Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1478.261ON61361331910.0
YLR088W (GAA1)8.261ON61461429150.0
Skud_12.1568.261ON61261427780.0
Suva_10.1728.261ON61461427660.0
TDEL0F038808.261ON57961318930.0
SAKL0H17050g8.261ON58461318920.0
ZYRO0C01672g8.261ON56961618500.0
TBLA0F030808.261ON58360818350.0
CAGL0L12232g8.261ON59161318200.0
AGR087C8.261ON57761218160.0
Kpol_543.378.261ON57861218080.0
NCAS0B038608.261ON58361118060.0
Ecym_43098.261ON57761217990.0
NDAI0J013908.261ON58360817870.0
KLLA0F19118g8.261ON57861417570.0
Kwal_56.238048.261ON57861617290.0
KLTH0G13706g8.261ON58459917270.0
KAFR0B055508.261ON55558417210.0
KNAG0H032508.261ON58561817190.0
TPHA0A018208.261ON58161616470.0
Kwal_27.11067singletonOFF7948750.22
TPHA0E014205.301ON111873715.8
Kwal_26.71547.86ON121340716.8
KAFR0C052205.500ON1499129699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.147
         (613 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...  1233   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...  1127   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...  1074   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...  1070   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   733   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   733   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   717   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   711   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   705   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   704   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   701   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   700   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   697   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   692   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   681   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   670   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   669   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   667   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   666   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   639   0.0  
Kwal_27.11067 s27 complement(625801..626040) [240 bp, 79 aa] {OF...    33   0.22 
TPHA0E01420 Chr5 complement(287481..290837) [3357 bp, 1118 aa] {...    32   5.8  
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    32   6.8  
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    31   9.6  

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score = 1233 bits (3191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/613 (98%), Positives = 604/613 (98%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
           PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV
Sbjct: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
           AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420
           AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL
Sbjct: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420

Query: 421 LMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLAF 480
           LMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLAF
Sbjct: 421 LMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLAF 480

Query: 481 PMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXXXX 540
           PMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQE        
Sbjct: 481 PMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLLLV 540

Query: 541 XTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSFE 600
            TNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSFE
Sbjct: 541 LTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSFE 600

Query: 601 SKRVMLKSKEKQS 613
           SKRVMLKSKEKQS
Sbjct: 601 SKRVMLKSKEKQS 613

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score = 1127 bits (2915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/614 (88%), Positives = 576/614 (93%), Gaps = 1/614 (0%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRRIVDMGLVPRIIA LPV+SM+CALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNILRGYRSQI+EMVNMTSMERNN+MGSWLQEFGTKTAIYENEQYGETL
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YGVMHAPRGDGTEAMVLAVPWFNSDD+FN+GGAALGVSLARFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
           P AALRSWVEAYHTSLDLTGGSIEAAVV+DYSS EDFFEYVEISYDGLNGELPNLDLVN+
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
           AISITEHEGMKVSLHGLP DQLT NN+WSRLK+LCLGIRDWAL+GVK PHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420
           AVALS+AFAISSLNAFINN YA+IS+FSEYNLVALLVWF+SLVISFVVSQ FLL+PS+GL
Sbjct: 361 AVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSSGL 420

Query: 421 LMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLAF 480
           LM ISM SCFLPLILS+K+HISEPLSYRLKNVAFLYFSLV TSLLMINFAMALLIGTLAF
Sbjct: 421 LMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480

Query: 481 PMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGK-SQQRQEXXXXXXX 539
           PMT VKTI+ESS EHEV+ +    IKTEPK+E EL+EN+ D  P    QQ+Q+       
Sbjct: 481 PMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLVLL 540

Query: 540 XXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSF 599
             TNPFISIT+FG FFDDEF GFD+INKLVSAWLDLKCWSWFVLCIGWLPCWLL+LASSF
Sbjct: 541 ILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILASSF 600

Query: 600 ESKRVMLKSKEKQS 613
           ESK V+++SKEKQS
Sbjct: 601 ESKSVVVRSKEKQS 614

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score = 1074 bits (2778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/614 (83%), Positives = 566/614 (92%), Gaps = 3/614 (0%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRRIVDMGLVPRIIA LPV+S +CALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWN+LRGYRSQIEEM NMTS ERNN MGSWLQEFGTKTAIYE++QYGETL
Sbjct: 61  SQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YGVMHAPRGDGTEAMVLA+PWFNSDD+FNVGGAALGVSLARFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
           P AALRSWVEAYHTSLDLTGGSIEAAVV+DYSSAEDFFEYVEISYDGLNGELPNLDLVN+
Sbjct: 181 PRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
           AISITEHEGMKVSLHGLP DQL  N++WSRLK+L LGIRDWAL+GVKNPHGNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHG+ GHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420
           AVA SVAFAISSLNAFINN YASIS+FSEYNLVALLVWFISLV+SF++SQ+FLL+PS GL
Sbjct: 361 AVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSVGL 420

