++++I+ V++ PG     
Sbjct: 174 MGP-MIQRFQAECDACNGTGDIV----DPKDRCKTCNGKKIDNERKILEVHIEPGMKDGQ 228

Query: 256 VITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSEA 315
            I  +G AD +      GD+ F + ++           K+F E   ++LY  A + L  A
Sbjct: 229 KIVFQGEAD-QAPGVIPGDVIFVISQRPH---------KHF-ERKGDNLYYQAEVDLLSA 277

Query: 316 LTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHIE 375
           + G E               I PG VI PG    I  +G P+     G  GDL V   + 
Sbjct: 278 IAGGE-FAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQK--YGGFGDLIVTFKVN 334

Query: 376 FPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGE 411
           FP +++ +E+S L  ++ +LP  +  +F  +A+  E
Sbjct: 335 FPTNHFADEES-LKKLEEILPPRAKPSFPKSADVEE 369

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 6  RRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILS 65
          +  + YD+LGV  DA+  +IK  YRK ALK HPDK    N       KFKE+T AYE+LS
Sbjct: 3  KETKFYDLLGVPVDANDAQIKKGYRKQALKFHPDK----NPSAEAADKFKELTVAYEVLS 58

Query: 66 DPEKKSHYD 74
          D +K+  YD
Sbjct: 59 DSQKRDIYD 67

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score = 96.3 bits (238), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 123/272 (45%), Gaps = 28/272 (10%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY G+  K  L +QI+C  C G G K K  +      +C SC G+G K   ++ GP
Sbjct: 126 TLEELYKGRTAKLALNKQILCKTCEGRGGK-KGAVK-----KCSSCNGQGVKFVTRQMGP 179

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            ++      C+ C G G  +    +PK+ C  C    + ++++I+ V++ PG      I 
Sbjct: 180 -MIQRFQAECDVCSGTGDII----DPKDRCKTCNAKKVTNERKILEVHIEPGMKDGQNIV 234

Query: 259 IKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSEALTG 318
            KG AD+  D    GD+ F + +K     Q+          S +DL   A I L  A+ G
Sbjct: 235 FKGEADQAPD-VIPGDVIFVVAQKPHKHFQR----------SGDDLVYEAEIDLLTAIAG 283

Query: 319 FEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPR-GQRGDLYVFIHIEFP 377
            E              SI PG VI PG    I  +G PI   P+ G  G+L V   ++FP
Sbjct: 284 GE-FALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPI---PKYGGHGNLIVHFTVKFP 339

Query: 378 PDNWFNEKSELLAIKTMLPSSSSCTFQTTANT 409
             ++ +E S L  ++ +LP     +    A  
Sbjct: 340 QKHFADEDS-LKKLEEILPPRKKISIPANATV 370

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/66 (60%), Positives = 46/66 (69%), Gaps = 4/66 (6%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYDVLGV+  A   EIK AYRK ALK+HPDK    N  E    KFKE++AAYEILSD E
Sbjct: 6  KLYDVLGVSPTAGDSEIKKAYRKSALKYHPDK----NPTEEGAEKFKEVSAAYEILSDSE 61

Query: 69 KKSHYD 74
          K+  YD
Sbjct: 62 KREIYD 67

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 101/371 (27%), Positives = 152/371 (40%), Gaps = 35/371 (9%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y +LGV   AS ++IK+AYR+L+ K+HPDK       E    +F E+  AYE LSDPEK+
Sbjct: 23  YAILGVGRGASDKDIKSAYRQLSKKYHPDK---NPGDEDAHNRFIEVGEAYEALSDPEKR 79

Query: 71  SHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXXXX 130
             YD +G +                               G    R +    +       
Sbjct: 80  KIYDQFGAE-ALKNGGDRAGGGGAGGGFHDPFDIFDQMFGGGAGSRFHGGGGQRRKQRGQ 138

Query: 131 XXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE-CESCGGKGS 189
                  L +K  Y G  ++F +     C  C GSG +  K       VE C  CGG+G 
Sbjct: 139 SLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSGSQDGK-------VEKCGQCGGRGM 191

Query: 190 KERLKRFGPGLVASQ-WVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVA 248
             ++ R   G +  Q    C+KC G+G+ +      KN C  C G  +  K +   V+V 
Sbjct: 192 VVQVIR--QGFITQQIQQMCQKCEGRGEVI------KNKCKTCHGSKVVKKNKSFHVDVP 243

Query: 249 PGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQ-ENLEQKQIFLKNFDEGSAEDLYTS 307
            G   + V  I+G A++  D    GD+   +VE   +N+  ++            DL+ +
Sbjct: 244 AGAPRDFVAVIRGEAEKSPDTEP-GDIYVKVVESPVQNMGYRR---------RGPDLFRT 293

Query: 308 ATISLSEALT-GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRG 366
             +SL+EAL  G+ +             S   G  ++ G+V  I   G P+    +   G
Sbjct: 294 EVLSLTEALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLESGTK--YG 351

Query: 367 DLYVFIHIEFP 377
           DLYV   I  P
Sbjct: 352 DLYVDYVIVMP 362

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/249 (28%), Positives = 108/249 (43%), Gaps = 29/249 (11%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LY GK  K  L R  +C+ C+G G              CESC G G + + +R GP
Sbjct: 161 TLRELYNGKMAKLALNRTRLCLPCNGFGG--------LQRTTCESCQGDGFQTQTRRMGP 212

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            +V +   TC  C G G ++K    P + CP C G G   +++I  V V PG      + 
Sbjct: 213 -MVQTWTQTCASCDGAGCFIK----PNDVCPHCHGEGFIRERKIFHVEVKPGFQDGKDVI 267

Query: 259 IKGMADEEL------DKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISL 312
           ++G ADE +      +K   GD+   +  KQ   E     + N    + + L     + L
Sbjct: 268 MQGEADEIMLNNLVKEKVIPGDVVITI--KQSRDENNCFQMIN----NKDLLMNGCPVDL 321

Query: 313 SEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIM----DDPRGQRGDL 368
             +L G E               I PG +++P     I   G P +    DD   +RGDL
Sbjct: 322 VTSLCGGEVYIDNHPSGKLIKLDIIPGEILKPNCFKIIEGLGMPYLEDGKDDTMLRRGDL 381

Query: 369 YVFIHIEFP 377
           Y+   I++P
Sbjct: 382 YIQFKIQYP 390

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (63%), Gaps = 3/72 (4%)

Query: 6  RRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILS 65
          R  +LY+ L V   A+  +IK AY+KLALK+HPDK    N  E ++ KF+ +  AYEIL+
Sbjct: 3  RDTKLYETLNVPITATTLDIKKAYKKLALKYHPDK---NNHSEDSKTKFQAVCQAYEILN 59

Query: 66 DPEKKSHYDLYG 77
          D + ++ YD  G
Sbjct: 60 DKQSRAIYDALG 71

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 77/258 (29%), Positives = 113/258 (43%), Gaps = 25/258 (9%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T+K+LYMGK  K  L R  +C VC G G  L+K         C+ C G+G + + KR GP
Sbjct: 193 TLKELYMGKTAKLGLNRTRICHVCDGHGG-LRK-------YTCKPCKGQGIQTQTKRMGP 244

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            LV S   TC  C G G +VK     K+ C  C G+G   +++I+ V V PG   N +I 
Sbjct: 245 -LVQSWSQTCADCGGAGTFVKN----KDICEQCQGLGFIKQRKILQVTVQPGSCHNQLIV 299

Query: 259 IKGMADEELDKSACGDLKF---HLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSEA 315
           + G  DE +     G  K     +V     L+  +  + +    + + +     + L  +
Sbjct: 300 LTGEGDEVISTKGGGREKVIPGDVVITILRLKDPKFQITD----NCDLICKKCEVDLMTS 355

Query: 316 LTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWP-IMDDPRGQRGDLYVFIHI 374
           L G                 I PG V++PG    + N G P  ++  R   G LYV   +
Sbjct: 356 LCGGIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHLYVKFDV 415

Query: 375 EFP----PDNWFNEKSEL 388
            +P    P+N    KS L
Sbjct: 416 TYPERLEPENAAKVKSIL 433

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 10 LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
          LYD L VT+ AS  EIK AYR  ALK+HPDK    N  E ++ KF+EI  AYE+L D   
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEVLKDNHL 63

Query: 70 KSHYDLYG 77
          +S YD YG
Sbjct: 64 RSLYDQYG 71

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 111/247 (44%), Gaps = 29/247 (11%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T+K+LYMGK  K  L R  +C VC G G  LKK         C++C G+G + +  R GP
Sbjct: 190 TLKELYMGKTAKLGLNRTRICQVCDGHGG-LKK-------YACKTCKGQGVQTQTNRMGP 241

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            LV S   TC  C G G +V+     K+ C  C G+G   +++I+ V V PG   N +I 
Sbjct: 242 -LVQSWSQTCADCGGAGIFVES----KDICQQCQGLGFVKQRKILQVAVQPGSCHNQLIV 296

Query: 259 IKGMADEEL-------DKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATIS 311
           + G  DE +       +K   GD+   ++  ++   Q    + +++      +Y    + 
Sbjct: 297 LTGEGDEVISSKGGGHEKIIPGDVVITILRLKDPRFQ---IVDDYNL-----IYKKCKVD 348

Query: 312 LSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWP-IMDDPRGQRGDLYV 370
           L  +L G                 I PG V++PG    + N G P  ++  R   G +YV
Sbjct: 349 LMTSLCGGVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHMYV 408

Query: 371 FIHIEFP 377
              + +P
Sbjct: 409 KFEVTYP 415

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 43/68 (63%), Gaps = 3/68 (4%)

Query: 10 LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
          LYD L VT+ AS  EIK AYR  ALK+HPDK    N  E ++ KF+EI  AYE L D   
Sbjct: 7  LYDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYETLKDNHL 63

Query: 70 KSHYDLYG 77
          +S YD YG
Sbjct: 64 RSLYDQYG 71

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score = 94.0 bits (232), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 107/241 (44%), Gaps = 17/241 (7%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T+K+LYMGK  K  L R  +C VC G G  LKK         C++C G+G + + +R GP
Sbjct: 186 TLKELYMGKTAKLGLNRTRICSVCDGHGG-LKK-------CTCKTCKGQGIQTQTRRMGP 237

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            LV S   TC  C G G +VK     K+ C  C G+G   +++I+ V V PG   N +I 
Sbjct: 238 -LVQSWSQTCADCGGAGVFVKN----KDICQQCQGLGFIKERKILQVTVQPGSCHNQLIV 292

Query: 259 IKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYT-SATISLSEALT 317
           + G  DE +     G  K  ++     +   ++   NF   +  +L      I    +L 
Sbjct: 293 LTGEGDEVISTKGGGHEK--VIPGDVVITILRLKDPNFQVINYSNLICKKCKIDFMTSLC 350

Query: 318 GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWP-IMDDPRGQRGDLYVFIHIEF 376
           G                 I PG +++PG    + + G P  ++  R   G LYV   + +
Sbjct: 351 GGVVYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSGFGHLYVKFDVTY 410

Query: 377 P 377
           P
Sbjct: 411 P 411

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 10 LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
          LYD L VT+ AS  EIK AYR  ALK+HPDK    N  E ++ KF+EI  AYEIL D   
Sbjct: 7  LYDSLNVTAAASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEILKDNRL 63

Query: 70 KSHYDLYG 77
          ++ YD YG
Sbjct: 64 RALYDQYG 71

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 96/367 (26%), Positives = 155/367 (42%), Gaps = 52/367 (14%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y +LG++ DAS +EIK+AYR+L+ K+HPDK       E    KF E+  AY+IL DPEK+
Sbjct: 22  YAILGLSKDASDKEIKSAYRQLSKKYHPDK---NPGDEEAHHKFIEVGEAYDILGDPEKR 78

Query: 71  SHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGND-----FPREYDTYEEXX 125
             YD++G D                             H+  D     F R+   + +  
Sbjct: 79  KTYDVHGAD---------------AFKNGGQGQRGGGFHDPFDMFEQMFGRQGGGFRQTQ 123

Query: 126 XXXXXXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCG 185
                       +++K+ Y G +++FE+    +C  CHGSG     K+ V     C +C 
Sbjct: 124 RSQNYQVRNQ--VSLKEFYSGGEVEFEIPLNDICDSCHGSG-SADGKVKV-----CPACQ 175

Query: 186 GKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITV 245
           G+G   ++ R GP       +T +     G+   + K  +N C  C G  +  K +    
Sbjct: 176 GRGVVVQVIRMGP-------ITQQIQQQCGQCGGKGKTIENPCKTCKGHKVVRKNKPFHF 228

Query: 246 NVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVE-KQENLEQKQIFLKNFDEGSAEDL 304
               G   N +    G +D+  D  + GD+     E ++ENL  ++            +L
Sbjct: 229 EFPGGIPRNHIDKKSGESDKSPDMES-GDIIIEYNESEKENLGYRR---------RGNNL 278

Query: 305 YTSATISLSEALT-GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRG 363
           Y +  I+ +EA+  G+ +             S   G ++  GD+ +I   G PIM     
Sbjct: 279 YRTEIITANEAINGGWTREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMGSK-- 336

Query: 364 QRGDLYV 370
             GDLY+
Sbjct: 337 NFGDLYI 343

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score = 90.9 bits (224), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 114/260 (43%), Gaps = 31/260 (11%)

Query: 142 DLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGPGLV 201
           DL+ GK+ K  L R  +C  C G G K           +C  C G G     KR GP +V
Sbjct: 175 DLFHGKRAKLALNRTRLCQRCQGYGGK--------KATQCRGCQGTGLFTTTKRMGP-MV 225

Query: 202 ASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKG 261
            +   TC++C G GKY++     K+ C +C+G G   +++   V V PG    + I + G
Sbjct: 226 QTWQTTCKECSGTGKYIR----SKDACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPG 281

Query: 262 MADEELD------KSACGD--LKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLS 313
            ADE ++      +   GD  +   L   +E+  + +  + + D      +  +  + L 
Sbjct: 282 EADEVINTEYGKERVIPGDVIITIQLTRNEESNMRYKYLVHDHDL-----ILDNFEVDLK 336

Query: 314 EALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIH 373
            +L G                 +  G +++PG +  + N+G P+  D  G  G+LY+   
Sbjct: 337 TSLCGGTIIIEDHPSGNPFKIEVLSGELLKPGCIKCVENKGMPV--DSNGNFGNLYIRFR 394

Query: 374 IEFP---PDNWFNEKSELLA 390
           ++FP     +  N+ SE+L 
Sbjct: 395 VKFPEQLKSDTINKLSEILV 414

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 47/70 (67%), Gaps = 5/70 (7%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIK-FKEITAAYEILSDP 67
          +LYD+L V + A+ QEIK AYRK ALKHHPDK    N+     IK F++I+ AYE LS+ 
Sbjct: 6  KLYDILEVNTTATEQEIKKAYRKKALKHHPDK----NNHSAESIKLFQDISHAYETLSNS 61

Query: 68 EKKSHYDLYG 77
           K+  YD YG
Sbjct: 62 NKRELYDQYG 71

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 103/246 (41%), Gaps = 28/246 (11%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T+++LYMGK  K  L R  +C VC G G   K          C++C G+G + + K  GP
Sbjct: 197 TLRELYMGKTAKLGLNRTRICHVCEGHGGLQK--------YTCKTCKGQGVQTQTKCMGP 248

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            LV S   TC  C G G +V+     K+ C  C G+G   +++I+ V V PG   N +I 
Sbjct: 249 -LVQSWSQTCADCGGAGIFVES----KDICQQCQGLGFIKQRKILQVTVQPGTSHNQLIV 303

Query: 259 IKGMADEELDKSAC------GDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISL 312
           + G  DE + K         GD+   +      L  K    +  D  S   +Y    + L
Sbjct: 304 LTGEGDEVISKGGGHEKVIPGDVVITI------LRLKDPKFQVTDNCSL--IYKKCKVDL 355

Query: 313 SEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWP-IMDDPRGQRGDLYVF 371
             +L G                 I PG V++P     I   G P  ++  R   G LYV 
Sbjct: 356 MTSLCGGIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRSGFGHLYVK 415

Query: 372 IHIEFP 377
             + +P
Sbjct: 416 FDVSYP 421

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 44/68 (64%), Gaps = 3/68 (4%)

Query: 10 LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
          LYD L VT+ AS  EIK AYR  AL++HPDK    N  E ++ KF+EI  AYE+L D   
Sbjct: 7  LYDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKRKFQEICQAYEVLKDNHL 63

Query: 70 KSHYDLYG 77
          +S YD YG
Sbjct: 64 RSLYDQYG 71

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/303 (26%), Positives = 136/303 (44%), Gaps = 29/303 (9%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T+ +LY GK  K  L R+ +C  C G G  L+++        C++C G+G +   +R GP
Sbjct: 172 TLAELYDGKITKLGLNRRRMCQSCQGQG-SLRRRT-------CKTCRGQGQQTETRRTGP 223