Query: 421 LMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLAF 480
           LM IS+ +CFLPL+LS+KVHISEPLSYRLKNVAFLYFSLV TSLLMINFAMALLIG+LAF
Sbjct: 421 LMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSLAF 480

Query: 481 PMTLVKTI-IESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXXX 539
           PMT ++TI +  S EHE+  K + S+KTE ++  +L E++ D +  K+++RQ+       
Sbjct: 481 PMTFIRTIVVGKSTEHEMGTKSHTSVKTESRD--DLFEHHGDTVLEKAKKRQQLKNLLLL 538

Query: 540 XXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSF 599
             TNPFISIT+F   FD+EF GFD++NKL+SAWLDLKCW+WFVLCIGWLPCWLL+LASSF
Sbjct: 539 VLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598

Query: 600 ESKRVMLKSKEKQS 613
           ES+ V++KSKEKQS
Sbjct: 599 ESRSVVVKSKEKQS 612

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score = 1070 bits (2766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/614 (83%), Positives = 564/614 (91%), Gaps = 1/614 (0%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALLEKLHRR+VDMGLVPR+IA LPV+S +CALFGFISIAILPMDGQYRRTYISENALMP
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAILPMDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYRSQIEE VNMTS ERNN+MGSWLQEFGTKTAIYENEQYGETL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGETL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YGVMHAPRGDGTEAMVLA+PWFNS+ +FNVGGA+LGVSLARFFSRWPVWSKNII+VFSEN
Sbjct: 121 YGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSEN 180

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
           P AALRSWVEAYHTSLDLTGGSIEAAVV+DYSSAEDFFEYVE+SYDGLNGELPNLDLVNV
Sbjct: 181 PHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVNV 240

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
           AISI EHEGMKVSLHGLP +QL  N+++SRLK+LCLGIRDWAL+GVKNPHGNEAFSGWRI
Sbjct: 241 AISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           QSVTLKAHG+ GHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS
Sbjct: 301 QSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360

Query: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420
           AVALSVAFA+SSLNAFINN YASIS+FSEYNLVA+LVWFI++V+SFV+SQ+FL +  AGL
Sbjct: 361 AVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPAGL 420

Query: 421 LMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLAF 480
           LM IS+  CFLP+ LS KVHISEPLSYRLKNVAFLYFSLV TSLLMINFAMALLIGTLAF
Sbjct: 421 LMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTLAF 480

Query: 481 PMTLVKTI-IESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXXX 539
           PMT +KTI +E   E E   +  ISIKTEP +ET+L ++Y++    K+QQRQ+       
Sbjct: 481 PMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLLLL 540

Query: 540 XXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSF 599
             TNPFISIT+FG  FDDEFQGFD+INKLVSAW+DLKCWSWF+LC+GWLPCWLL+LASSF
Sbjct: 541 ILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILASSF 600

Query: 600 ESKRVMLKSKEKQS 613
           ESK V++KSKEKQS
Sbjct: 601 ESKSVVVKSKEKQS 614

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/613 (57%), Positives = 464/613 (75%), Gaps = 37/613 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           M+L+ KLHRR++D+GLVP+I+A+LP++SM+ A+     +A+LP++G+YRRTYISENAL+P
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLALLPLEGRYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWN LRGYR+QIE + N TS ERN  +  WL+EFG KTAIY++E++G+TL
Sbjct: 61  SQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YGV+HA RGDGTEA++LA PW N+D   N+ G ++G++L RFFSRWPVWSKNII+V SEN
Sbjct: 121 YGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSEN 180

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
           P  ++RSWVEAYHTSLDLTGGSIEAAVV+DY    D+F++VEI YDGLNGE PNLDLVN+
Sbjct: 181 PKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
           AISITEHEGMKVSLHG+  D+++ N++WSRL ++  GI++ AL+G++  +GNEAFSGWRI
Sbjct: 241 AISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           Q+VTLKAHG  G HD+TTFGRIPEAMFRSINNLLEKFHQSFFFY+LLAPR FVSISSYLP
Sbjct: 301 QAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYLP 360

Query: 360 SAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAG 419
            AV LS++FA++SL+A INN Y  + + S YNL++L +W ISL+  F ++Q+FL   +  
Sbjct: 361 CAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAPT 420

Query: 420 LLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLA 479
           +L++ S +  FLPL+L KK  I+EPL+YRLK+VAFL+FSLVLTSLLM+NF +A  +G  A
Sbjct: 421 ILISFSALISFLPLLLKKK--IAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 480 FPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXXX 539
           FPMTLV+T          S+    S++ + K    L+                       
Sbjct: 479 FPMTLVRT----------SSLNNYSLRIKLKNSILLL----------------------- 505

Query: 540 XXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSF 599
             +NPFI+  IF   F+ +  GF V  +  +AW +L CW+WFV+CIGWLP WL+V  S+ 
Sbjct: 506 -LSNPFIASYIFCQCFEPDLPGFTVFTEFATAWKELGCWTWFVICIGWLPSWLMVALSTL 564

Query: 600 ESKRVMLKSKEKQ 612
            ++   L  ++K+
Sbjct: 565 NTQPAQLDDRKKK 577

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/613 (59%), Positives = 458/613 (74%), Gaps = 40/613 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MAL+EKLHRR +DMGL+P+ IA LP +S+ CA+ G   +A+ +P DGQ+RRTYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRE+EWN+LRGYR+QIE     ++ ERN  + SWLQ+FG KTAIY NE+YGET
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSE 179
           LYG++HAPRGDGTEAMVLA PW+NS++++N GG AL VSL+RFFSRWPVWSKNIIIV SE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 180 NPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239
           +P AALRSWVEAYHTSLDLTGGSIEAAVV+D+  + DFF+YVEI +DGLNGELPNLDLVN
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 240 VAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWR 299
           VA+ ITEHEGMKVSLHG+  ++L  N+++SR+K + LG+++ AL+G+K  HGNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           I SVTLKA G  G  DITTFGRIPEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418
           P+AVALSV+FA++SLN  +NN Y S+ + S YN+ ALL + ++L +SF+ +Q FL  P  
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478
            LL++++++   +P+I + +V I  P SYRLK+ A+LYFS+VLTSLL++NF++A  +G L
Sbjct: 421 ELLLSLNVLLLLMPIIFT-RVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCL 479

Query: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXX 538
           AFPMTLV+T   +SG      K  + +                                 
Sbjct: 480 AFPMTLVRT---TSGNLRARLKNCVLL--------------------------------- 503

Query: 539 XXXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASS 598
              +NPFI+I +F    D E QG  V   L SAW DL CW+WFV+CIGWLP WLLV  S 
Sbjct: 504 -LISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDLGCWTWFVICIGWLPSWLLVAYSG 562

Query: 599 FESKRVMLKSKEK 611
            +S  +++   EK
Sbjct: 563 IDSVSIVVPQDEK 575

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/616 (57%), Positives = 450/616 (73%), Gaps = 51/616 (8%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           MAL+E+L RR+V+MGLVP+IIA LP+VSM+CA+   + +A LP++GQ+RRTYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNILRGYRSQIE    +++ ERN  M  WLQEFG KT+IY NE+YG++L
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDSL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YG++HA RGDGTEA++LAVPW+N++   NVGGA+LG+SL+RFFSRWPVWSKNIIIVFSEN
Sbjct: 121 YGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSEN 180

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
           P  ALRSWV+AYHTSLDLTGGSIEAA+V+DY    D+F+Y EISY GLNGELPNLDLVN+
Sbjct: 181 PNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
           A+SITEHEG+ VSLHG+  + +   +YWSRLK+L  GI   A AG++   GNEAFSGWRI
Sbjct: 241 AVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSG--HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           QSVT+KAHG  G  +DITTFGRIPEAMFRSINNLLEKFHQS+FFY+L+APR FVSISSYL
Sbjct: 301 QSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSYL 360

Query: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418
           P+ V L+  FA++SLN+ + N Y+++S +S YNL ALL W +S+++SFV SQ+FL +PS 
Sbjct: 361 PATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPST 420

Query: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478
            LL+A  ++   LPL   +   I+EPLS+RL+  AFLY SLV+TSL+M+NF +A ++G L
Sbjct: 421 ILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGIL 480

Query: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXX 538
           AFPMT V T      +  ++ K Y                                    
Sbjct: 481 AFPMTAVGT------QRSLTFKKY----------------------------------AL 500

Query: 539 XXXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASS 598
              +NP +S  I             ++ KL+SAW DL CW+WFVLC+GWLP W L+  S+
Sbjct: 501 LIISNPLVSFFIVKPH-------PQLLQKLISAWQDLGCWTWFVLCLGWLPSWTLIALSA 553

Query: 599 FESKRV--MLKSKEKQ 612
             S  +  +  SK++Q
Sbjct: 554 CSSTNLDPVATSKKEQ 569

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/608 (58%), Positives = 453/608 (74%), Gaps = 38/608 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           MALL  +HRR++DMGLVP+I+  LP+VS+  A  G +   +LPMDGQYR TYISENALMP
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIVLFLMLPMDGQYRHTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNILRGYR++I+   +M S +RN +M  WL+EFGTKT++Y N++YG+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YG+ +APRGDGTEA+VLA+PW+N+D +FN GGAALG++L+RFFSRWP+WSKNII+VFSEN
Sbjct: 121 YGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSEN 180

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
           P  ALRSWV+AYH SLDLTGGSIEAA+V+DY S+ DFF+YVEI Y G+NGELPNLDL+N+
Sbjct: 181 PDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLNI 240