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            +V +   TC  C+G G Y K+     + C +C G     +++I  V V+ G      I 
Sbjct: 224 -MVQTWTQTCPDCNGLGTYTKQA----DVCHECRGESYIKERKIFDVEVSKGMCHGQTIV 278

Query: 259 IKGMADEELDKSACGDLKFHLVEKQENLEQ-KQIFLKNFDEGSAEDLYTSATISLSEALT 317
           + G AD EL K++ G  K    +    ++Q K       +    + +  S +I LS +L 
Sbjct: 279 LPGEAD-ELIKTSFGVEKVIPGDVVITIDQVKDSKFHRVNRYGCDLVMGSCSIDLSTSLC 337

Query: 318 GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
           G +              SI PG +I P  +  I   G P      G +G+LY+   +E+P
Sbjct: 338 GGDIYIDGHPSGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHD-GGKGNLYIQFQLEYP 396

Query: 378 ----PDNWFNEKSELLA---IKTMLPSSSSCTFQTTANTGEDDRNPINNETISNFQIINM 430
               PD     +S LL    ++  + S ++  +Q   +  E     ++   +S+F + +M
Sbjct: 397 VGLEPDTIGRLQSVLLQDKYVQNQIQSQNAKVYQKLGDCAE-----VDEHVLSSF-VPSM 450

Query: 431 EEL 433
           EE+
Sbjct: 451 EEI 453

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (67%), Gaps = 5/77 (6%)

Query: 6  RRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILS 65
          R  +LYD L V+ DA++ EIK AY+ +ALK+HPDK    +  E  + KF+E+  AYEIL+
Sbjct: 3  RDTRLYDTLKVSPDATISEIKRAYKVMALKYHPDK---NHHSEDAKNKFQEVCKAYEILA 59

Query: 66 DPEKKSHYDLYG--DDY 80
          D +K+  YD YG  D+Y
Sbjct: 60 DEDKRVMYDRYGTVDEY 76

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 95/369 (25%), Positives = 144/369 (39%), Gaps = 36/369 (9%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y +LGV  DAS ++IK+AYR+++ K HPDK  +    E +  KF EI  AYE+LSD EK+
Sbjct: 21  YAILGVAKDASEKDIKSAYRQMSKKWHPDK--NAGDDEAHH-KFIEIGEAYEVLSDSEKR 77

Query: 71  SHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHE-GNDFPREYDTYEEXXXXXX 129
           + YD +G D                                G+  P   +  +       
Sbjct: 78  ATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQMFGDSHPGGQNVRKGSNLIVK 137

Query: 130 XXXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGS 189
                  F      Y G      L     C  CHGSG              CE+C G+G 
Sbjct: 138 DSVTLNGF------YHGFYANLTLDLNDDCEHCHGSG------AEDNQFATCETCQGRGV 185

Query: 190 KERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAP 249
             ++ + G      Q V C  C GKGK +      K+ C  C G  +    +   ++V  
Sbjct: 186 IIQVIQMGFMTQQIQQV-CGACQGKGKTI------KHVCKICRGARVVKTPKTFEISVPA 238

Query: 250 GHHFNDVITIKGMADEELDKSACGDLKFHLVE-KQENLEQKQIFLKNFDEGSAEDLYTSA 308
           G   N  +   G A++  D  + GDL F   E   ENL  ++           + LY + 
Sbjct: 239 GAQRNYNVVKSGQAEKVPDMQS-GDLVFVFEENSHENLGYRR---------RGDHLYRTE 288

Query: 309 TISLSEALT-GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGD 367
            +   EAL  G+E+                   V  PG++ ++ N G P + + +G+  +
Sbjct: 289 VLHWKEALLGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKL-NSKGKSTN 347

Query: 368 LYVFIHIEF 376
            Y  + IE+
Sbjct: 348 AYGDLFIEY 356

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 124/299 (41%), Gaps = 34/299 (11%)

Query: 140 VKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGPG 199
           +K+LY GK  K  L R  +C  C G G        +T  V C  C G+G   + +R GP 
Sbjct: 163 LKELYSGKVAKLGLTRTRLCHRCSGHG-------SMTSSV-CGECRGQGVYSQTRRHGP- 213

Query: 200 LVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITI 259
           LV +   +C  C G G +VK      + C  C G G   +++I  V + PG      I +
Sbjct: 214 LVQTWSSSCRNCSGAGTFVK----SNDVCQTCRGTGYIRERKIFEVEIKPGLSNKSEIIL 269

Query: 260 KGMADEELD------KSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLS 313
            G AD+ +       +   GD+   +V++Q +  + + F +      ++ + T   + L 
Sbjct: 270 PGEADQVISTVYGKQQVIPGDVII-IVQEQCSTGRYRRFRE------SDLVLTRCVVDLR 322

Query: 314 EALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIH 373
            +L G                 + PG ++ PG +  + N G P  D+P  Q GDLY+   
Sbjct: 323 TSLCGGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRDNP-SQYGDLYIKFC 381

Query: 374 IEFPPDNWFNEKSELLAIKTMLPSSSSCTFQ--TTANTGEDDRNP--INNETISNFQII 428
           + FP      E   +  I + L S S+   Q   T  +    RNP        SNF  I
Sbjct: 382 VNFPER---LEPETMNVISSALASDSNIIRQENITEPSSAQTRNPDCYEEHVFSNFNEI 437

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+L V+   S QE+K +Y+  AL++HPDK       E  +  F++IT AY ILSD  
Sbjct: 6  RFYDLLNVSPTVSPQELKKSYKLAALRYHPDK---NGHSESAKQAFQQITEAYGILSDER 62

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 63 KRKIYDRYG 71

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 104/236 (44%), Gaps = 27/236 (11%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T+ +LY GK+ K  L+R   C+ C G G    K         C  C G+GS  + K+FGP
Sbjct: 240 TLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIK--------SCSKCNGRGSLTQTKKFGP 291

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            +  +   TC+ C G G +     + ++ C +C G G  ++K+I  V + PG     +I 
Sbjct: 292 -MTQTFTQTCDGCGGNGTFA----DAQDICNECQGEGFLNEKKIFEVEITPGMTDGQLII 346

Query: 259 IKGMADEEL------DKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISL 312
           + G ADE +      ++   GD+   +     NL     F     +G A+ LY +  I+L
Sbjct: 347 LTGEADEVISTNLGKERVIPGDIILTI-----NLLPDPTF--KVVQG-ADLLYANYKINL 398

Query: 313 SEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDL 368
             +L G                +I PG +I+ G +  + N G P +D   G   D+
Sbjct: 399 LTSLCGGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSVGHSNDI 454

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          QLYD+L V  D+    IK AYR LALK+HPDK    N  E ++  F++I+ AY +LS+ +
Sbjct: 6  QLYDILQVRYDSDESVIKKAYRTLALKYHPDK---NNLSEESKQMFQKISEAYVVLSNKD 62

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 63 KRQMYDKYG 71

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 100/406 (24%), Positives = 156/406 (38%), Gaps = 82/406 (20%)

Query: 9   QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
           +LYD+LGV++ AS Q+IK AYR  ALKHHPDK       E +++KF++I  AYEIL D  
Sbjct: 8   ELYDILGVSASASRQDIKKAYRVNALKHHPDK---NGHSEESKLKFQQICKAYEILKDER 64

Query: 69  KKSHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXX 128
           K+  YD +G                                + + +  E  +Y+E     
Sbjct: 65  KREMYDRFG------------------------------TADESQWHTESTSYQEQSGMS 94

Query: 129 XXXXXXXXF--LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVEC---ES 183
                   F   +    +    + F  KRQ        S  +L +   + H ++C   E 
Sbjct: 95  AGDLFAQFFGGGSTTGSFFNDDMSFFGKRQGAHTA--PSRRELPRGPDIKHYLKCTLEEV 152

Query: 184 CGGKGSKERLKRFG--------PGLVASQWVTC--------EKCHG-------------- 213
             GK +K  LKR           GL ASQ  TC         K HG              
Sbjct: 153 YHGKRAKLALKRTRLCKKCKGEGGLKASQCYTCGGRGIRTETKRHGPMVQTWSSTCSDCA 212

Query: 214 -KGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSAC 272
            +G ++K+    K+ C DC G G   ++ I  + V  G      + + G ADE +     
Sbjct: 213 GRGSFMKQ----KDICRDCNGQGCIRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELG 268

Query: 273 GDLKFHLVEKQENLEQKQIFLKNF-DEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXX 331
            +   H++     +  +Q+  K F     A  +     + L  +L G             
Sbjct: 269 SE---HVIPGDVIIILEQLPHKAFWRHRDASLVLDHCKVDLKTSLCGGPVWVDSHPSGKL 325

Query: 332 XXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
               + PG +++PG +  +   G P      G+ G+LY+   + FP
Sbjct: 326 LKIDVLPGEILKPGAIKCVEGMGMP---KSGGRFGNLYIRFDVAFP 368

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 101/251 (40%), Gaps = 31/251 (12%)

Query: 140 VKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGPG 199
           + DLY GKK K  L R  VC  C G G              C +C G+G   + +R GP 
Sbjct: 159 LSDLYQGKKTKLGLNRMRVCSSCDGKGG--------MRVASCRTCKGQGEVVKTRRVGP- 209

Query: 200 LVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITI 259
           +V +   TC  CHG G ++K      + C  C G G+  +++I  V V  G   N VI +
Sbjct: 210 MVQTMSSTCNSCHGTGTFIK----DSDLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVL 265

Query: 260 KGMADEELDKSACGDLKFH---LVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSEAL 316
            G ADE ++ S  G +K     +V   + ++  Q  + N      + +  +  + L   L
Sbjct: 266 PGEADEVIETSH-GLIKVQPGDVVIVIDLVKNTQFQVVN----DHDLVLKNCEVPLKTCL 320

Query: 317 TGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWP----------IMDDPRGQRG 366
            G E              SI P  +++P     +   G P          I        G
Sbjct: 321 CGGEIMIEGHPSGKIIKLSIIPNELLKPSCFKTVEGLGMPKVIANSDHANIAGTDIDGYG 380

Query: 367 DLYVFIHIEFP 377
           +LYV   ++FP
Sbjct: 381 NLYVQFQVKFP 391

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+L V  DAS   IK A+   AL+ HPDK    N  E ++ +F+EI+ AYE+LSDP+
Sbjct: 6  RLYDLLNVECDASQVTIKKAFHAAALRCHPDK---NNHSEESKKQFQEISKAYEVLSDPK 62

Query: 69 KKSHYDLYG 77
           +  YD YG
Sbjct: 63 SREMYDRYG 71

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 109/265 (41%), Gaps = 42/265 (15%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T+K+LY GKK K  L R   C  C+G G          + + C  C GKG     K  GP
Sbjct: 180 TLKELYQGKKCKLGLNRTRSCHSCNGMGG--------MNTIICNECQGKGINTETKMLGP 231

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            +V S   TC  C G G ++    + ++ C +C G G   ++ I TV V PG   N  I 
Sbjct: 232 -MVQSWSSTCFNCSGMGYFI----DSQSGCKECQGEGYLRERTIFTVTVKPGMRNNQKIV 286

Query: 259 IKGMADEEL-------DKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAED-------- 303
           +KG AD+ +       +K   GD+   ++ + E    K     N D+G  ++        
Sbjct: 287 LKGEADQVMLVGKLNKEKVIPGDV-IIVINQIEGKSWKND--SNIDQGENKNKFHFEIIN 343

Query: 304 ----LYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWP--I 357
               L  +  I L  +L G E               I P  +++P  +  + N G P  I
Sbjct: 344 EKDLLLRNCQIDLITSLCGGEIYIKNHPSGKLIKLDIIPSEILKPDCLKCVENLGMPRYI 403

Query: 358 MDDPRG-----QRGDLYVFIHIEFP 377
            D+          GDLY+   +++P
Sbjct: 404 EDETNNGEEYLPNGDLYIQFKVKYP 428

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LY +L V + A++ EIK AY+KLALK+HPDK    N  E +++KF+EI  AYE+L D +
Sbjct: 13 RLYSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESKLKFQEICKAYEVLHDKD 69

Query: 69 KKSHYDLYG 77
          KK  YD YG
Sbjct: 70 KKLLYDTYG 78

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 101/248 (40%), Gaps = 37/248 (14%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T++DLY GK +K  L+R   C  C      +           C SC G G+  R++R GP
Sbjct: 122 TLQDLYRGKVIKLALRRTAPCERCSLGAANV-----------CSSCNGSGNITRIERVGP 170

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            L  +   TC  C G+G+           C  C G    +++ +  V+V PG H    I 
Sbjct: 171 -LTQTWSSTCNACQGQGRMSVD-------CSQCGGAQYLNERVVFKVHVKPGMHDGQTIV 222

Query: 259 IKGMADE-------ELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSAT-I 310
           + G AD+        L  +  GD+   + E  +   ++    K       E+L+     +
Sbjct: 223 LDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKR------ENLFVDQVKV 276

Query: 311 SLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIK-ITNEGWPIMDDPRGQRGDLY 369
            L+ ALTG                +I PG  + P + IK +   G PI  D  GQRGDLY
Sbjct: 277 DLTTALTGGNVLLEDHPSGNLMKINILPGEFL-PENCIKCVEGLGMPI--DDTGQRGDLY 333

Query: 370 VFIHIEFP 377
           +      P
Sbjct: 334 IRFCTHSP 341

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 10 LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
          LYDVLGV SDAS  EIK AYRKLAL++HPDK    N  E     F++I+ AY +L D  +
Sbjct: 4  LYDVLGVASDASQSEIKKAYRKLALRYHPDK---NNGDEKCHEAFQKISHAYGVLGDVAQ 60

Query: 70 KSHYDLYGDD 79
          +  YD  GD+
Sbjct: 61 RQRYDQSGDE 70

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 112/259 (43%), Gaps = 32/259 (12%)

Query: 139 TVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGP 198
           T+KDLY GK+ K  L+R  +C +C G G  +K+ +       C  C G G+     R GP
Sbjct: 167 TIKDLYRGKRSKLRLERSKLCSICKGDGG-VKRSM-------CNQCHGDGNITETTRLGP 218

Query: 199 GLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVIT 258
            ++ +   TC  C+G G  +   +     C  C GVG  ++ +I  V + PG      I 
Sbjct: 219 -MLQTFTHTCNICNGNGWVIISQET----CQGCNGVGFYNEMKIFDVEIYPGMKDGTQIV 273

Query: 259 IKGMADEELDKSAC--GDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYT-SATISLSEA 315
                DE ++K     G++  H+ E ++N        K  ++G  +DLY  +  I L  +
Sbjct: 274 FNNEGDEIVNKRRVIPGNVIIHINEIEDNK------FKRVNDG--QDLYYWNYEIDLFTS 325

Query: 316 LTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHIE 375
           L G                 I PG +I  G V  + + G P   +   + G LY+   ++
Sbjct: 326 LCGGVIYIKGHPNNKLIKVDILPGEIIESGSVKGVESLGMP--KNKGNEYGILYIQFQVK 383

Query: 376 FPPDNWFNEKSELLAIKTM 394
           +P      EK  + +IK +
Sbjct: 384 YP------EKLNMESIKAI 396

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LY+ L +   AS  +IK AYR  AL++HPDK    N  E ++ KF++I+ AY IL D  
Sbjct: 6  RLYNALNIPPTASQSDIKKAYRVQALRYHPDK---NNESEESKKKFQDISEAYSILRDEN 62

Query: 69 KKSHYDLYG 77
          ++  YD YG
Sbjct: 63 QRKMYDKYG 71

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 89/385 (23%), Positives = 157/385 (40%), Gaps = 64/385 (16%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y +L +  DA+ ++I++AYR+L+ K+HPDK  + N ++ +  KF E+  AYEILSDPEK+
Sbjct: 24  YKILELDKDATDKDIRSAYRQLSKKYHPDK--NPNDEDAHH-KFIEVGQAYEILSDPEKR 80

Query: 71  SHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXXXX 130
             YD +G +                                  F   +D +E+       
Sbjct: 81  QRYDQFGPEGVNGQNGGGPGGAG--------------------FHDPFDIFEQMFGGGGG 120

Query: 131 XXXXXXFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSK 190
                     +    G+ +   + R+   +  + +G+ LK  I++     C+ C G GS 
Sbjct: 121 MGGHGGNPFQQQRQRGQNV---VARESTSLKNYYNGYVLKFSINLND--ICDHCHGSGSN 175

Query: 191 E----------------RLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGV 234
           +                ++ R G      Q V C KC GKG+ +K P      C  C G 
Sbjct: 176 DGKSTKCPDCQGRGVTVQVIRMGMMTQQIQQV-CGKCGGKGQIIKNP------CKTCHGS 228