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
           AI ITEHEGM+VSLHGLP + L  NNY+SRL+ L LG +D  L+G+K  HGNEAFSG+RI
Sbjct: 241 AIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFRI 300

Query: 301 QSVTLKAH---GNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           Q++TLKA     N+ HDIT+FGRI EA FRS+NNLLEKFHQSFFFYL+LAP+ FVSISSY
Sbjct: 301 QAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISSY 360

Query: 358 LPSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPS 417
           LPSAV  SVAFAISSL+++INN+Y+++ IFSEYNL+A L++ IS+  SF V+++ LL   
Sbjct: 361 LPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFTE 420

Query: 418 AGLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGT 477
             LL+  S+    LP +L  +  I EPLSYRLK++AFLY SLVLTSLL++NF++A  IG 
Sbjct: 421 PRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIGI 480

Query: 478 LAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXX 537
           L F MT VKTI   S           S++   +    L+                     
Sbjct: 481 LGFAMTAVKTITIHS-----------SMRVRVRNTMHLL--------------------- 508

Query: 538 XXXXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLAS 597
               +NPF S+ +F   FD +  G  +  + + +W  L CW+WF++C+GWLP W+LV  S
Sbjct: 509 ---LSNPFTSVLLFTYIFDKDIYGIKIFYEFIHSWNTLNCWTWFIICVGWLPPWILVSIS 565

Query: 598 SFESKRVM 605
           S ++  VM
Sbjct: 566 SIQTNTVM 573

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/613 (57%), Positives = 465/613 (75%), Gaps = 36/613 (5%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           M+LL+K++RR+ + G + +++  LP VS +  +   + +AILP+DGQYRRTYISENALMP
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIVLLAILPLDGQYRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYRSQIE + + +  +RN ++  WLQE G KTA+YE+E++G+TL
Sbjct: 61  SQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKTL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YGV+HA RGDGTEAMVLA+PW N DD+FN+GGAALGVSL++FF RWPVWSKNII+VFSE+
Sbjct: 121 YGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSED 180

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
             AALR+WV+AYHTSLDLT GSIEAAVV+DY S  DFFEYVEISYDGLNGELPNLDLVN+
Sbjct: 181 SGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
           A+SITEHEGMKVSLHGLP +++   +Y++RLK++ +GI++WAL+GVK  HGNEAFSGWRI
Sbjct: 241 AVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QSVTL+AHGN G  DIT FGRIPEAMFRS+NNLLEKFHQS+FFYLLLAPR FVSIS+YLP
Sbjct: 301 QSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYLP 360

Query: 360 SAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAG 419
           SAV +SVAFA+ SL++ INN Y SI   S   LV  ++   S+ +SF++S+V ++LP   
Sbjct: 361 SAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIVE 420

Query: 420 LLMAISMISCFLPLILSKK-VH-ISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGT 477
            L+  S+   FLPL++SKK +H I++ ++YRLK++  +Y+SL+LTSLLM+NFA+  +IG 
Sbjct: 421 SLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIGL 480

Query: 478 LAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXX 537
           LAFP+T +                 IS KT   E  + I     I+              
Sbjct: 481 LAFPLTKLAV---------------ISTKTIADESRKSILKNTFIL-------------- 511

Query: 538 XXXXTNPFISITIFGSFFDDEFQG-FDVI-NKLVSAWLDLKCWSWFVLCIGWLPCWLLVL 595
               TNPFIS+ +F +  D +F G F VI N+++++W  L CW+WF++C+GWLP WL+ +
Sbjct: 512 --FITNPFISLWLFTATMDTDFNGSFSVIYNRMITSWDTLGCWTWFIICLGWLPYWLISV 569

Query: 596 ASSFESKRVMLKS 608
            SS  S+ ++ ++
Sbjct: 570 ISSIPSQPIVERT 582

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/612 (55%), Positives = 445/612 (72%), Gaps = 39/612 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MA+LEKLHR++VDMGLVP+II SL  +S V  L     + + LPM+GQYRRTYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRESEWNILRGYRS+I+ M  +T+ ERN I+ SW++E+G K A+Y ++++GET
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSE 179
           LY V+HA RGDGTEAMVLA PW   + ++N GG AL V++ R+FSRWPVWSKNIIIV SE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 180 NPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239
           +P A+LRSWV+AYHT LDLTGGSIEAA+V+DY    D+F++VEISY+GLNG +PNLDL+N
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 240 VAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWR 299
           VA+ ITEHEGMKV+LHG P ++L  + Y+SR+++L  GI+D AL+G+K   GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 300 IQSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQSVTLKA G +G  DITTFGR+PEAMFRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418
           P+AV LS++FA+ + ++ +NN +AS+ + S YN+ ALL + ++L++S + ++VF  LP+ 
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478
            LL+A +++  F+P  L  K  I +P S+R K  A+LYFS VL+SLL++NF +A ++G L
Sbjct: 421 ALLLAFNVVVSFMPFALV-KYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479