Query: 235 GLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEK-QENLEQKQIFL 293
            +  K +   + +  G     V    G AD+  D  + GD+     E  ++N+  ++   
Sbjct: 229 KVVQKPKDFEIELPAGAPRKFVHAEHGAADKHPDYDS-GDVYIEFTENDKDNMGYRR--- 284

Query: 294 KNFDEGSAEDLYTSATISLSEAL-TGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITN 352
                     LY +  ++ +EAL  G+E+               +P ++I+ G+  +I  
Sbjct: 285 ------RGPHLYRTEVLNATEALYGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAG 338

Query: 353 EGWPIMDDPRGQRGDLYVFIHIEFP 377
            G P+ +  +G  GDL++   +  P
Sbjct: 339 FGMPLGNGRKG-FGDLFIDYVVVMP 362

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa]
          {ON} highly similar to uniprot|P25294 Saccharomyces
          cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 47/69 (68%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LG++  A+ QEIK  YRK ALK+HPDK            KFKEI+ A+EILSDP+
Sbjct: 6  KLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREVYDQYG 68

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 58/153 (37%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE 284
           K F     G     +K  + + + PG      IT K   D          L+F + EK+ 
Sbjct: 196 KTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKH 255

Query: 285 NLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRP 344
                  F ++       DL  +  ++  E+L GF K              I+P   I+P
Sbjct: 256 PF-----FTRD-----GNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPVSRIQP---IQP 302

Query: 345 GDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
            +      +G PI   P GQRGD+ V   +++P
Sbjct: 303 SEKSTYPGQGMPIPKTP-GQRGDMIVNYKVDYP 334

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa]
          {ON} Anc_1.398 YNL007C
          Length = 353

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 47/71 (66%), Gaps = 6/71 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+S AS  EIK  YRK ALK+HPDK            KFKEI+ A+EILSD  
Sbjct: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSN 59

Query: 69 KKSHYDLYGDD 79
          K+S YD YG D
Sbjct: 60 KRSVYDQYGLD 70

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 62/153 (40%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE 284
           K+F     G+  + +K  I +N+ PG      +T K   D          L+F + EK+ 
Sbjct: 200 KSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKH 259

Query: 285 NLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRP 344
            L ++            +++  +  ++  E+L GF K               +P   ++P
Sbjct: 260 PLYKRD----------GDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPLSRSQP---VQP 306

Query: 345 GDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
            +      +G PI  +P GQRG+L +   I +P
Sbjct: 307 TEENTYPGQGMPISKNP-GQRGNLIIKYKINYP 338

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
          Anc_1.398
          Length = 363

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGVT  A+ QEIK  YRK ALK+HPDK            KFK+I+ AYEILSD  
Sbjct: 6  KLYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTE------KFKQISEAYEILSDSN 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREIYDQYG 68

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 60/153 (39%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE 284
           K+F     G G   +K  I + + PG      +T K   D          L+F + EK  
Sbjct: 208 KSFKIGRKGPGGVQEKTQIDIQLKPGWKAGTKLTYKNKGDYNPRTHGRKTLQFIIDEKPH 267

Query: 285 NLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRP 344
              Q++           ++L  +  ++  E+L GF K               +P   I+P
Sbjct: 268 PTFQRE----------DDNLVCTVPLTFKESLLGFSKTVQTIDGRNLPISRSQP---IQP 314

Query: 345 GDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
            ++ +   +G PI   P GQRGDL V   I +P
Sbjct: 315 TEITRYPGQGMPISKKP-GQRGDLIVKYKIAYP 346

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
          SIS1Type II HSP40 co-chaperone that interacts with the
          HSP70 protein Ssa1p; not functionally redundant with
          Ydj1p due to due to substrate specificity; shares
          similarity with bacterial DnaJ proteins
          Length = 352

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREIYDQYG 68

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  AS  E+K  YRK ALK+HPDK            KFKEI+ A+EILSDP 
Sbjct: 6  KLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDPN 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREVYDTYG 68

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa]
          {ON} YNL007C (REAL)
          Length = 359

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 47/69 (68%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREIYDQYG 68

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 107/240 (44%), Gaps = 36/240 (15%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSG---WKLKKKIHVTHEVECESCGGKGSKERLK 194
           LT+KD Y G  + F L     C  CHGSG    K+KK         C  CGG+G   ++ 
Sbjct: 158 LTLKDYYNGGSISFSLLLNDNCDHCHGSGSEDGKVKK---------CPDCGGRGVVIQVI 208

Query: 195 RFGPGLVASQWVT--CEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHH 252
           R G   + +Q V   C +C G G+ +      +N C  C+G  +Q K++ I+V+   G  
Sbjct: 209 RMG---IVTQQVQQRCNRCAGSGEII------QNKCKVCSGAKVQKKEKDISVSFDSGIE 259

Query: 253 FNDVITIKGMADEELDKSACGDLKFHLVEKQE-NLEQKQIFLKNFDEGSAEDLYTSATIS 311
            N +   +G A E+      GDL     E  E N+  ++           +DL+ +  ++
Sbjct: 260 RNHISVQQGEA-EKGPGIEPGDLIVEFFEVPEANMGYRR---------RGKDLFRTEVLT 309

Query: 312 LSEALTG-FEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYV 370
           L EA+ G + +                P  ++  G+V KI   G PI+   +G+ GDLY+
Sbjct: 310 LQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGS-KGKFGDLYI 368

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG++ + + +EIK+AYR+L+ K HPDK  + N ++ +  KF EI  AYE+LSDPEK+
Sbjct: 25 YKILGLSKNCNEKEIKSAYRQLSKKFHPDK--NPNDEDAHN-KFIEIGEAYEVLSDPEKR 81

Query: 71 SHYDLYGDD 79
            YD +G D
Sbjct: 82 RMYDQFGAD 90

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 107/243 (44%), Gaps = 27/243 (11%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFG 197
           +++ D Y G++ K+ L+    C  CHG+G K  K   VT    C  C G+G   ++ + G
Sbjct: 148 VSLMDFYNGREFKYNLQLNDFCEKCHGTGSKDGK---VT---RCPDCQGRGVIVQVIQMG 201

Query: 198 PGLVASQWV--TCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFND 255
              + +Q +   C++C G G+ +K P      CP C G  +    +  TV +  G   N 
Sbjct: 202 ---IMTQQIQHVCDRCSGSGEIIKNP------CPHCHGHKVAKMDKEFTVKLPNGAQRNY 252

Query: 256 VITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSEA 315
           V    G A++  D  A GDL F   E +EN      + +  D      LY +  +S+ EA
Sbjct: 253 VDIKHGEAEKGADFDA-GDLMF---EFRENSMNNMGYRRRGDH-----LYRTEVLSVQEA 303

Query: 316 LT-GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHI 374
           L  G+E+                  +V+  G++  +   G PI++    + GDL++   I
Sbjct: 304 LKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLFIDYVI 363

Query: 375 EFP 377
             P
Sbjct: 364 LMP 366

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV  DA+ +EIK+AYR+L+ K+HPDK       E    KF E+  AY++LSD EK+
Sbjct: 24 YKILGVNKDANDKEIKSAYRQLSKKYHPDK---NPGDEEAHNKFIEVGEAYDVLSDSEKR 80

Query: 71 SHYDLYGDD 79
          + YD YG D
Sbjct: 81 NIYDQYGAD 89

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 46/69 (66%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QEIK  YRK AL++HPDK         N  KFK+I+ AYEILSD  
Sbjct: 6  KLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTG------NTEKFKQISEAYEILSDSN 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREVYDQYG 68

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON}
          Anc_1.398 YNL007C
          Length = 355

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 46/69 (66%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QEIK  YRK ALK+HPDK         N  KFKEI+ A+EILSD  
Sbjct: 6  KLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTG------NTEKFKEISEAFEILSDSN 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREVYDQYG 68

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 310 ISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLY 369
           ++  E+L GF+K              ++P   ++P D      +G P+   P GQRGD+ 
Sbjct: 277 LTFKESLLGFQKTIQTIDGRTLPISRVQP---VQPNDSSTYPGQGMPMTKKP-GQRGDMI 332

Query: 370 VFIHIEFP 377
           V   IE+P
Sbjct: 333 VKYKIEYP 340

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
          (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 44/68 (64%), Gaps = 6/68 (8%)

Query: 10 LYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
          LYD+L V+  A+ QEIK  YRK ALK+HPDK            KFKEI+ A+EILSD EK
Sbjct: 7  LYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAEK 60

Query: 70 KSHYDLYG 77
          +  YD YG
Sbjct: 61 REVYDQYG 68

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON}
          Anc_1.398 YNL007C
          Length = 359

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QEIK  YRK ALK+HPDK            KFKEI+ A+EILSD  
Sbjct: 6  KLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDKN 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREVYDQYG 68

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 59/153 (38%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE 284
           K+F     G G   +K  I + + PG      IT K   D          L+F L EK  
Sbjct: 206 KSFKIGRKGQGGIPEKTQIDIQLKPGWKAGTKITYKSQGDYNPQTGGRKTLQFMLQEKNH 265

Query: 285 NLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRP 344
            + +++           +DL  +  ++  E+L GF K               +P   I+P
Sbjct: 266 PVFKRE----------GDDLTCTLPLTFKESLLGFNKQIQTIDGRTLPISRTQP---IQP 312

Query: 345 GDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
            +      +G PI   P  QRG+L V   I++P
Sbjct: 313 SETSVYPGQGMPIPKTP-SQRGNLIVRYKIDYP 344

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 104/243 (42%), Gaps = 29/243 (11%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFG 197
           L++++ + G  + F++  +  C  C GSG +  K        +C+ CGG G   ++ R G
Sbjct: 163 LSLREYFTGANVNFQMDFKDTCDHCKGSGSEDGK------VDKCKECGGNGFVVQVIRMG 216

Query: 198 PGLVASQWVT-CEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDV 256
           P  V  Q  T C KCHG G  +K      N C  C G  L +K + I V V  G   + +
Sbjct: 217 P--VTQQMHTQCPKCHGAGSTIK------NHCKKCHGQKLVTKSKEINVKVPAGAPRDFL 268

Query: 257 ITIKGMADEELDKSACGDLKFHLVE-KQENLEQKQIFLKNFDEGSAEDLYTSATISLSEA 315
             ++   D+EL+  A GDL     E  Q NL  ++            DL+ +  +   +A
Sbjct: 269 KIVENGGDKELNAEA-GDLLVQFQEIAQNNLGYRR---------RGNDLFRTEALVFKDA 318

Query: 316 LT-GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHI 374
           +  G+ +             S KPG  +   ++ K+   G PI    R   GDLY+   I
Sbjct: 319 MEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPIQGSDR--FGDLYIDYVI 376

Query: 375 EFP 377
             P
Sbjct: 377 IVP 379

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+  +AS + IK+AYR+L+ K+HPDK  +QN +E +   F EI  AYE+LSDPEK+
Sbjct: 31 YKILGIPKEASEKAIKSAYRQLSKKYHPDK--NQNDEEAHN-HFIEIGEAYEVLSDPEKR 87

Query: 71 SHYDLYGDD 79
            YD +G D
Sbjct: 88 RTYDQFGSD 96

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
          YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
          82] FULL
          Length = 353

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A   E+K  YRK ALK+HPDK         +  KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSAQETELKKGYRKAALKYHPDK------PSGDAEKFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREVYDTYG 68

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 60/153 (39%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE 284
           K+F     G G  S+K+ + + + PG      IT K   D          L+F L EK  
Sbjct: 200 KSFKITRKGPGGASEKQQVDIQLKPGWKAGTKITYKNEGDYNPRTGRRQTLQFILQEKPH 259

Query: 285 NLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRP 344
           +         N+      DL  S  ++  E+L GF K              ++P   ++P
Sbjct: 260 S---------NYTR-DGNDLIYSLPLTFKESLLGFSKTIQTIDGRTLPISRVQP---VQP 306

Query: 345 GDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
            D      +G PI   P  QRG+L V   I++P
Sbjct: 307 SDSSTYPGQGMPIAKTP-SQRGNLIVKYKIDYP 338

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 93/377 (24%), Positives = 147/377 (38%), Gaps = 53/377 (14%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y +LGV  +A+ ++IK+AYR+L+ K+HPDK     +   N   F E+  AYE LSDPEK+
Sbjct: 23  YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHN---FIEVGEAYEALSDPEKR 79

Query: 71  SHYDLYGDDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXHEGNDFPREYDTYEEXXXXXXX 130
             YD YG +                             H+  D   +             
Sbjct: 80  RIYDQYGAE--------------ALKNGGGAEGGHGGFHDPFDIFEQMFGGGARFGGGQR 125

Query: 131 XXXXXXFLTVKD------LYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE-CES 183
                  L V++       Y G  ++F L     C  C  +G +  K       VE C  
Sbjct: 126 RRQRSQSLQVQEELTLRQYYHGTAVEFTLSLNDHCDHCGATGSQDGK-------VERCTQ 178

Query: 184 CGGKGSKERLKRFGPGLVASQW-VTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEI 242
           C  +G   ++ R   G +  Q+   C +  G       PK     C  C G     K + 
Sbjct: 179 CSVRGVIVQVGR--QGFMTQQFQQVCPRLLGPW-----PKALPKKCKVCQGHKAIKKNKS 231

Query: 243 ITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEK-QENLEQKQIFLKNFDEGSA 301
             V V PG   + V   +G A++  D    GD+   + E  ++N+  ++           
Sbjct: 232 FRVEVPPGAPRDFVAVQQGEAEKVPDMDP-GDIYVKVFENTRDNMGYRR---------QG 281

Query: 302 EDLYTSATISLSEALTG-FEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDD 360
            +L+ +  +SL EAL G +++             S K G+ ++ G+V ++   G P+ D 
Sbjct: 282 ANLFRTEVLSLKEALHGDWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDS 341

Query: 361 PRGQRGDLYVFIHIEFP 377
                GDLYV   +  P
Sbjct: 342 --AGFGDLYVDYVVILP 356

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 357

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  Y+K ALK+HPDK            KFKEI+ AYEILSD  
Sbjct: 6  KLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTE------KFKEISEAYEILSDSS 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREIYDQYG 68

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 55/138 (39%), Gaps = 14/138 (10%)

Query: 240 KEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEG 299
           K  I + + PG      IT K   D          L+F L EK   L ++          
Sbjct: 219 KTQIDIQLKPGWKAGTKITYKNEGDYNPQTGGRKTLQFVLQEKSHPLYKRD--------- 269

Query: 300 SAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMD 359
             ++L  S  +S  E+L GF K              I+P   ++P +V     +G P+  
Sbjct: 270 -GDNLIYSLPLSFKESLLGFSKTIQTIDGRTLPISKIQP---VQPTEVSSYPGQGMPVSK 325

Query: 360 DPRGQRGDLYVFIHIEFP 377
            P GQRGDL V   I++P
Sbjct: 326 RP-GQRGDLVVKYKIDYP 342

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP 
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPN 59

Query: 69 KKSHYDLYG 77
           +  YD YG
Sbjct: 60 TREVYDQYG 68

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 58/153 (37%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE 284
           K+F     G G   +K  I + + PG      +T K   D          L+F + EK  
Sbjct: 174 KSFKIGRKGPGGSQEKTQIDIQLRPGWKAGTKVTYKNQGDYNPRSGGRKTLQFVIQEKAH 233

Query: 285 NLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRP 344
                     +F     +DL     +S  E+L GF K               +P   I+P
Sbjct: 234 ---------PDFKR-DGDDLIYILRLSFKESLLGFSKTINTIDGRKLPLSRSQP---IQP 280

Query: 345 GDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
            ++     +G P+  +P  QRG+L +   I++P
Sbjct: 281 TEISTYPGQGMPVSKNP-SQRGNLIIKYKIDYP 312

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
          to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A   E+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREIYDSYG 68

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 58/153 (37%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE 284
           K+F     G G   +K+ I + + PG      IT K   D          ++F + EK  
Sbjct: 195 KSFKITRKGPGSVPEKKQIDIQMKPGWKAGTKITFKNEGDYNQQTGGRQTMQFVIQEK-- 252

Query: 285 NLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRP 344
                   L    +    +L  +  +S  E+L GF K              ++P   I+P
Sbjct: 253 --------LHPHFKRDGNNLIYTLPLSFKESLLGFSKTIQTIDGRTLPISRVQP---IQP 301

Query: 345 GDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
            +      +G P+   P  QRGDL +   +++P
Sbjct: 302 SETSTYPGQGMPLPKTP-AQRGDLIIKYKVDYP 333

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON}
          Anc_1.398
          Length = 367

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+L V   A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREIYDQYG 68

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 54/138 (39%), Gaps = 14/138 (10%)

Query: 240 KEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEG 299
           K  I + + PG      IT K   D          L+F + EK     +++         
Sbjct: 229 KTQIDIQLKPGWKAGTKITYKSKGDYNPKTGGRKTLQFIISEKPHPHFKRE--------- 279

Query: 300 SAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMD 359
             ++L  +  ++  E+L GF K              +  G+ ++P +      +G PI  
Sbjct: 280 -DDNLIYTLPLTFKESLLGFSKTIQTIDGKNL---PLSRGQPVQPSETTTYPGQGMPITK 335

Query: 360 DPRGQRGDLYVFIHIEFP 377
            P GQRGDL +   +++P
Sbjct: 336 KP-GQRGDLLIKYKVDYP 352

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
          {ON} some similarities with uniprot|P25294
          Saccharomyces cerevisiae YNL007C SIS1 HSP40 family
          chaperone sit4 suppressor dnaJ homolog
          Length = 350

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A   E+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP+
Sbjct: 6  KLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAE------KFKEISEAFEILNDPQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREIYDNYG 68

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa]
          {ON} similar to gnl|GLV|CAGL0H03707g Candida glabrata
          CAGL0H03707g and some similarites with YNL007C
          uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
          HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 44/69 (63%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LG++  A   EIK  YRK ALK+HPDK            KFKEI+ A+EILSD +
Sbjct: 6  KLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDAQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREVYDTYG 68

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 57/153 (37%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE 284
           K+F     G G  S+K  I + + PG      IT KG  D          L+F L EK  
Sbjct: 201 KSFKITRKGAGGVSEKNQIDIQLKPGWKAGTKITFKGEGDYNPRTGGRQTLQFVLQEKPH 260

Query: 285 NLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRP 344
               +Q            DL  +  +S  E+L GF K               +P   I+P
Sbjct: 261 EFFTRQ----------DNDLIYTLPLSFKESLLGFSKQVQTIDGKTIPITRTQP---IQP 307

Query: 345 GDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
                   +G  +  +P  QRGDL +   I++P
Sbjct: 308 TQTSTYPGQGMTLSKNP-SQRGDLIIKFKIDYP 339

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
          {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREIYDQYG 68

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 60/153 (39%), Gaps = 14/153 (9%)

Query: 225 KNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE 284
           K+F     G    S+K  I + +  G      IT K   D          L+F L EK  
Sbjct: 216 KSFKIGRKGPNGTSEKTQIDIQLKQGWKAGTKITYKNEGDYNPRTGGRKTLQFVLQEKAH 275

Query: 285 NLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRP 344
            L ++            ++L  +  +S  E+L GF K              ++P   I+P
Sbjct: 276 PLFKR----------DGDNLIYTLPLSFKESLLGFSKTIQTIDGRTLPISRVQP---IQP 322

Query: 345 GDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377
            +  +   +G PI   P GQRGDL V   I++P
Sbjct: 323 SESSRYPGQGMPITKKP-GQRGDLIVKYKIDYP 354

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 3/71 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YDVLG+  DA+  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP+
Sbjct: 6  EYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPDAQS---KFQAVGEAYQVLSDPQ 62

Query: 69 KKSHYDLYGDD 79
           KS YD +G D
Sbjct: 63 LKSRYDQFGKD 73

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa]
          {ON} YNL007C (REAL)
          Length = 368

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDAQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREIYDQYG 68

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa]
          {ON} YNL007C (REAL)
          Length = 366

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDSQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREIYDQYG 68

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+  DAS  EIK AYRK A+  HPDK+ D    +    KF+ I  AY++LSDPE +
Sbjct: 8  YDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPEAQA---KFQAIGQAYQVLSDPELR 64

Query: 71 SHYDLYG 77
          S YD +G
Sbjct: 65 SRYDEFG 71

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 3/70 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YDVLGV+  AS  EIK AYRK A++ HPDK+ D    +    KF+ +  AY++LSD E +
Sbjct: 8  YDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPDAQA---KFQRVGEAYQVLSDEELR 64

Query: 71 SHYDLYGDDY 80
            YD +G DY
Sbjct: 65 KRYDEFGKDY 74

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa]
          {ON} Anc_1.398 YNL007C
          Length = 363

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 46/69 (66%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+  A+ QE+K  YRK ALK+HPDK            KFKEI+ A+EIL+D +
Sbjct: 6  KLYDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTE------KFKEISEAFEILNDKQ 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREIYDQYG 68

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 99/242 (40%), Gaps = 27/242 (11%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFG 197
           LT+K  Y G  L F L     C  CHGSG +  K  H      C  C G+G   ++ R G
Sbjct: 147 LTLKQYYQGTSLDFTLNLNDFCENCHGSGSQDGKTTH------CSECRGQGVVIQVVRMG 200

Query: 198 PGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVI 257
           P L       C  C GKG+ +      KN C  C G  ++ K +   V+V  G   + V 
Sbjct: 201 P-LTQKIQQMCGACQGKGQVI------KNKCKRCHGAKVERKAKHFHVDVPAGAPRDFVD 253

Query: 258 TIKGMADEELDKSACGDLKFHLVE-KQENLEQKQIFLKNFDEGSAEDLYTSATISLSEAL 316
              G AD+  D  + GD+     E  ++N+  ++             LY +  +SL EAL
Sbjct: 254 VKAGEADKGPDFDS-GDVFIKFSESSRDNMGYRR---------RGPHLYRTEVLSLKEAL 303

Query: 317 T-GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIHIE 375
             G+++                 G  +R G++ ++   G P      G+ GDL+V   + 
Sbjct: 304 LGGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPT--GGHGKHGDLFVDYVVV 361

Query: 376 FP 377
            P
Sbjct: 362 IP 363

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV+ DAS +EIK+AYR+L+ K HPDK       E    KF E+  AYE+LSD +K+
Sbjct: 27 YGILGVSKDASDKEIKSAYRQLSKKFHPDK---NPGDEDAHHKFIEVGEAYEVLSDDQKR 83

Query: 71 SHYDLYG 77
            YD +G
Sbjct: 84 QIYDQHG 90

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
          similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 6/69 (8%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          +LYD+LGV+ + +  E+K  YRK ALK+HPDK            KFKEI+ A+EIL+DP 
Sbjct: 6  KLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPN 59

Query: 69 KKSHYDLYG 77
          K+  YD YG
Sbjct: 60 KREVYDKYG 68

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YDVLGV+  A+  EIK AYRK A++ HPDK  D    E    KF+ +  AY++LSD E
Sbjct: 6  EYYDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPEAET---KFQAVGEAYQVLSDTE 62

Query: 69 KKSHYDLYGDD 79
           +S YD +G D
Sbjct: 63 LRSRYDQFGKD 73

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YDVLGV   A+  EIK AYR+ A++ HPDK+ D    +    KF+E+  AY++LSDP  +
Sbjct: 8  YDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPEAQA---KFQEVGEAYQVLSDPGLR 64

Query: 71 SHYDLYGDD 79
          S YD +G D
Sbjct: 65 SRYDEFGKD 73

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
          (REAL)
          Length = 378

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 3/69 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +L V  DAS +EIK+AYR+L+ K+HPDK  +  S+E +  KF E+  AY++LSDPEKK
Sbjct: 25 YAILEVDKDASEKEIKSAYRQLSKKYHPDK--NSGSEEAHH-KFIEVGEAYDVLSDPEKK 81

Query: 71 SHYDLYGDD 79
            YD +G D
Sbjct: 82 KIYDQFGAD 90

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 102/241 (42%), Gaps = 40/241 (16%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFG 197
           L++K  Y G  ++F L     C VCHGSG    K        +C  C G+G   ++ R G
Sbjct: 149 LSLKQFYSGTSIEFTLSLNDECDVCHGSGSADGKL------AQCPDCQGRGVIIQVLRMG 202

Query: 198 PGLVASQWV--TCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFND 255
              + +Q +   C +C G G+ +      KN C  C G  +  K +   V+V PG   N 
Sbjct: 203 ---IMTQQIQQMCGRCGGTGQII------KNQCKTCHGKKVIKKNKFFHVDVPPGAPRNY 253

Query: 256 VITIKGMADEELDKSACGDLKFHLVEKQ-ENLEQKQIFLKNFDEGSAEDLYTSATISLSE 314
           + T  G A++  D  A GDL     EK  EN+  ++           ++LY +  +S  E
Sbjct: 254 LDTRAGEAEKGPDFDA-GDLVIEFKEKDTENMGYRR---------RGDNLYRTEVLSAEE 303

Query: 315 ALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNE-----GWPIMDDPRGQRGDLY 369
           AL G  +               KP ++ RP  V+    E     G+ +    +G  GDLY
Sbjct: 304 ALYGGWQRTIEFFDEN------KPVKLSRPAHVVVSNGEIEVLKGFGMPKSGKGH-GDLY 356

Query: 370 V 370
           +
Sbjct: 357 I 357

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+  DAS +++K+AYR+L+ K+HPDK       E    +F E+  AYE+LSDPEK+
Sbjct: 21 YSILGLNKDASDKDVKSAYRQLSKKYHPDK---NPGDESAHQRFIEVGEAYEVLSDPEKR 77

Query: 71 SHYDLYGDD 79
            +D YG D
Sbjct: 78 GIFDQYGAD 86

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 101/244 (41%), Gaps = 30/244 (12%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE-CESCGGKGSKERLKRF 196
           L++KD Y G  ++FEL    +C  C GSG +  K       VE C  CGG+G   ++ R 
Sbjct: 146 LSLKDYYSGTGVEFELMLNDICDHCEGSGSEDGK-------VETCPDCGGQGILIQIIRM 198

Query: 197 GPGLVASQWVT--CEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFN 254
           G   + +Q +   C +C G+G  +      KN C  C G  +  K +   V V  G   +
Sbjct: 199 G---IMTQRIQQPCGRCSGRGHII------KNQCKACGGHKVVKKPKSFQVEVPAGAPRD 249

Query: 255 DVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLSE 314
            V      AD+  D  A GD+    VE  E+ +    + +  D      L+ +  +S  E
Sbjct: 250 HVEVRHQEADQSTDMEA-GDI---FVEFTESDKNNMGYRRRGDH-----LFRTEVLSARE 300

Query: 315 ALTGFEKXXXXXXXXXXXXXSIKP-GRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFIH 373
           AL G                  +P G ++  G++ +I   G P     +   GDL+V   
Sbjct: 301 ALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGK-SFGDLFVEYA 359

Query: 374 IEFP 377
           +  P
Sbjct: 360 VVMP 363

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV  DA+  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP 
Sbjct: 6  EYYDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPDAQA---KFQAVGEAYQVLSDPG 62

Query: 69 KKSHYDLYGDD 79
           +S YD +G D
Sbjct: 63 LRSRYDEFGKD 73

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 3/71 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YDVLGVT +A+  +IK AYRK A++ HPDK+ D    +    KF+ +  AY++LSDP 
Sbjct: 6  EYYDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPEAQS---KFQAVGEAYQVLSDPG 62

Query: 69 KKSHYDLYGDD 79
           +S YD +G D
Sbjct: 63 LRSKYDQFGKD 73

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          Q YD+LGV  +A+  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP 
Sbjct: 6  QYYDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPEAQS---KFQAVGEAYQVLSDPG 62

Query: 69 KKSHYDLYGDD 79
           +S YD +G D
Sbjct: 63 LRSRYDEFGKD 73

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
          several homologs of bacterial chaperone DnaJ, located
          in the ER lumen where it cooperates with Kar2p to
          mediate maturation of proteins
          Length = 377

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 50/69 (72%), Gaps = 3/69 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +L +  DA+ +EIK+AYR+L+ K+HPDK  +  S+E ++ KF E+  AY++LSDPEKK
Sbjct: 25 YAILEIDKDATEKEIKSAYRQLSKKYHPDK--NAGSEEAHQ-KFIEVGEAYDVLSDPEKK 81

Query: 71 SHYDLYGDD 79
            YD +G D
Sbjct: 82 KIYDQFGAD 90

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 107/248 (43%), Gaps = 40/248 (16%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFG 197
           L++K  Y G  ++F L     C  CHGSG    K        +C  C G+G   ++ R G
Sbjct: 148 LSLKQFYSGSSIEFTLNLNDECDACHGSGSADGKL------AQCPDCQGRGVIIQVLRMG 201

Query: 198 PGLVASQWV--TCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFND 255
              + +Q +   C +C G G+ +      KN C  C G  +  K +   V+V PG   N 
Sbjct: 202 ---IMTQQIQQMCGRCGGTGQII------KNECKTCHGKKVTKKNKFFHVDVPPGAPRNY 252

Query: 256 VITIKGMADEELDKSACGDLKFHLVEKQ-ENLEQKQIFLKNFDEGSAEDLYTSATISLSE 314
           + T  G A++  D  A GDL     EK  EN+  ++           ++LY +  +S +E
Sbjct: 253 MDTRVGEAEKGPDFDA-GDLVIEFKEKDTENMGYRR---------RGDNLYRTEVLSAAE 302

Query: 315 ALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDD---PRGQR--GDLY 369
           AL G  +               KP ++ RP  V+ ++N    ++     P+G +  GDLY
Sbjct: 303 ALYGGWQRTIEFLDEN------KPVKLSRPAHVV-VSNGEVEVVKGFGMPKGSKGYGDLY 355

Query: 370 VFIHIEFP 377
           +   +  P
Sbjct: 356 IDYVVVMP 363

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa]
          {ON} Anc_8.730 YMR214W
          Length = 373

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/69 (50%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+  DAS +EIK++YR+L+ K HPDK       E    KF EI  AYE+LSDPEK+
Sbjct: 23 YAILGLNKDASDKEIKSSYRQLSKKFHPDK---NPGDEEAHHKFIEIGEAYEVLSDPEKR 79

Query: 71 SHYDLYGDD 79
            +D YG D
Sbjct: 80 KIFDQYGAD 88

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 101/246 (41%), Gaps = 34/246 (13%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFG 197
           L++K+ Y G  L+F L    +C  C G+G    K        +C  C G+G   ++ R G
Sbjct: 144 LSLKEYYTGATLEFTLALNDICDHCDGTGSADGKV------AKCSDCQGRGVVIQVIRMG 197

Query: 198 PGLVASQWV--TCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFND 255
              + +Q +   C +C GKG  +      KN C  C G  +  K++   V V PG   + 
Sbjct: 198 ---MMTQQIQQMCGRCGGKGSVI------KNHCKTCHGSKVVKKQKPFHVEVPPGAARHY 248

Query: 256 VITIKGMADEELDKSACGDLKFHLVEK-QENLEQKQIFLKNFDEGSAEDLYTSATISLSE 314
             T  G +D+  D  A GD+     EK   NL  ++             LY +  +S  E
Sbjct: 249 TETRSGESDKGADFDA-GDVFIEFNEKTTNNLGYRR---------RGPHLYRTEVLSARE 298

Query: 315 ALTG-FEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQR--GDLYVF 371
           AL G +++             +     V+  G+V +I   G P    P G+   GDL++ 
Sbjct: 299 ALKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGMP---QPNGKHAFGDLFIE 355

Query: 372 IHIEFP 377
             +  P
Sbjct: 356 YVVVMP 361

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 5/73 (6%)

Query: 5  DRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEIL 64
          D +Y  YDVLGV  DA+ ++IK AYRK A++ HPDK  + N  E  + KF+E++ AY++L
Sbjct: 4  DTKY--YDVLGVQPDATAEQIKKAYRKKAIQTHPDK--NPNDPEA-QAKFQEVSKAYKVL 58

Query: 65 SDPEKKSHYDLYG 77
          SD E +S YD  G
Sbjct: 59 SDGELRSRYDEVG 71

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YDVLG++ +A+  EIK AYRK+A+  HPDK+ D    +    KF+ +  AY++L+DP 
Sbjct: 6  EFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPEAQA---KFQAVGEAYQVLNDPA 62

Query: 69 KKSHYDLYGDD 79
           +  YD +G D
Sbjct: 63 LRKQYDEFGKD 73

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 109/249 (43%), Gaps = 42/249 (16%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFG 197
           L++K  Y G  ++F L     C VCHGSG    K        +C  C G+G   ++ R G
Sbjct: 146 LSLKQFYSGSSIEFTLSLNDECDVCHGSGSADGKL------AQCPDCQGRGVIIQVLRMG 199

Query: 198 PGLVASQWV--TCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFND 255
              + +Q +   C +C G G+ +      KN C  C G  +  + +   V+V PG   N 
Sbjct: 200 ---IMTQQIQQMCGRCGGTGQVI------KNECKTCHGNKVTKRNKFFHVDVPPGAPRNY 250

Query: 256 VITIKGMADEELDKSACGDLKFHLVEK-QENLEQKQIFLKNFDEGSAEDLYTSATISLSE 314
           + T  G A++  D  A GDL     EK  EN+  ++           ++LY +  +S+ E
Sbjct: 251 MDTRAGEAEKGPDFDA-GDLVIEFKEKDSENMGYRR---------RGDNLYRTEVLSIEE 300