Query: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXX 538
           AFPMT V+T + +S                                     RQ+      
Sbjct: 480 AFPMTFVRTTVHAS------------------------------------VRQKMKNSLL 503

Query: 539 XXXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASS 598
              +NPFISI +F   F+ E  GF V   L+ AW DL CW+W+VLC+GW P W++V  SS
Sbjct: 504 LLLSNPFISICVFVHLFEPELTGFSVFYSLIDAWNDLGCWTWYVLCLGWYPAWIMVAYSS 563

Query: 599 FESKRVMLKSKE 610
            +S  +   +K+
Sbjct: 564 IDSVPIAAPAKK 575

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/612 (54%), Positives = 446/612 (72%), Gaps = 36/612 (5%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           M++LE L RR++D GL+P+ +A+LP +SM+      + +  LPMDGQ+RRTYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYR +IE + + +S+ERN IM SWL+EFG KT++Y+N++YG++L
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDSL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YGV +APRGDGTE+MVLAVPW+N++D+FNV GAALGVSLARF SRWPVWSKNII+VFSEN
Sbjct: 121 YGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSEN 180

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
           P  ALRSWVEAYHTSLDLTGGSIEAAVV+DY    D+FEY+E+ Y+G NG LPNLDLVN+
Sbjct: 181 PREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVNI 240

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
           AISI EHEG+KVSLHGL  D++   +YWSRLK++ LG ++ AL GV+  +GNEAFSGWRI
Sbjct: 241 AISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           Q++TLKA G++ HD+TTFGR+ EAMFRSINNLLEKFHQSFFFY LLAPR FVSI SYLP+
Sbjct: 301 QALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYLPA 360

Query: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420
           AV LS++FA++S+++F+NN Y S+   S YNL++ + W +S+++ F +   F   P   L
Sbjct: 361 AVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQPLL 420

Query: 421 LMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLAF 480
           L+  +++   +PL   K + ISEPL+YRLK ++F+Y SLV+TSLL++NF +A  +G  A+
Sbjct: 421 LLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLFAY 480

Query: 481 PMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXXXX 540
           PMTLV                             ++ N +++       R +        
Sbjct: 481 PMTLV-----------------------------MLNNTDNL-------RLKTRNSILLA 504

Query: 541 XTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSFE 600
            +NPFI+  +F +  + +  G + I  LV AW  L  W+WF+ CIGW P W+LV  S+ +
Sbjct: 505 ISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNKLGSWTWFIFCIGWFPSWILVAISALK 564

Query: 601 SKRVMLKSKEKQ 612
            ++V  +   K+
Sbjct: 565 VEQVQTEPNSKK 576

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/611 (57%), Positives = 456/611 (74%), Gaps = 34/611 (5%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L E++ R+++  GL+P++I+ LP++S +C + G + I ILP +GQYR TYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNI+RGYRSQI E+ N +++ERN IM  WLQ+FGTKT IY+N + G+TL
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YGV HAPRGDGTE+MVLA+PWFN+D +FNV GAALGV+LAR+FSRWPVWSKNII+VF+EN
Sbjct: 121 YGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTEN 180

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
           P AALRSWVEAYHTSLDLTGGSIEAA+V+D++   D F+Y+EI YDGLNGELPNLD+VN+
Sbjct: 181 PKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVNI 240

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
            +   EHEGMKVSLHG P D++  +  +SRLK+L   I++ AL+GVK  +GNEAFSGWRI
Sbjct: 241 GVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWRI 300

Query: 301 QSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QSVTL+A G +G  D+T+FGR+PEAMFRSINNLLEKFHQSFFFYL+LAPR FVSISSYLP
Sbjct: 301 QSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYLP 360

Query: 360 SAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAG 419
           S VA+S+ FA++SLN++ NN Y ++  FS Y L+++L WF+SLV++F+VS +F+  P   
Sbjct: 361 STVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFPT 420

Query: 420 LLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLA 479
           +L+A+++I C  P IL     + + LSYRL++ AFL+ SL+LTSLLM+NF +A  +G L+
Sbjct: 421 ILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLLS 480

Query: 480 FPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXXX 539
           FPMT VKTI         S  P IS +T  K    L+                       
Sbjct: 481 FPMTQVKTI--------TSDTPTIS-RTRVKNSVLLL----------------------- 508

Query: 540 XXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASSF 599
             +NPFI+  +F    D+EF G DV  +LVSA  +L CW+W VLC+GW   WLLV  S+ 
Sbjct: 509 -VSNPFIATWLFSLLCDNEFSGLDVFERLVSASRELGCWTWLVLCVGWWTPWLLVAISAL 567