Query: 315 AL-TGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDD---PRGQR--GDL 368
           AL  G+E+               KP ++ RP   + ++N    +M     P+G +  GDL
Sbjct: 301 ALYGGWERTIEFLDEN-------KPVKLSRPA-YVGVSNGEIEVMKGFGMPKGGKGYGDL 352

Query: 369 YVFIHIEFP 377
           Y+   +  P
Sbjct: 353 YIDYVVIMP 361

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +L +   AS +EIK+AYR+L+ K HPDK  +  S+E ++ KF E+  AY++LSDPEKK
Sbjct: 25 YAILEIDKGASEKEIKSAYRQLSKKFHPDK--NAGSEEAHQ-KFIEVGEAYDVLSDPEKK 81

Query: 71 SHYDLYG 77
            YD +G
Sbjct: 82 KIYDQFG 88

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+  DA+ +EIK+AYR+L+ K HPDK       E    KF E+  AYE+LSDP+K+
Sbjct: 23 YQILGIAKDATDKEIKSAYRQLSKKFHPDK---NPGNEDAHQKFIEVGEAYEVLSDPQKR 79

Query: 71 SHYDLYGDD 79
            +D +G D
Sbjct: 80 QTFDQFGAD 88

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 108/249 (43%), Gaps = 32/249 (12%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFG 197
           +++KD Y G +L F L    +C  CHG+G    K         C  C G+G   +L R G
Sbjct: 143 ISLKDYYTGYELNFTLNVNDLCDHCHGTGSDDGKL------TPCPDCQGRGVIIQLIRMG 196

Query: 198 PGLVASQWV--TCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPG--HHF 253
              + +Q +   C +C GKG+  K+       C  C G  +  +K+   V +  G   H+
Sbjct: 197 ---MMTQQIQQMCGRCGGKGQLFKKQ------CRKCHGNKVMPQKKEFQVKLPKGAKRHY 247

Query: 254 NDVITIKGMADEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLYTSATISLS 313
            DV    G AD+  D  A GDL   L+E  EN +    + +       ++LY +  ++++
Sbjct: 248 MDV--KHGEADKNPDLEA-GDL---LIEFNENDKSNMGYRR-----RGQNLYRTEVLNVT 296

Query: 314 EAL-TGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFI 372
           EAL  G+++               +   V+  G+V +I   G P     +   GDL++  
Sbjct: 297 EALYGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLFI-D 355

Query: 373 HIEFPPDNW 381
           ++   P  W
Sbjct: 356 YVVIMPKQW 364

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+L V SDAS  ++K AYR+ AL++HPDK  D N +E   I F EI AAYE+LSDP+++
Sbjct: 6  YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPD-NVEEATTI-FAEIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LG+  DAS  +IK AYRK A+  HPDK+ D    +    KF+ I  AY++LSDP+
Sbjct: 6  EYYDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPEAQA---KFQAIGEAYQVLSDPD 62

Query: 69 KKSHYDLYG 77
           +S YD +G
Sbjct: 63 LRSRYDEFG 71

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+L V+ DAS QEIK +YRKLA+K HPDK  D    +    KF+E+  AY++L D + +
Sbjct: 8  YDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQAQT---KFQELAKAYQVLIDDDLR 64

Query: 71 SHYDLYGDD 79
            YD +G D
Sbjct: 65 KKYDQFGLD 73

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV S AS  E+K AYRK AL++HPDK  D N +E  E KF  I AAYE+LSDP+++
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD-NVQEATE-KFAIIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LG+  DA+  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP 
Sbjct: 6  EYYDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPDAQA---KFQAVGEAYQVLSDPG 62

Query: 69 KKSHYDLYG 77
           +S YD +G
Sbjct: 63 LRSKYDEFG 71

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON}
          similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 375

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV+ DAS +EIK+AYR+L+ K+HPDK       E    KF E+  AYE+LSD +K+
Sbjct: 26 YAILGVSKDASEKEIKSAYRQLSKKYHPDK---NPGDETAHHKFIEVGEAYEVLSDDQKR 82

Query: 71 SHYDLYG 77
            Y+ YG
Sbjct: 83 QIYNQYG 89

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 96/235 (40%), Gaps = 28/235 (11%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFG 197
           +T+K+ Y G  L F L     C  C G+G +  K         C  C G+G   ++ R G
Sbjct: 148 ITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQDGKT------TRCSDCQGQGVVIQIIRMG 201

Query: 198 PGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVI 257
           P     Q + C  C GKG+ +      KN C  C G  ++ K +   V+V  G   + V 
Sbjct: 202 PITQQIQQM-CGACQGKGQII------KNKCKQCHGAKVERKTKHFHVDVPAGAPRDFVD 254

Query: 258 TIKGMADEELDKSACGDLKFHLVE-KQENLEQKQIFLKNFDEGSAEDLYTSATISLSEAL 316
              G AD+  D  A GD+     E  ++N+  ++             L+ +  ++L EAL
Sbjct: 255 VKNGEADKGPDFDA-GDVYIKFSESSRDNMGYRR---------RGVHLHRTEVLTLKEAL 304

Query: 317 T-GFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYV 370
             G+++                 G  +R G+  ++   G P   D R   GDL+V
Sbjct: 305 QGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMP--KDGR-HFGDLFV 356

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
          S  ++  YD+L V   A   EIK +YRKLA+K HPDK     + E     FK I  A+E+
Sbjct: 19 SKEKHAFYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKAGEA----FKVINRAFEV 74

Query: 64 LSDPEKKSHYDLYGDD 79
          LSD EK+S +D  G D
Sbjct: 75 LSDDEKRSVFDRIGRD 90

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YDVLG+   A+  EIK AYR+ A++ HPDK+ D  +      +F+++  AY++LSDP+
Sbjct: 6  EYYDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASE---RFQQVGEAYQVLSDPD 62

Query: 69 KKSHYDLYGDD 79
           +  YD +G D
Sbjct: 63 LRKQYDEFGKD 73

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
          S  +++ Y++L V   A+  EIK AYRKLA+K HPDK    NS       FK I  A+E+
Sbjct: 16 SKDKHEFYEILRVDKKATDGEIKKAYRKLAIKLHPDK----NSHPRASEAFKVINRAFEV 71

Query: 64 LSDPEKKSHYDLYGDD 79
          LS+ EK+S YD  G D
Sbjct: 72 LSNEEKRSIYDRIGRD 87

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
          S  +++ Y++L V   A+  EIK AYRKLA+K HPDK     + E     FK I  A+E+
Sbjct: 16 SKDKHEFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEV 71

Query: 64 LSDPEKKSHYDLYGDD 79
          LS+ EK+S YD  G D
Sbjct: 72 LSNEEKRSIYDRIGRD 87

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD LG++ DA+  EIK AYRK A+  HPDK+ +    +    KF+ +  AY++LSDP 
Sbjct: 6  EYYDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPDAQA---KFQAVGQAYQVLSDPG 62

Query: 69 KKSHYDLYGDD 79
           +S YD +G D
Sbjct: 63 LRSRYDEFGKD 73

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV + AS  E+K AYRK AL++HPDK  D N +E  + KF  I AAYE+LSDP+++
Sbjct: 6  YELLGVETHASDLELKKAYRKKALQYHPDKNPD-NVEEATQ-KFAVIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+L V SDA+  ++K AYRK AL +HPDK  + N +E  E+ F +I AAYE+LSD +++
Sbjct: 6  YDLLDVKSDATDTDLKRAYRKKALLYHPDKNRN-NIEEATEV-FAQIRAAYEVLSDAQER 63

Query: 71 SHYDLYGD 78
          + YD + D
Sbjct: 64 AWYDAHKD 71

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 7  RYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSD 66
          R   Y+VL +   AS  EIK +YRKLA+K HPDK     + E     FK I  A+E+LSD
Sbjct: 22 RQAFYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRASEA----FKVINRAFEVLSD 77

Query: 67 PEKKSHYDLYGDD 79
           EK+  YD  G D
Sbjct: 78 EEKRRLYDRLGRD 90

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 44/73 (60%), Gaps = 4/73 (5%)

Query: 7  RYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSD 66
          ++  Y+VL +  +AS  EIK AYRKLA+K HPDK     + E     FK I  A+E+LSD
Sbjct: 20 KHAFYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEVLSD 75

Query: 67 PEKKSHYDLYGDD 79
           +K+  +D  G D
Sbjct: 76 EQKRRIFDQVGHD 88

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LG+  +A+  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP 
Sbjct: 6  EYYDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPDAQA---KFQAVGEAYQVLSDPG 62

Query: 69 KKSHYDLYG 77
           +S YD +G
Sbjct: 63 LRSKYDEFG 71

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LG+  +A+  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSDP 
Sbjct: 6  EYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQA---KFQAVGEAYQVLSDPG 62

Query: 69 KKSHYDLYG 77
           +S YD +G
Sbjct: 63 LRSKYDQFG 71

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 5/71 (7%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIK----FKEITAAYEILSD 66
           Y++LGVT  ++ +EIK AYR L+LK HPDK +D+N  E   +     F +I+ AYE L++
Sbjct: 123 YEILGVTVSSTEKEIKKAYRNLSLKFHPDK-LDRNLSEKERLSMEEIFVQISKAYEALTN 181

Query: 67  PEKKSHYDLYG 77
           P  K +Y LYG
Sbjct: 182 PATKENYLLYG 192

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 44/73 (60%), Gaps = 4/73 (5%)

Query: 7  RYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSD 66
          ++Q Y++L V   A+  EIK +YRKLA++ HPDK     + E     FK I  A+E+L D
Sbjct: 20 KHQFYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRASEA----FKLINRAFEVLGD 75

Query: 67 PEKKSHYDLYGDD 79
           EK+S YD  G D
Sbjct: 76 SEKRSLYDRLGRD 88

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 102/245 (41%), Gaps = 32/245 (13%)

Query: 138 LTVKDLYMGKKLKFELKRQIVCMVCHGSGWK-LKKKIHVTHEVECESCGGKGSKERLKRF 196
           L++K  Y G   +F L     C  CHG+G +  K K+       C  C G G   ++ R 
Sbjct: 157 LSLKQYYQGFDFQFALNLHDDCDHCHGTGSEDGKTKV-------CPDCKGSGIIIQIIRM 209

Query: 197 GPGLVASQWVT--CEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEIITVNVAPGHHFN 254
           G   + +Q +   C +C G+G  +K      NFC  C G  +Q K +   V V PG   N
Sbjct: 210 G---MMTQQIQQPCGRCRGQGHLIK------NFCKVCNGAKVQQKLKDFKVYVPPGSPRN 260

Query: 255 DVITIKGMADEELDKSACGDLKFHLVE-KQENLEQKQIFLKNFDEGSAEDLYTSATISLS 313
            V    G A++  +    GD+     E   +NL  ++            +L+ +  ISL+
Sbjct: 261 HVEVKAGQAEKNPNYEP-GDVIIEFNELPLDNLGYRR---------RGNNLFRTEYISLN 310

Query: 314 EALTG-FEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRGDLYVFI 372
           EAL G +E+                P   I  G++  +   G PI  + + + GDLY+  
Sbjct: 311 EALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPI-PNKKNKFGDLYIDY 369

Query: 373 HIEFP 377
            +  P
Sbjct: 370 KVIIP 374

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 4/70 (5%)

Query: 11 YDVLGVTSDASVQ-EIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEK 69
          Y +LG+  +   + EIK+AYRKL+ K+HPDK  ++N K+  +  F ++  AY++L DP+K
Sbjct: 26 YKILGINKNYKYEKEIKSAYRKLSKKYHPDK--NKNDKDAQQ-NFIKVGEAYDVLGDPDK 82

Query: 70 KSHYDLYGDD 79
          K  YD  G D
Sbjct: 83 KRQYDQMGHD 92

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L + SDA+ +EIK AYR   L  HPDK     +  VN +   +I  AY+ILS+ +K+
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 GEYD 73

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+++ A+  EIK AYRK ++K HPDK  + N     E +F+ I+ AY++LSD + +
Sbjct: 8  YDLLGISTTATDIEIKKAYRKKSIKEHPDK--NPNDPSATE-RFQAISEAYQVLSDKQLR 64

Query: 71 SHYDLYG 77
          S+YD YG
Sbjct: 65 SNYDKYG 71

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 47/64 (73%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV+S A   E+K A+R+ AL++HPDK  D N +E  E  F +I AAYE+L+DP+++
Sbjct: 6  YELLGVSSTADDLELKKAFRRKALQYHPDKNRD-NVEEATET-FAQIRAAYEVLNDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 7  RYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSD 66
          +++ Y++L V   AS  EIK AYRKLA++ HPDK     + E     FK I  A+E+LSD
Sbjct: 22 KHEFYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASEA----FKRINRAFEVLSD 77

Query: 67 PEKKSHYDLYGDD 79
            K+  +D  G D
Sbjct: 78 VGKRRMFDQLGRD 90

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (60%), Gaps = 4/76 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
          S  +++ Y++L V   A+  +IK AYRKLA+K HPDK     + E     FK I  A+E+
Sbjct: 16 SKDKHEFYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGEA----FKVINRAFEV 71

Query: 64 LSDPEKKSHYDLYGDD 79
          LS+ EK+S YD  G D
Sbjct: 72 LSNEEKRSIYDRIGRD 87

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV S AS  E+K AYRK AL++HPDK  D N +E  E KF  I AAYE+LSD +++
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD-NVEEATE-KFAIIRAAYEVLSDSQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+T  A+  EIK AYRK ++K HPDK  + N     E +F++I+ AY++LSD   +
Sbjct: 8  YDILGITPTATQAEIKKAYRKKSIKEHPDK--NPNDPTATE-RFQQISEAYQVLSDEHLR 64

Query: 71 SHYDLYG 77
          ++YD +G
Sbjct: 65 NNYDQFG 71

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV S AS  ++K AYR+ AL++HPDK +  N ++  EI F  I AAYE+LSD +++
Sbjct: 6  YELLGVDSGASDTDLKKAYRRKALQYHPDKNIG-NVQQATEI-FASIRAAYEVLSDAQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 7/75 (9%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV S AS  E+K AYRK ALK+HPDK  + N+ E     F  I  AYE+LSDP+++
Sbjct: 6  YELLGVESIASDLELKKAYRKKALKYHPDK--NPNNVEEATQAFATIRLAYEVLSDPQER 63

Query: 71 SHYD-----LYGDDY 80
          + YD     +  DDY
Sbjct: 64 AWYDSHKNQILDDDY 78

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
          S  ++  Y++L V   A+  EIK AYRKLA+K HPDK     + E     FK I  A+E+
Sbjct: 17 SKDKHAFYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKASEA----FKIINRAFEV 72

Query: 64 LSDPEKKSHYDLYGDD 79
          LSD EK+  YD  G D
Sbjct: 73 LSDVEKRQLYDRIGRD 88

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   AS  E+K AYRK AL+ HPDK  D N  E  E  F  I AAYE+LSDP+++
Sbjct: 6  YELLGVEVTASDAELKKAYRKKALQFHPDKNPD-NVDEATE-NFATIRAAYEVLSDPQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYV-DQNSKEVNEIK--FKEITAAYEILSDP 67
           YD+LGV+  AS +EIK+AYRKL+LK HPDK   D   +E N ++  + +I+ AYE L+D 
Sbjct: 122 YDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALTDE 181

Query: 68  EKKSHYDLYG 77
             K +Y +YG
Sbjct: 182 LVKQNYLMYG 191

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV++ A+  EIK AYRK +++ HPDK  + N  +  E +F+ I+ AY++L D E +
Sbjct: 8  YDLLGVSTTATAIEIKKAYRKKSIQEHPDK--NPNDPKATE-RFQAISEAYQVLGDDELR 64

Query: 71 SHYDLYG 77
          + YD YG
Sbjct: 65 AKYDKYG 71

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 57.8 bits (138), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
          S  +++ Y +L V   A+  EIK AYRKLA+K HPDK     + E     FK I  A+E+
Sbjct: 16 SKDKHEFYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKASEA----FKIINRAFEV 71

Query: 64 LSDPEKKSHYDLYGDD 79
          LS+ EK+  YD  G D
Sbjct: 72 LSNEEKRGLYDRIGRD 87

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV + AS  ++K AYRK AL +HPDK  D N +E   I F  I AAYE+L+DP+++
Sbjct: 6  YELLGVETTASDADLKKAYRKKALVYHPDKNRD-NVEEATAI-FATIRAAYEVLADPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYRK AL+ HPDK  D N  E  EI F  I +AYE+LSDP+++
Sbjct: 6  YELLGVDVTATDLELKKAYRKKALQFHPDKNPD-NVDEATEI-FATIRSAYEVLSDPQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV   A+  E+K AYRK AL+ HPDK  D N +E  EI F  I +AYE+LSDP+++
Sbjct: 6  YELLGVDITATDIELKKAYRKKALQFHPDKNPD-NVEEATEI-FATIRSAYEVLSDPQER 63