Query: 600 ESKRVMLKSKE 610
           ++ ++   S++
Sbjct: 568 DTVKLSNDSED 578

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/612 (55%), Positives = 437/612 (71%), Gaps = 39/612 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAI-LPMDGQYRRTYISENALM 59
           MA+LEKLHRRIVDMGLVPRIIASLP +S+ CAL     + + LP++GQYRRTYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRESEWNILRGYR ++E + ++   ERN I+ SW++E+G KT+I  N QYGET
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSE 179
           LYG++H  RGDGTEAMVLA PW  +D  +N GGAAL +SLAR+F+RWPVWSKNII+V S 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 180 NPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239
           +P A+LR+WV+AYHT LDLTGGSIE+AVV+DY    D+F+Y+EI Y+GLNG LPNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 240 VAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWR 299
            A+ I+EHEGMKVSLHG+P  +L+ + Y  RLK L  GI+D  LAG+KN  G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQSVTLKAHG  G  D+TTFGR+PEA+FRS+NNLLEKFHQSFFFYLLL+PR FVSI SYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418
           P+A+ALS +FAI+S ++ +NN Y+ + + S YN+ AL  + ++L+ISFV ++ F  +P  
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478
            LL+A ++   F+   +  K  I +P SYR K  A LYFS+VLTSLL++NFA+AL +G L
Sbjct: 421 SLLLAFNVALSFISFTV-IKYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVL 479

Query: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXX 538
           AFPM+L KT   ++                                     +Q+      
Sbjct: 480 AFPMSLTKTTTNAT------------------------------------MQQKLRNSLL 503

Query: 539 XXXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASS 598
              +NPFI+  I    F+ +  G  + + L+ AW  L CW+W+VLCIGW P W+LV  SS
Sbjct: 504 LMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQLGCWTWYVLCIGWYPSWILVAYSS 563

Query: 599 FESKRVMLKSKE 610
            +S  ++  SK+
Sbjct: 564 IDSIPIVTTSKK 575

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/608 (57%), Positives = 441/608 (72%), Gaps = 41/608 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           M LLE++ R IV  GL+P+I+A LP +S++      + IAILPMDGQYR TYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNI+RGYR+++  M N TS ERN IM SWL EFG KT IYEN    E L
Sbjct: 61  SQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NEVL 119

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YGV HAPRGDGTEA+VLAVPWFN D +FN  GAA+GV+LAR+FSRWPVWSKNII+VFSEN
Sbjct: 120 YGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSEN 179

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
           P +ALRSWVEAY+TSLDLTGGSIEAA+V+D     D+F+Y+E+ YDGLNGELPNLDLVN+
Sbjct: 180 PDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVNI 239

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
            I I EHEGM+VSLHG P DQ+  NNYW+RLK+L   I+  A +G+   HGNEAFSGWRI
Sbjct: 240 GIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWRI 299

Query: 301 QSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359
           QS+TLK  GNSG  DIT FGR+PEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP
Sbjct: 300 QSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLP 359

Query: 360 SAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAG 419
           SAV LSVAF I+ ++++INN   ++  FS Y L+  +VW ++LV  F+++Q+FL+LP   
Sbjct: 360 SAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIPS 419

Query: 420 LLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTLA 479
           LL+ I+++     +I+  K      +S RL++ AFL+ SL+LTSLLM+NF ++ +IG +A
Sbjct: 420 LLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLMA 479

Query: 480 FPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXXX 539
           FPMT V++               I+  T P+ + E I                       
Sbjct: 480 FPMTKVRS---------------ITANTAPQIKLENI--------------------ILL 504

Query: 540 XXTNPFISITIFGSFFDDE----FQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVL 595
             +NPFI++ I+ +   +      QG  VIN+L+SAW D++CW+WFVLC+GWLP W++V 
Sbjct: 505 MISNPFIALIIYNNVSSNSGLQGLQGLRVINRLISAWKDMRCWTWFVLCLGWLPSWIMVA 564

Query: 596 ASSFESKR 603
            S  E++R
Sbjct: 565 ISVIENER 572

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/614 (54%), Positives = 438/614 (71%), Gaps = 39/614 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIA-ILPMDGQYRRTYISENALM 59
           MAL+EKLHRRI+ +GL+P+ I+ L  +S++C + G   +  +LP DGQ+RRTYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNM-TSMERNNIMGSWLQEFGTKTAIYENEQYGE 118
           PSQAYSYFRESEWNILRGYR+Q++    + T+ + N  +  WLQEFG KTAIY++EQYGE
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 119 TLYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFS 178
           TLYG+ HAPRGDGTEAMV+A PW+N + ++N GGAAL +SL RFFSRWPVWSKNIIIV S
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 179 ENPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLV 238
           E+P A+LRSWV AYHTSLDLTGGSIE+A+V+DY    D F+Y+EI YDGLNGE PNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 239 NVAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGW 298
           NVA+ I EHEG+KVSLHGLP  +L  N+Y SRLK + LGI+D  L+G+KN +GNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 299 RIQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357
           RIQS+TLKA G  G HDITTFGR+PEA+ RS+NNLLEKFHQSFFFYLLLAPR F+SI +Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 358 LPSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPS 417
           L +AVA+SVAF  ++LN  +NN Y  + + S YN+ ++L + ISLV +F  SQ+F+  P 
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 418 AGLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGT 477
             +L+ +S I   LPL+   ++ I EP SYR K  A++Y ++VLTSLL++NF++A+++G 
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 478 LAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXX 537
           LAFPMT   TIIES            +++   K    LI                     
Sbjct: 481 LAFPMTRTTTIIES------------NLRLSIKNLVLLI--------------------- 507

Query: 538 XXXXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLAS 597
               +NPFI+     +F +    GF V   L+ A   L CW+W+++C+GW P WLLV  +
Sbjct: 508 ---ISNPFIATWAVVNFVEPRLSGFKVFYALIEASQQLGCWTWYIICLGWYPSWLLVTYA 564

Query: 598 SFESKRVMLKSKEK 611
           S ++  V    K++
Sbjct: 565 SIDAIEVQTPIKKE 578

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/616 (54%), Positives = 442/616 (71%), Gaps = 42/616 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFG-FISIAILPMDGQYRRTYISENALM 59
           MAL+E+L R+++D+GL+PRI+  LP +S++C + G F    +LP++GQYR TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRE+EWNILRGYR+QI+ + N +S+ERN I+GSWLQEFG KTA+YE+E  G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSE 179
           LYGV+HAPRGDGTEAMVL+ PWFN D +FN GG AL V+LAR+FSRWPVWSKNII+VFS+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 180 NPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239
           +P A+LRSWV+AYHTSLDLTGGSIE+AVV+DY    DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 VAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWR 299
           VAI +TEHEGMKVSL+G+P D++   +Y++R+K + +GI+  AL+GV+  +GNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQ+V L+A G+ G  DITTFGR+PEA+FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418
           P+AVA SV+F +++L+  +    ++       N+ A++ + ++L+ SF VS  F      
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478
            +L++ S+++   P++L+ +V I    ++RLK VA+LY S+VLTSLL++NFA+A  IG L
Sbjct: 421 VILISWSVMTALAPILLN-RVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLL 479

Query: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXX 538
           AFP+ LVK                    T P                    R        
Sbjct: 480 AFPLILVKN------------------STTP--------------------RLLFKNSLL 501

Query: 539 XXXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASS 598
              +NPFIS  +F  FF+    G  ++ +LV AW +  CW+W V+CIGWLP WLL+  SS
Sbjct: 502 LLLSNPFISTCLFAYFFEPLLPGLQILEQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYSS 561

Query: 599 FESK-RVMLKSKEKQS 613
             +    +L S EK+S
Sbjct: 562 MITDVSTLLNSAEKKS 577

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/599 (54%), Positives = 433/599 (72%), Gaps = 41/599 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAIL-PMDGQYRRTYISENALM 59
           MAL+EKL RRI+D+GL+PRI+  LP +S++C + G   + +L P++GQYR TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGET 119
           PSQAYSYFRE+EWNILRGYR+QI+ +   +S ERN ++ SW QEFG KTA YE++ +G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSE 179
           +YGV+HAPRGDGTEAMVLA PW+N D ++N+GGAAL  +L+RFFSRWPVWSKNIIIVFS+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 180 NPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239
           +P A+LRSWV AYHTSLDLTGGSIE+AVV+DY  + DFF+YVEI Y GLNGELPNLDLVN
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 240 VAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWR 299
           VA+ ITEHEGMKVSL+G+  +++   NY+S++K + +G++  AL+GV++ +GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 300 IQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           IQ++ L+A G  G  DITTFGRIPEA FRS+NNLLEKFHQSFFFYLLLAPR FVSI+SYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418
           P+AVA SV+F +++L+  + +  ++   FS +NL A++ + ++L++SF +S +F     +
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478
            LL++ + +   LP I  ++  I    SY+ K+VAFLY S+VLTSLL+INFA+A  IG L
Sbjct: 421 SLLISCNAVIAVLPAIFGRQ-GIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLL 479

Query: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXXX 538
           AFP+ LVK  + S                                      RQ       
Sbjct: 480 AFPLILVKAPMTS--------------------------------------RQRVKNTIL 501

Query: 539 XXXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLAS 597
              +NPFIS  +F + F+ +  G  + ++LV AW  L CW+W V+CIGWLP WLLV  S
Sbjct: 502 LILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKLGCWTWSVVCIGWLPSWLLVACS 560