Query: 71 SHYDLY 76
          + YD +
Sbjct: 64 AWYDAH 69

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV S AS  E+K AYRK AL++HPDK  D N +E  + KF  I AAYE+LSD +++
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPD-NVEEATQ-KFAIIRAAYEVLSDSQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV ++A+  E+K AYR+ AL+ HPDK  D N +E   I F  + AAYE+L+DP+++
Sbjct: 6  YELLGVETNATDVELKKAYRRKALQFHPDKNPD-NVEETTAI-FASVRAAYEVLADPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LG+   A+  EIK AYRK A++ HPDK+ D    +    KF+ +  AY++LSD +
Sbjct: 6  EYYDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPDAQS---KFQSVGEAYQVLSDDD 62

Query: 69 KKSHYDLYGDD 79
           +  YD +G D
Sbjct: 63 LRKRYDEFGKD 73

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD LG++  A+  EIK AYR+ A++ HPDK+ D    E    KF+ +  AY++LSD  
Sbjct: 6  EYYDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEAEN---KFQAVGEAYQVLSDES 62

Query: 69 KKSHYDLYGDD 79
           ++ YD YG D
Sbjct: 63 LRARYDEYGKD 73

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV++ AS  EIK AYRK +++ HPDK  + N  +  E +F+ I+ AY++L D E +
Sbjct: 8  YDLLGVSTTASAIEIKKAYRKKSIQEHPDK--NPNDLKATE-RFQAISEAYQVLGDDELR 64

Query: 71 SHYDLYG 77
          + YD +G
Sbjct: 65 AKYDKFG 71

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/69 (44%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV++ AS  EIK AYRK +++ HPDK  + N  +  E +F+ I+ AY++L D E
Sbjct: 6  EYYDLLGVSTTASAIEIKKAYRKKSIQEHPDK--NPNDPKATE-RFQAISEAYQVLGDNE 62

Query: 69 KKSHYDLYG 77
           +  YD YG
Sbjct: 63 LRVKYDKYG 71

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L V+  AS  E+K AYRK AL++HPDK   +N +E   I F EI AAYE+LSDP+++
Sbjct: 6  YELLEVSEYASDLELKKAYRKKALQYHPDKNR-ENPEEATAI-FSEIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 6   RRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYE 62
           + +  Y++LG++S AS ++IK+AYRKL++K HPDK    +  + K+V E  + +IT AYE
Sbjct: 122 KLFDPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYE 181

Query: 63  ILSDPEKKSHYDLYG 77
            L+D   + +Y  YG
Sbjct: 182 SLTDELVRQNYLKYG 196

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
          S  R+  Y+VL V   +   EIK +YRKLA+K HPDK     + E     FK I  A+E+
Sbjct: 17 SKERHDFYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKASEA----FKVINRAFEV 72

Query: 64 LSDPEKKSHYDLYGDD 79
          LSD EK+  +D  G D
Sbjct: 73 LSDNEKREIFDRIGRD 88

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 44/73 (60%), Gaps = 4/73 (5%)

Query: 7  RYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSD 66
          +++ Y++L V   AS  +IK AYRKLA+K HPDK     + E     FK+I  A+E+LSD
Sbjct: 20 KHEFYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRASEA----FKKINRAFEVLSD 75

Query: 67 PEKKSHYDLYGDD 79
            K+  +D  G D
Sbjct: 76 DSKRRIFDQLGHD 88

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LG+  +A+  EIK AYR+ A++ HPDK+ D    +    KF+ +  AY++LSD  
Sbjct: 6  EYYDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPDAQA---KFQAVGEAYQVLSDQG 62

Query: 69 KKSHYDLYG 77
           +S YD +G
Sbjct: 63 LRSKYDEFG 71

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYEILSDP 67
           YD+LG++S AS +EIK+AYRKL++K HPDK    + +  +   E  + +IT AYE L+D 
Sbjct: 121 YDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

Query: 68  EKKSHYDLYG 77
             + ++  YG
Sbjct: 181 LTRQNFLKYG 190

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 45/64 (70%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV S AS  E+K AYRK AL++HPDK   +  +E  EI F  I  AYE+LSDP+++
Sbjct: 6  YELLGVDSHASDLELKKAYRKKALQYHPDKNPTK-VEEATEI-FATIRTAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV+ DA   EIK AYRK +++ HPDK  + N  +  E +F+ I+ AY++LS  E +
Sbjct: 8  YDLLGVSPDAKAIEIKKAYRKKSVQEHPDK--NPNDPKATE-RFQAISEAYQVLSSDELR 64

Query: 71 SHYDLYG 77
          + YD +G
Sbjct: 65 AKYDKFG 71

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 41/71 (57%), Gaps = 4/71 (5%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + Y+VL V   AS  EIK AYR+LA+K HPDK     S E     FK I  A+E+L D +
Sbjct: 23 EFYEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAEA----FKVINRAFEVLGDED 78

Query: 69 KKSHYDLYGDD 79
          K+  +D  G D
Sbjct: 79 KRRLFDQLGRD 89

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 46/64 (71%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV + AS  ++K AYR+ AL++HPDK  D N +E   + F  I +AYE+L+DP+++
Sbjct: 6  YELLGVETTASDSDLKKAYRRKALQYHPDKNPD-NVEEATTV-FATIRSAYEVLADPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y+ LGV  DAS  +IK AY KLA + HPD     N  E  E KF ++  AYEILSD  K+
Sbjct: 43  YETLGVAKDASASQIKKAYYKLAKQFHPDI----NKDEGAEKKFHDLQNAYEILSDENKR 98

Query: 71  SHYDLY 76
             YD +
Sbjct: 99  RQYDQF 104

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 99/248 (39%), Gaps = 38/248 (15%)

Query: 138 LTVKDLYMGKK---LKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLK 194
           L+ +D   G K   L++ +  Q  C  C GSG K   +  V     C  C G G++  + 
Sbjct: 181 LSFRDAVFGLKDVPLRYAVYDQ--CGTCSGSGLKAGAQRSV-----CGGCHGTGTQVHV- 232

Query: 195 RFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQ-SKKEIITVNVAPGHHF 253
           R G  + +    TC +C G+G  ++R     + C  C+G G+  ++ + + ++   G   
Sbjct: 233 RAGFQMAS----TCSQCSGEGYSIRR----GDRCGTCSGEGVVFNRNKEVKMDFPHGLQD 284

Query: 254 NDVITIKGMAD---EELDKSACGDLKFH----LVEKQENLEQKQIFLKNFDEGSAEDLYT 306
            DV+ + G       ++D      ++      LV+ Q   + +     N+      D++ 
Sbjct: 285 GDVVKVPGQGSFPHIQVDPKTAHTMRLRRGDLLVQVQVERDPRFQIKNNY------DIWY 338

Query: 307 SATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQRG 366
              I ++ A  G                 I PG   +P  V+ I N+G P      G RG
Sbjct: 339 VQEIPITTAALGGTVSIPTVDGDQIRLKVI-PG--TQPDQVVSIPNKGVP--RGLSGARG 393

Query: 367 DLYVFIHI 374
           D+ V   I
Sbjct: 394 DMKVQYRI 401

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 5/70 (7%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYV-DQNSKEVNEIKFKEITAAYEILSDPEK 69
          YD+LGV  +A+  EIK AYR+ A++ HPDK+  D N+    + KF+ +  AY++LSD E 
Sbjct: 8  YDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPNA----QAKFQAVGEAYQVLSDDEL 63

Query: 70 KSHYDLYGDD 79
          +  YD  G +
Sbjct: 64 RKRYDQLGKE 73

>NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON}
          Anc_1.113
          Length = 190

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 6/80 (7%)

Query: 1  MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQ------NSKEVNEIKF 54
          M+ S  R   Y+VL + SDA++QEIK AY++  L  HPDK   Q       + ++  +  
Sbjct: 1  MTKSSSRITHYEVLNINSDATLQEIKKAYKQKLLNIHPDKSSTQILPISITTNDLTSVSI 60

Query: 55 KEITAAYEILSDPEKKSHYD 74
           +I  AY+ILS+   +  YD
Sbjct: 61 NQIQQAYKILSNESTREQYD 80

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV++ AS  EIK AYRK +++ HPDK  + N     E +F+ I+ AY++L D +
Sbjct: 6  EYYDLLGVSTTASSIEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLGDDD 62

Query: 69 KKSHYDLYG 77
           ++ YD YG
Sbjct: 63 LRAKYDKYG 71

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 39/64 (60%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L + SDA+ +EIK AYR   L  HPDK   + S +VN +    I  AY++LS+ + +
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIKTR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 GEYD 73

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 7  RYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSD 66
          ++  YD+L V   +S  +IK AYRKLA+K HPDK     + E     FK I  A+E+LSD
Sbjct: 19 KHAFYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKAHEA----FKLINRAFEVLSD 74

Query: 67 PEKKSHYDLYGDD 79
           +K+  YD  G D
Sbjct: 75 SQKRQIYDQIGRD 87

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYEILSDP 67
           Y++LG++S AS ++IK+AYRKL+LK HPDK    + +  +E  E ++ +IT AYE L+D 
Sbjct: 123 YELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTDE 182

Query: 68  EKKSHYDLYG 77
             + +Y  YG
Sbjct: 183 LIRFNYLTYG 192

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 3/78 (3%)

Query: 3   GSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITA 59
            + + +  Y++LG+++ AS ++IK+AYRKL++K HPDK    +  + K V E  + +IT 
Sbjct: 119 AATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITK 178

Query: 60  AYEILSDPEKKSHYDLYG 77
           AYE L+D   + +Y  YG
Sbjct: 179 AYESLTDELVRQNYLKYG 196

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
          S  ++  Y+VL V   AS  EIK AYRKLA+K HPDK     + E     FK I  A+E+
Sbjct: 17 SKDKHAFYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRASEA----FKRINRAFEV 72

Query: 64 LSDPEKK 70
          LSD +K+
Sbjct: 73 LSDEQKR 79

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
          S  ++  YD+L V   A   EIK +YRKLA+K HPDK     + E     FK I  A+E+
Sbjct: 19 SKDKHAFYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKASEA----FKRINRAFEV 74

Query: 64 LSDPEKKSHYDLYGDD 79
          L D +K+  +D  G D
Sbjct: 75 LGDEKKRVLFDRIGRD 90

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
          S  ++  Y++L V   ++  EIK AYRKLA++ HPDK     + E     FK I  A+E+
Sbjct: 16 SKDKHAFYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKASEA----FKIINRAFEV 71

Query: 64 LSDPEKKSHYDLYGDD 79
          LSD EK+  +D  G D
Sbjct: 72 LSDNEKRRIFDQLGRD 87

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 50/78 (64%), Gaps = 3/78 (3%)

Query: 3   GSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITA 59
            + + +  Y++LG+++ AS ++IK+AYRKL++K HPDK    +  + K V E  + +IT 
Sbjct: 119 AATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITK 178

Query: 60  AYEILSDPEKKSHYDLYG 77
           AYE L+D   + +Y  YG
Sbjct: 179 AYESLTDELVRQNYLKYG 196

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 5/67 (7%)

Query: 8  YQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDP 67
          Y+L DV    SDA   ++K AYR+ AL++HPDK ++ N KE  +I F  I  AYEILSDP
Sbjct: 6  YELLDVEMTASDA---DLKKAYRRKALQYHPDKNIN-NIKEATDI-FANIRTAYEILSDP 60

Query: 68 EKKSHYD 74
          +++  YD
Sbjct: 61 QERVWYD 67

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y  LGV+ DAS  +IK AY KLA K+HP    D N +   +  F  +  AYEILSD +KK
Sbjct: 50  YKTLGVSRDASPSDIKRAYYKLAKKYHP----DINKEPGADKTFHNLQNAYEILSDEKKK 105

Query: 71  SHYDLYG 77
             YD YG
Sbjct: 106 LQYDQYG 112

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 86/193 (44%), Gaps = 34/193 (17%)

Query: 138 LTVKDLYMG-KKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVE-CESCGGKGSKERLKR 195
           ++ KD   G   +  + K    C  CHGSG K  ++    H+ + C  C G G++  +K 
Sbjct: 191 VSFKDAVFGLNNVSLKYKSLDPCGTCHGSGLKNGEQ----HKRKTCSYCNGTGTQVHVK- 245

Query: 196 FGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQ-SKKEIITVNVAPGHHFN 254
              G   +   TC  CHG+G  + R    ++ C  C G G++ + K+ + VN   G    
Sbjct: 246 --SGFQMAS--TCMHCHGEGTTIAR----EDTCSACDGDGVKINSKKSLNVNFPSGLSDG 297

Query: 255 DVITIKG------MADEELDKS---ACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDLY 305
           DVI I G      +A  E DKS   + GDL   +  K +     + F+KN       D++
Sbjct: 298 DVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVRIRVKSD----PKFFVKN-----KYDIW 348

Query: 306 TSATISLSEALTG 318
           T   I ++ A  G
Sbjct: 349 TIKEIPITTAALG 361

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68
          + YD+LGV  +++  EIK AYRK ++K HPDK  + N+ +  + KF+ I+ AY++LSD  
Sbjct: 6  EYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDK--NPNNPDATK-KFQAISEAYQVLSDKN 62

Query: 69 KKSHYDLYGDD 79
           +S+YD +G D
Sbjct: 63 LRSNYDKFGKD 73

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 6   RRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYE 62
           + +  Y++LGV++ AS ++IK+AYRKL++K HPDK    +  + K V E  + +IT AYE
Sbjct: 122 KLFDPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYE 181

Query: 63  ILSDPEKKSHYDLYG 77
            L+D   + +Y  YG
Sbjct: 182 SLTDELVRQNYLKYG 196

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (68%), Gaps = 2/64 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L V   A   E+K AYR+ AL++HPDK   +N +E  EI F  I AAYE+LSDP+++
Sbjct: 6  YELLDVQPFADDNELKKAYRRKALQYHPDKNP-ENVEEATEI-FASIRAAYEVLSDPQER 63

Query: 71 SHYD 74
          + YD
Sbjct: 64 AWYD 67

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGVT  A+  EIK AYRK +++ HPDK  D     +   +F+ I+ AY++LSD + +
Sbjct: 8  YEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDD---PMATERFQAISEAYQVLSDEDLR 64

Query: 71 SHYDLYG 77
            YD +G
Sbjct: 65 GKYDRFG 71

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+   A+  EIK AYRK ++K HPDK  + N  +  E +F+ I+ AY++LSD   +
Sbjct: 8  YDLLGIEPSATQGEIKKAYRKKSIKEHPDK--NPNDPQATE-RFQAISEAYQVLSDESLR 64

Query: 71 SHYDLYG 77
            YD YG
Sbjct: 65 LKYDKYG 71

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 4/73 (5%)

Query: 7  RYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSD 66
          ++  Y++L +  +AS  ++K AYRKLA+K HPDK     + E     FK+I  A+E+LSD
Sbjct: 22 KHSFYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRAAEA----FKKINRAFEVLSD 77

Query: 67 PEKKSHYDLYGDD 79
            K+  YD  G D
Sbjct: 78 ENKRKVYDQIGCD 90

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKE---VNEIKFKEITAAYEILSDP 67
           YD+LG++  AS ++IK+AYR+L+LK HPDK   + S E     E  + +I+ A+E L+DP
Sbjct: 127 YDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDP 186

Query: 68  EKKSHYDLYG 77
             + +Y  YG
Sbjct: 187 IVRENYLKYG 196

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 4/73 (5%)

Query: 7  RYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSD 66
          ++  Y++L V   AS  +IK AYRK+A+K HPDK     + E     FK++  A+E+LSD
Sbjct: 22 KHSFYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRAAEA----FKKVNRAFEVLSD 77

Query: 67 PEKKSHYDLYGDD 79
           +K+  YD  G D
Sbjct: 78 EKKRRVYDQLGYD 90

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV+ +A   EIK AYRK +++ HPDK  + N     E +F+ I+ AY++LS+ E +
Sbjct: 8  YDLLGVSPNARPIEIKKAYRKKSVQEHPDK--NPNDPSATE-RFQSISQAYQVLSNEELR 64

Query: 71 SHYDLYG 77
          + YD +G
Sbjct: 65 TKYDKFG 71

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 3/69 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV+ DA   +IK AYRK +++ HPDK  + N  +  E +F+ I+ AY++L   E +
Sbjct: 8  YDLLGVSPDAKQIDIKKAYRKKSVQEHPDK--NPNDPKATE-RFQAISEAYQVLGSDELR 64

Query: 71 SHYDLYGDD 79
          + YD +G D
Sbjct: 65 AKYDKFGKD 73

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV +DA   +IK AYRK ++K HPDK  D  +      +F+ I+ AY++LS  E +
Sbjct: 8  YDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTATE---RFQAISEAYQVLSSEELR 64

Query: 71 SHYDLYG 77
            YD +G
Sbjct: 65 MKYDKFG 71

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y VLGV S AS  EIK AY KLA ++HPD     N +   E KF ++  AYEILSD  K+
Sbjct: 37 YGVLGVKSSASQGEIKKAYYKLAKQYHPDI----NKEAGAEKKFHDLQNAYEILSDESKR 92

Query: 71 SHYD 74
            +D
Sbjct: 93 KQFD 96

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 91/254 (35%), Gaps = 49/254 (19%)

Query: 138 LTVKDLYMGK---KLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLK 194
           ++ KD   GK   KLKF +     C  C GSG K     H     +C  C G G+K  ++
Sbjct: 192 MSFKDAVFGKSGVKLKFNVFDP--CDTCSGSGIKKGASRH-----QCPGCQGSGTKIHVR 244

Query: 195 RF-----------GPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEII 243
                        G G   +    C  CHG+G +  R K                    I
Sbjct: 245 GGFQMMSTCNECQGEGTTVNSSDLCGACHGEGVHFHRGKE-------------------I 285

Query: 244 TVNVAPGHHFNDVITIKGMA---DEELDKSACGDLKFHLVEKQENLEQKQIFLKNFDEGS 300
           TV++  G    DVI I G     +  LD S  G +K    +   N+  ++     F    
Sbjct: 286 TVDLPHGLQDGDVIRIPGQGSYPEVALDPSLAGSVKLTRGDVLVNVRVEED--PTFTIRD 343

Query: 301 AEDLYTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDD 360
             D++ +  I ++ A  G                 + PG   + GDVI + N G P  + 
Sbjct: 344 KSDIWYTMEIPITTAALG-GTVQVPTVDGSHIRLKVAPG--TQSGDVITVPNMGVPRSNL 400

Query: 361 PRGQRGDLYVFIHI 374
            R  RG + V   I
Sbjct: 401 TR-SRGAMKVQYRI 413

>TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON}
          Anc_1.185 YJL162C
          Length = 586

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y VLG+TS ASV EI+ +Y KLA   HPDK     S+E+    FK ++ A+ IL DPE K
Sbjct: 16 YSVLGLTSKASVSEIRKSYMKLAKSLHPDKSKSNASEEL----FKIVSNAHSILIDPELK 71

Query: 71 SHYD 74
            YD
Sbjct: 72 LDYD 75

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYEILSDP 67
           Y++LG++  AS ++IK+AYRKL++K HPDK    + Q  +   E K+ +IT AYE L+D 
Sbjct: 123 YELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

Query: 68  EKKSHYDLYG 77
             K ++  YG
Sbjct: 183 VIKENFLKYG 192

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YJR097W (JJJ3)
          Length = 156

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 5/64 (7%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+  DA   E++ AYR+  L+ HPDK        V++     I  AY +LSDP ++
Sbjct: 6  YDILGIAVDAEPLEVRQAYRQRLLEAHPDK-----QGGVDKGAVTRIQQAYRVLSDPTQR 60

Query: 71 SHYD 74
          S YD
Sbjct: 61 SAYD 64

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+T +A+  EIK AYRK +++ HPDK  + N     E +F+ I+ AY++LS+ E +
Sbjct: 8  YDLLGITPNATSIEIKKAYRKKSVQEHPDK--NPNDPGATE-RFQAISEAYQVLSNDELR 64

Query: 71 SHYDLYG 77
          + YD  G
Sbjct: 65 AKYDRLG 71

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 4/75 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKY----VDQNSKEVNEIKFKEITA 59
          S  R   Y+VLGV  DAS  EIK  YRK+ L  HPDK     +D   K  + +   +I  
Sbjct: 5  SKSRISHYEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQE 64

Query: 60 AYEILSDPEKKSHYD 74
          AY +LS+ + ++ Y+
Sbjct: 65 AYRVLSNDQLRAAYN 79

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LG+ + A+  EIK AYRK +++ HPDK  + N     E +F+ I+ AY++LSD + +
Sbjct: 8  YELLGIETTATAVEIKKAYRKKSIEEHPDK--NPNDPGATE-RFQAISEAYQVLSDSDLR 64

Query: 71 SHYDLYG 77
          ++YD +G
Sbjct: 65 ANYDKFG 71

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
          {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
          YJR097W JJJ3 Protein required along with Dph1p Dph2p
          Kti11p and Dph5p for synthesis of diphthamide which is
          a modified histidine residue of translation elongation
          factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y+VL V  DAS+ EIK AYR   L  HPDK  D+N   +N +    I  AY +LSD + +
Sbjct: 5  YEVLRVKFDASLIEIKQAYRDRLLNAHPDKNNDENKPALN-VSVNAIQEAYRVLSDEKLR 63

Query: 71 SHYD 74
            YD
Sbjct: 64 REYD 67

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVN---EIKFKEITAAYEILSDP 67
           Y++LGV++ A+ +EIK+AYRKL++K HPDK     + E     E  + +IT AYE L+D 
Sbjct: 124 YEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTDE 183

Query: 68  EKKSHYDLYG 77
             K +Y  YG
Sbjct: 184 NVKENYLRYG 193

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 53/91 (58%), Gaps = 18/91 (19%)

Query: 1   MSGSDRRYQL-------YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEI- 52
           +  +D  YQ+       Y++LGVT  ++ +EIK+AYRKL++K HPDK     SK++NEI 
Sbjct: 96  IRSNDAIYQIAAAAFDPYELLGVTLSSTDKEIKSAYRKLSVKFHPDKL----SKDLNEIE 151

Query: 53  ------KFKEITAAYEILSDPEKKSHYDLYG 77
                 +F  I  AY+ L+D   K +Y  YG
Sbjct: 152 RTAMEEQFVMINKAYKALTDEITKENYRKYG 182

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
          (REAL)
          Length = 172

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (54%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L + SDA+ +EIK AYR   L  HPDK        ++ +   +I  AY ILSD   +
Sbjct: 10 YEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIRSR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 CEYD 73

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 4  SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEI 63
          S  ++  Y++L V   A+  EIK AYRKLA+K HPDK     + E     FK I  A+E+
Sbjct: 17 SKDKHAFYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKAAEA----FKLINRAFEV 72

Query: 64 LSDPEKKSHYDLYGDD 79
          L + EK+  ++  G D
Sbjct: 73 LGNSEKREIFNRIGRD 88

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LG+   A+  EIK AYRK +++ HPDK  + N     E +F+ I+ AY++LS  E +
Sbjct: 8  YDLLGIGPTATAVEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLSSEELR 64

Query: 71 SHYDLYG 77
          + YD +G
Sbjct: 65 AKYDKFG 71

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 16/124 (12%)

Query: 138 LTVKDLYMGKK-LKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRF 196
           L  KD   GKK +K        C  C+GSG K     H  H+  C++C G G++  + R 
Sbjct: 188 LNFKDSVFGKKNVKLNFNSFDPCNTCNGSGLK-----HNAHKSTCQTCNGTGTRVHI-RG 241

Query: 197 GPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKKEI-ITVNVAPGHHFND 255
           G  +++    TC  C+G+G  +    +P ++C  C G G++ K+   ITV++       D
Sbjct: 242 GFQMMS----TCNDCNGEGTKI----DPNDYCNHCHGDGVEFKRNKEITVDLPNALQDGD 293

Query: 256 VITI 259
           VI +
Sbjct: 294 VIRV 297

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y  LG+ S+AS  +IK AY KLA K+HPD   ++N+    E KF ++  AYEILSD +K+
Sbjct: 49  YKTLGINSNASQSDIKKAYYKLAKKYHPDINKEENA----EAKFHDLQNAYEILSDEQKR 104

Query: 71  SHYDLYG 77
             YD +G
Sbjct: 105 KQYDQFG 111

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
          Anc_2.350 YMR161W
          Length = 175

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 4/69 (5%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YDV+GV    S +++K +Y++L  K HPDK     +KE     F  +  AY+ LS+ +K+
Sbjct: 25 YDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEA----FALVHKAYKTLSNKQKR 80

Query: 71 SHYDLYGDD 79
          + YD YG+D
Sbjct: 81 AMYDKYGND 89

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDK--YVDQNSKEVNEIKFKEITAAYEILSDPE 68
           Y +LG++ +A+ ++I+ AY +L  ++HPDK  ++ ++ ++ N  K  EI  AYE LSD  
Sbjct: 561 YKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSDEA 620

Query: 69  KKSHYD 74
           KKS YD
Sbjct: 621 KKSEYD 626

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 52/107 (48%), Gaps = 15/107 (14%)

Query: 159 CMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYV 218
           C  CHGSG K   + H     +C SC G G K  + R G  +V+    TC +CHG+G  +
Sbjct: 222 CHTCHGSGIKQGAQKH-----QCPSCHGSGQKVHI-RSGFQMVS----TCNECHGEGTIL 271

Query: 219 KRPKNPKNFCPDCAGVGLQ-SKKEIITVNVAPGHHFNDVITIKGMAD 264
               N  ++C  C G  ++ ++   I VN+  G    DVI I G  +
Sbjct: 272 ----NASDYCGTCHGDAVEFTRDHSINVNLPNGLQDGDVIRIPGQGN 314

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y VLG+   A+  EIK AY KLA K+HPD     N +   E KF ++  AYEILSD  KK
Sbjct: 53  YKVLGINKSATSSEIKKAYYKLAKKYHPDI----NKEPTAEKKFHDLQNAYEILSDETKK 108

Query: 71  SHYDLYG 77
           S YD +G
Sbjct: 109 SQYDTFG 115

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 45/74 (60%), Gaps = 4/74 (5%)

Query: 4   SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKY--VDQNSKEVNEIKFKEITAAY 61
           +D+ Y  Y +L V  +A+ ++I+ AY +L  K+HPDK   + +N +  NE K   I  AY
Sbjct: 504 TDKDY--YKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAY 561

Query: 62  EILSDPEKKSHYDL 75
           EILSD  K+  YDL
Sbjct: 562 EILSDESKRKEYDL 575

>TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON}
          Anc_1.113 YJR097W
          Length = 168

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 1  MSGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAA 60
          M+G   R   Y+VLGVT+D+++ +IK AY++  L  HPDK   Q  K  N     +I  A
Sbjct: 1  MTGYTLRVSHYEVLGVTTDSTLMDIKRAYKEKLLNVHPDKNKGQAPKS-NTYSVNQIQEA 59

Query: 61 YEILSDPEKKSHYD 74
          Y +L++   ++ YD
Sbjct: 60 YGVLAEQTLRTQYD 73

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYEILSDP 67
           Y++LG+++ AS ++IK+AYRKL++K HPDK    + +  +   E  + +IT AYE L+D 
Sbjct: 131 YELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

Query: 68  EKKSHYDLYG 77
             + ++  YG
Sbjct: 191 AMRENFLKYG 200

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LG++  A+  EIK AYRK +++ HPDK  + N     E +F+ I+ AY++LSD   +
Sbjct: 8  YELLGISPSATAIEIKKAYRKKSIQEHPDK--NPNDPTATE-RFQAISEAYQVLSDDTLR 64

Query: 71 SHYDLYG 77
            YD YG
Sbjct: 65 LKYDKYG 71

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV+ DA   +IK AYRK +++ HPDK  + N     E +F+ I+ AY++LS  + +
Sbjct: 8  YDLLGVSPDAKSIDIKKAYRKKSVQEHPDK--NPNDPTATE-RFQAISQAYQVLSKDDLR 64

Query: 71 SHYDLYG 77
          + YD +G
Sbjct: 65 AKYDKFG 71

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQN--SKEVNEIKFKEITAAYEILSDPE 68
          Y+VL V + AS+ +IK AYR+  L  HPDK   Q   S+   +   ++I  AY +L+DP 
Sbjct: 6  YEVLAVEAGASLSQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRVLADPT 65

Query: 69 KKSHYD 74
          ++  YD
Sbjct: 66 RREQYD 71

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 4/73 (5%)

Query: 4   SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQN--SKEVNEIKFKEITAAY 61
           +D+ Y  Y +LGV   A+ ++++ +Y +L  K HPDK  + N   ++ NE K  EI  AY
Sbjct: 525 TDKDY--YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAY 582

Query: 62  EILSDPEKKSHYD 74
           EILSD +K++ YD
Sbjct: 583 EILSDDDKRTKYD 595

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+L +   A+  EIK AYRK ++K HPDK  + N     E +F+ I+ AY++LSD   +
Sbjct: 8  YDLLDIDITATAIEIKKAYRKKSIKEHPDK--NPNDPTATE-RFQAISEAYQVLSDKNLR 64

Query: 71 SHYDLYG 77
          ++YD +G
Sbjct: 65 ANYDKFG 71

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 16/126 (12%)

Query: 138 LTVKDLYMG-KKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRF 196
           ++ KD   G K ++ +      C  C G+G K       TH+V C +C G GS   + R 
Sbjct: 212 VSFKDAVFGAKNVQLKFSALDPCGTCSGTGMKPN-----THKVSCTTCHGSGSTVHV-RG 265

Query: 197 GPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSKK-EIITVNVAPGHHFND 255
           G  +++    TC  C+G+G      K P++ C  C G G+Q+ + + ITV++  G    D
Sbjct: 266 GFQMMS----TCPTCNGEGTM----KRPQDNCTSCHGEGVQANRGKSITVDLPHGLQDGD 317

Query: 256 VITIKG 261
           V+ I G
Sbjct: 318 VVRIPG 323

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           YD LG+   A+  EIK AY KLA K+HPD     N +   E KF ++  AYEILSD  K+
Sbjct: 63  YDTLGLKKSATGAEIKKAYYKLAKKYHPDI----NKEPDAEKKFHDLQNAYEILSDDTKR 118

Query: 71  SHYD 74
             +D
Sbjct: 119 QQFD 122

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEI--KFKEITAAYEILSDPE 68
           Y VLG++  AS +EI+ AY  L  K+HPDK    + KE  +I  K  ++  AYEILSD  
Sbjct: 524 YKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSDEG 583

Query: 69  KKSHYD 74
           KK  YD
Sbjct: 584 KKRDYD 589

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 4   SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDK--YVDQNSKEVNEIKFKEITAAY 61
           +D+ Y  Y +LGV  ++  + I+ AY  L  K+HPDK   + Q  +E N  K  EI  AY
Sbjct: 551 TDKDY--YKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAY 608

Query: 62  EILSDPEKKSHYD 74
           EIL D  KK  YD
Sbjct: 609 EILGDESKKKEYD 621

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 4/75 (5%)

Query: 3   GSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEI--KFKEITAA 60
            S++ Y  Y +L V+ DA  ++I+ +Y  L  K HPDK    + KE  +I  K  EI  A
Sbjct: 523 ASNKDY--YKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEA 580

Query: 61  YEILSDPEKKSHYDL 75
           YE+LSD  K++ YDL
Sbjct: 581 YEVLSDETKRNEYDL 595

>ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YER048C (CAJ1)
          Length = 578

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 40/67 (59%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGVT  A  ++   AYR  A++ HPD      +      KF+E++ AY++LSDP+ K
Sbjct: 8  YDILGVTPSAFAEQNNKAYRMKAIQTHPDM---NPTHPYAHAKFQEVSKAYKVLSDPDLK 64

Query: 71 SHYDLYG 77
          + Y  +G
Sbjct: 65 NRYTEFG 71

>KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 3/64 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++LGV + ++V EIK AY++  L  HPDK     + E   +  +EI  AY++L +P  K
Sbjct: 8  YEILGVDTKSTVAEIKKAYKEKLLCTHPDK---NRTVEAQNVSIEEIKEAYQVLVNPSGK 64

Query: 71 SHYD 74
           +YD
Sbjct: 65 ENYD 68

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV   A   +IK AYRK +++ HPDK  + N     E +F+ I+ AY++LS  + +
Sbjct: 9  YDLLGVDPSAKAIDIKKAYRKKSVQEHPDK--NPNDPTATE-RFQAISQAYQVLSKEDLR 65

Query: 71 SHYDLYG 77
          + YD YG
Sbjct: 66 AKYDKYG 72

>TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa]
          {ON} Anc_1.185 YJL162C
          Length = 492

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 4/65 (6%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y VLG+T  AS+ +IK +Y+KLA + HPDK     S E+    FK +  AY ILSD +++
Sbjct: 9  YSVLGLTPTASLNDIKKSYKKLARELHPDKSKSNESSEL----FKIVVDAYSILSDVKER 64

Query: 71 SHYDL 75
            Y++
Sbjct: 65 EEYNI 69

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEI--KFKEITAAYEILSDPE 68
           Y +LG+ +DA+ ++I+ AY  L  K+HPDK  + +  E  ++  K   I  AYE+LSD  
Sbjct: 511 YKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDES 570

Query: 69  KKSHYDL 75
           K+  YD+
Sbjct: 571 KRKEYDM 577

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDK--YVDQNSKEVNEIKFKEITAAYEILSDPE 68
           Y +LGV  ++ ++EI+ +Y  L  K+HPDK   + +  +E N  K ++I  AYE LSD  
Sbjct: 606 YKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHKKMEQINEAYECLSDES 665

Query: 69  KKSHYDL 75
           K+  YDL
Sbjct: 666 KRKEYDL 672

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa]
          {ON} Anc_1.113 YJR097W
          Length = 159

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 6/65 (9%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSK-EVNEIKFKEITAAYEILSDPEK 69
          Y+ LG+ SD S++EIK AY++  L  HPDK  D++S  EVN+I+      AY++L D   
Sbjct: 6  YETLGLNSDCSLEEIKKAYKEKLLSSHPDKIGDESSSVEVNKIQ-----EAYKVLCDVNL 60

Query: 70 KSHYD 74
          +  YD
Sbjct: 61 REKYD 65

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYV-DQNSKEVNEIK--FKEITAAYEILSDP 67
           Y +LGV+  A+ ++IK+AYRKL++K HPDK   D   +E   I+  + +I+ AYE L+D 
Sbjct: 125 YALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALTDE 184

Query: 68  EKKSHYDLYG 77
             K++Y  YG
Sbjct: 185 ITKANYLTYG 194

>KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa]
          {ON} some similarities with uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 653

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 48/79 (60%), Gaps = 9/79 (11%)

Query: 1  MSGSDRRYQL-----YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFK 55
          MSGSD+ YQL     Y VL +   A+  +I+ AY KLA + HPDK     S+E  E+ FK
Sbjct: 1  MSGSDKTYQLDETTLYSVLNLKYGATEVQIRKAYMKLARELHPDK---SKSEEAGEL-FK 56

Query: 56 EITAAYEILSDPEKKSHYD 74
          ++  A+ IL+D ++K  YD
Sbjct: 57 KVAHAHFILTDKKEKMKYD 75

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
          of unknown function, contains a CSL Zn finger and a
          DnaJ-domain; involved in diphthamide biosynthesis;
          ortholog human Dph4
          Length = 172

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y++L + SDA+  EIK AYR   L  HPDK        V+ +   +I  AY+ILS+ + +
Sbjct: 10 YEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKTR 69

Query: 71 SHYD 74
            YD
Sbjct: 70 REYD 73

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y VLG+  DA   EIK AY KLA K+HPD   D+ S +    KF +IT AYEILSD +KK
Sbjct: 49  YKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKGSDK----KFHDITNAYEILSDEKKK 104

Query: 71  SHYDLYG 77
             YD +G
Sbjct: 105 MQYDQFG 111

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 103/250 (41%), Gaps = 48/250 (19%)

Query: 138 LTVKDLYMGKK-LKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRF 196
           L+ KD   G + +   +     C  C GSG K       +H  EC SC G G+   + R 
Sbjct: 203 LSFKDAVFGSRNVTLNVSSIEQCKTCTGSGMKPG-----SHRSECSSCHGTGTTVHV-RA 256

Query: 197 GPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQSK--KEIITVNVAPGHHFN 254
           G  + +    TC  C G G+ + R    ++ C +C G G + +  +  + V + PG    
Sbjct: 257 GFQMAS----TCMSCGGTGENIAR----EDVCRNCDGEGTEPRPVQRTVQVELPPGLVDG 308

Query: 255 DVITIKG--------MADEELD--KSACGDLKFHLVEKQENLEQKQIFLKNFDEGSAEDL 304
           DVI + G        +A E+ D  K   GDL   +  KQ+    K   ++N +E     L
Sbjct: 309 DVIRVAGQGGYPNIAIAPEQRDQVKVTRGDLLVRIRVKQD----KVFSIRNGNE-----L 359

Query: 305 YTSATISLSEALTGFEKXXXXXXXXXXXXXSIKPGRVIRPGDVIKITNEGWPIMDDPRGQ 364
           + +  I ++ A+ G                 ++ G   R G+ + +  +G      PRG+
Sbjct: 360 WQTREIPVTTAVLG-GNVVIPTLDGNQLRLRVRSG--TRDGETVSVPGQGV-----PRGR 411

Query: 365 ----RGDLYV 370
               RGD+ V
Sbjct: 412 GGLSRGDMKV 421

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y+ LGV+ DAS  +IK AY KLA K+HPD     N  E  E KF ++  AYEILSD  K+
Sbjct: 53  YETLGVSRDASTSQIKKAYYKLAKKYHPDI----NKDEGAEKKFHDLQNAYEILSDESKR 108

Query: 71  SHYDLYG 77
           S YD +G
Sbjct: 109 SQYDQFG 115

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 30/77 (38%), Gaps = 12/77 (15%)

Query: 146 GKKLKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLKRFGPGLVASQW 205
           G  LK   KR   C +CHG+G ++  +        C  C G+GS  R           + 
Sbjct: 224 GSGLKSGAKRS-SCSICHGTGTQMHVRAGFQMASTCTQCNGEGSSIR-----------RS 271

Query: 206 VTCEKCHGKGKYVKRPK 222
             C  C G+G    R K
Sbjct: 272 DQCSSCRGEGVVFNRQK 288

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 45/70 (64%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYEILSDP 67
           Y +L V++ ++ +EI++AYRKL++K HPDK    +  N + + E ++  IT AY+ L+D 
Sbjct: 119 YALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDE 178

Query: 68  EKKSHYDLYG 77
             + +Y  YG
Sbjct: 179 VTRENYLKYG 188

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDK--YVDQNSKEVNEIKFKEITAAYEILSDPE 68
           Y VLGV   A+ ++I+ +Y  +  K+HPDK   + +  K  N+ K  EI  AYEILSD  
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 69  KKSHYD 74
           K+  YD
Sbjct: 567 KRKEYD 572

>KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar
          to uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
          Protein required along with Dph1p Dph2p Kti11p and
          Dph5p for synthesis of diphthamide which is a modified
          histidine residue of translation elongation factor 2
          (Eft1p or Eft2p) contains a DnaJ-like domain,
          Length = 162

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 10 LYDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYEILSD 66
           Y++LG+ SDAS  EIK AYR + L+ HPDK     + N    +     +I  AY+ L D
Sbjct: 5  FYEILGIESDASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQTLID 64

Query: 67 PEKKSHYD 74
           + +  YD
Sbjct: 65 QDLRKKYD 72

>KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 607

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDK--YVDQNSKEVNEIKFKEITAAYEILSDPE 68
           Y VL VT  A+ ++I+ +Y  +  K+HPDK   + ++ K  N+ +  EI  AYEILSD  
Sbjct: 505 YKVLEVTPQATSKDIRKSYLSMTRKYHPDKQGQLSESQKLQNQERMSEINEAYEILSDEG 564

Query: 69  KKSHYD 74
           K+  YD
Sbjct: 565 KRKEYD 570

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 4/74 (5%)

Query: 5   DRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKY-VDQNSKE--VNEIKFKEITAAY 61
           D +   Y +LGV+  AS +EI+ AY  L  K+HPDK   + N K+  ++E    +I  AY
Sbjct: 534 DPKKDYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHET-MSQINEAY 592

Query: 62  EILSDPEKKSHYDL 75
           E LSD +K+  YDL
Sbjct: 593 ETLSDDDKRKEYDL 606

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 41/68 (60%), Gaps = 4/68 (5%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKY-VDQNSKE--VNEIKFKEITAAYEILSDP 67
           Y VLGV   A+ +EI+ AY  L  K+HPDK   + N KE  ++E    +I  AYE LSD 
Sbjct: 537 YKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHET-MSQINEAYETLSDD 595

Query: 68  EKKSHYDL 75
           +K+  YDL
Sbjct: 596 DKRKEYDL 603

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 46/79 (58%), Gaps = 6/79 (7%)

Query: 5  DRRYQLYDVLGVTSDASV---QEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAY 61
          + +  LYD+LG  ++ S     EIK  YR LALK+HPDK    N   + E KF +IT A 
Sbjct: 10 ENKVNLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDK--TPNDLTLVE-KFHKITIAL 66

Query: 62 EILSDPEKKSHYDLYGDDY 80
           IL++ + K+ YD + + Y
Sbjct: 67 NILTNNQLKTEYDKWLNSY 85

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 44/70 (62%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYEILSDP 67
           Y +LGV + A+ +E+++AYRKL++K HPDK    + Q  +   E ++  IT AY+ L+D 
Sbjct: 118 YTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

Query: 68  EKKSHYDLYG 77
             K +Y  +G
Sbjct: 178 ITKENYLKFG 187

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (59%), Gaps = 4/77 (5%)

Query: 2   SGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKY-VDQNSKE--VNEIKFKEIT 58
           S  D +   Y +LGV+ +A+ +EI+ AY  L  K+HPDK   + N K+  ++E    +I 
Sbjct: 535 SSYDPKKDYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHET-MSQIN 593

Query: 59  AAYEILSDPEKKSHYDL 75
            AYE LSD +K+  YDL
Sbjct: 594 EAYETLSDEDKRKEYDL 610

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          YD+LGV   A+  EIK AYRK ++  HPDK  D  +      +F+ I+ AY++LS+ + +
Sbjct: 8  YDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATE---RFQSISEAYQVLSNKDLR 64

Query: 71 SHYDLYG 77
          ++YD  G
Sbjct: 65 ANYDKSG 71

>YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON}
          JJJ2Protein of unknown function, contains a J-domain,
          which is a region with homology to the E. coli DnaJ
          protein
          Length = 583

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%), Gaps = 4/68 (5%)

Query: 7  RYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSD 66
          R   Y +LG+TS+A+  E+  +Y KLA   HPDK     S+E+    FK +  A+ IL+D
Sbjct: 11 RTTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEEL----FKAVVHAHSILTD 66

Query: 67 PEKKSHYD 74
           ++K  YD
Sbjct: 67 EDQKLRYD 74

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+TSDA+  +IK AYRK+A+  HPDK    ++ E+    FK ++ A  +L D E++
Sbjct: 14 YSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSAAEL----FKLVSHAQSVLIDKEQR 69

Query: 71 SHYD 74
            Y+
Sbjct: 70 QSYN 73

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 44/70 (62%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYEILSDP 67
           Y++L V S A+ +EI++AYRKL++K HPDK    +    + V E ++  IT AY+ L+D 
Sbjct: 117 YELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALTDD 176

Query: 68  EKKSHYDLYG 77
             + ++  YG
Sbjct: 177 ATRDNFLRYG 186

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 42/67 (62%), Gaps = 3/67 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNS---KEVNEIKFKEITAAYEILSDP 67
           Y +LG+  +AS +EI+ AY  L  K+HPDK   Q S   ++ N+ K  EI  AYE+L+D 
Sbjct: 543 YQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLNDE 602

Query: 68  EKKSHYD 74
           EK+  YD
Sbjct: 603 EKRKEYD 609

>NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON}
          Anc_1.113 YJR097W
          Length = 174

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 2  SGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKE---VNEIKFKEIT 58
          + ++ R   YD+L V SDAS Q+IK AY++  L  HPDK           ++ +   +I 
Sbjct: 4  TTTNNRLNHYDILSVPSDASQQDIKRAYKERLLNIHPDKSSSSADSPPPTISHVTVNQIQ 63

Query: 59 AAYEILSDPEKKSHYDL 75
           AY ILS PE ++ YD+
Sbjct: 64 EAYRILSKPESRTKYDM 80

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 43/77 (55%), Gaps = 4/77 (5%)

Query: 2   SGSDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKY-VDQNSKE--VNEIKFKEIT 58
           S  D +   Y  LGVT  A+ +EI+ AY  L  K+HPDK   + N K+  ++E    +I 
Sbjct: 531 SSYDPKKDYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHET-MSQIN 589

Query: 59  AAYEILSDPEKKSHYDL 75
            AYE LSD  K+  YDL
Sbjct: 590 EAYEALSDDNKRKEYDL 606

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 45/70 (64%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYEILSDP 67
           Y +L +++ ++ +EI++AYRKL++K HPDK    +  + + V E ++  IT AY+ L+D 
Sbjct: 117 YALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALTDE 176

Query: 68  EKKSHYDLYG 77
             + +Y  YG
Sbjct: 177 ITRENYLRYG 186

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 5/70 (7%)

Query: 10  LYDVLGVTS----DASVQEIKTAYRKLALKHHPDKYVD-QNSKEVNEIKFKEITAAYEIL 64
           LYDVLG+ S    + +V+E+K  Y+KL L++HPDK V           +F  + +A++IL
Sbjct: 83  LYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVASRFHSLRSAFQIL 142

Query: 65  SDPEKKSHYD 74
            D   ++ YD
Sbjct: 143 CDSSLRTQYD 152

>Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to
          Ashbya gossypii AFR639W
          Length = 156

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y VLG+ SDA    IK AYR+  L+ HPDK   Q S E   +   ++  AY +L D E +
Sbjct: 6  YSVLGIDSDADSDTIKKAYRRRLLETHPDK--KQISNE--SLSVDQLQKAYRVLIDKELR 61

Query: 71 SHYD 74
          + YD
Sbjct: 62 AKYD 65

>CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some
          similarities with uniprot|P46997 Saccharomyces
          cerevisiae YJL162c
          Length = 455

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LGV ++AS  EI+ +Y KLA K HPDK   +++ E+    FK +  A+ IL++ + +
Sbjct: 14 YSILGVPTNASTNEIRKSYMKLAKKLHPDKTKSEHTAEL----FKLVVDAHSILNNDQLR 69

Query: 71 SHYD 74
          + YD
Sbjct: 70 AEYD 73

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 20/128 (15%)

Query: 138 LTVKDLYMGKK---LKFELKRQIVCMVCHGSGWKLKKKIHVTHEVECESCGGKGSKERLK 194
           +  KD   G K   L+F +     C VCHGSG  LKK    +    C SC G G+   ++
Sbjct: 180 MKFKDAVFGAKNANLQFSVLDP--CGVCHGSG--LKKNAQSS---TCPSCHGTGTTVHVR 232

Query: 195 RFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAGVGLQ-SKKEIITVNVAPGHHF 253
             G   +AS   TC +C G+G  V+    P++ C  C G G++ + +  I+V++  G   
Sbjct: 233 --GGFQMAS---TCNQCGGEGTTVR----PEDVCSKCHGEGVELNSQRSISVDLPQGLQD 283

Query: 254 NDVITIKG 261
            DV+ + G
Sbjct: 284 GDVVRVPG 291

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
           Y+ LGV  +AS  EIK AY KLA K HPD   + N+    E KF ++  AYEILSD  KK
Sbjct: 38  YETLGVGKNASSSEIKKAYYKLAKKFHPDINKEPNA----EAKFHDLQNAYEILSDDTKK 93

Query: 71  SHYDLYG 77
             YD +G
Sbjct: 94  QQYDQFG 100

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKY---VDQNSKEVNEIKFKEITAAYEILSDP 67
           YD+LG++S +S ++IK+AYRKL++K HPDK    +  + + V E K+ +IT AYE L+D 
Sbjct: 124 YDILGISSSSSDKDIKSAYRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKAYEALTDE 183

Query: 68  EKKSHYDLYG 77
             + +Y  YG
Sbjct: 184 TVRENYLKYG 193

>KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa]
          {ON} Anc_1.185 YJL162C
          Length = 555

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 4/64 (6%)

Query: 11 YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70
          Y +LG+T +A+  EI+ +Y  LA K HPDK   + + E+    FK +  A+ IL+D EKK
Sbjct: 15 YSILGLTPNATDIEIRKSYMNLARKLHPDKSKSEATGEL----FKLVVHAHSILTDVEKK 70

Query: 71 SHYD 74
            YD
Sbjct: 71 RAYD 74

>TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.297
           YJL073W
          Length = 604

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 4   SDRRYQLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEI--KFKEITAAY 61
           +DR Y  Y +LG+   A+ ++I+ AY     K+HPDK    + KE ++I  K  +I  AY
Sbjct: 491 TDRDY--YKILGLPKTATSKDIRRAYLDFTKKYHPDKQGQLSEKEESKIHEKMSQINEAY 548

Query: 62  EILSDPEKKSHYD 74
           E LSD  ++  YD
Sbjct: 549 ETLSDDTRRKEYD 561

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,894,004
Number of extensions: 2024627
Number of successful extensions: 5723
Number of sequences better than 10.0: 386
Number of HSP's gapped: 5233
Number of HSP's successfully gapped: 492
Length of query: 460
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 347
Effective length of database: 40,524,141
Effective search space: 14061876927
Effective search space used: 14061876927
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)