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/584 (58%), Positives = 424/584 (72%), Gaps = 43/584 (7%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L+E++ R++  MGLVP++   LP+ S + AL   ISIAILP+DGQYR TYISENALMP
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLISIAILPIDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRE+EWNILRGYR+Q+E MV++   ERN+IM +WL + G KT  + N     T+
Sbjct: 61  SQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----TI 116

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YG+ H+PRGDGTEA+VLA+PW NS+ +FN GGAALGVSLARFF RWP+WSKNII+VFSE+
Sbjct: 117 YGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSED 176

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
             A+LRSWVEAYHTSLDLTGGSIEAAV++DY+S  DFF+YVEI YDGLNGELPNLDLVN+
Sbjct: 177 TGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVNI 236

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
           A+SITEHEGMKVSLHGLP ++L   + WSR K+L   I+D +LAG+K PHGNEAFSGWRI
Sbjct: 237 AVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWRI 296

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           Q++TLKA G  G DITTFGRIPEAMFRSINNLLEKFHQSFF+YLLLAPR FVSISSYLP+
Sbjct: 297 QALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYLPA 356

Query: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420
           AV LS+AFA SSL  F+N+   SI   S Y L A++VWF+S+  SF  +  +L      +
Sbjct: 357 AVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFPVM 416

Query: 421 LMAISMISCFLPLILSKKVHISE---PLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGT 477
           LM I ++  F+PLI S+ + ++E    +++R+K  AF YFSLVLTSLLMINF +AL IG 
Sbjct: 417 LMFICILFSFIPLI-SRGLPLAETKITVAHRMKAFAFGYFSLVLTSLLMINFPLALTIGV 475

Query: 478 LAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXX 537
           LAFPMTLVK                                  + +P  SQ  +      
Sbjct: 476 LAFPMTLVKI--------------------------------SNTLPTSSQALKN---SM 500

Query: 538 XXXXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWF 581
               +NP+ISI  F + FD E  G   +++L+ AW D+ CW+WF
Sbjct: 501 LLLVSNPYISICAFSNIFDSELTGLATLDRLIPAWNDMNCWTWF 544

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/618 (55%), Positives = 444/618 (71%), Gaps = 39/618 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           M L E L R+ V +GL+P+++A+LP++S + A+   + I I+PM+GQYR TYISENALMP
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEM--VNMTSMERNNIMGSWLQEFGTKTAIYENEQYGE 118
           SQAYSYFRE+EWNILRGYR++IE +    +++ +R +I+  WL EFG KTA+Y NE+ G+
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 119 TLYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFS 178
           TLYGV+HAPRGDGTEAMVL  PW NS+ +FN+GG+AL ++L+R+FSRWPVWSKNII+VFS
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 179 ENPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLV 238
           +NP  ALRSWVEAYHTSLDLTGGSIEAAV++DY S  D+F Y EI ++GLNGELPNLDLV
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 239 NVAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGW 298
           NVA+ IT+HEGMKVSLHGLP  +L  NNYWSRLK+L LG++D  LAG+K  HGNE FSGW
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 299 RIQSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358
           RIQ+VTLKA G    DITTFGRIPEAMFRSINNLLEKFHQSFFFY LL+P  FVSISSYL
Sbjct: 301 RIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSYL 360

Query: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418
           PSAV LS+ FAI++++A +NN YAS ++   Y L+A L   ISL++SF+V+  FL   ++
Sbjct: 361 PSAVLLSITFAIAAVDATVNNAYAS-ALHITYTLLAALASVISLLVSFLVAHWFLYSTTS 419

Query: 419 GLLMAI-SMISCFLPLILSKKVH-ISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIG 476
            L + + S++    PL++S+  + + EP+ YR++ + ++Y+SL+LTSLLM+NF +A  IG
Sbjct: 420 PLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFSIG 479

Query: 477 TLAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXX 536
              +PMTLVK +   S                                 KSQ   +    
Sbjct: 480 LFGYPMTLVKPLNIYS---------------------------------KSQMSLKLRNS 506

Query: 537 XXXXXTNPFISITIFGSFFDD-EFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVL 595
                +NPF++  +  +  ++ EF   DV   L SAW DL CW+WFVLC+GWLP WLLV 
Sbjct: 507 VLLVISNPFVATWLICTVVENSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVT 566

Query: 596 ASSFESKRVMLKSKEKQS 613
            SSF S      + EK+S
Sbjct: 567 FSSFTSIPAAETTIEKKS 584

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/616 (50%), Positives = 436/616 (70%), Gaps = 39/616 (6%)

Query: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAILPMDGQYRRTYISENALMP 60
           MAL+E LHRR   +GL+P++I  L +VS +  L     I  LP+DGQYRRTYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGETL 120
           SQAYSYFRESEWNILRGYR+ IE +++  +  RN ++ SWL +FG K A+Y+N   G+TL
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDTL 120

Query: 121 YGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSEN 180
           YGV ++ RGDGTEA+VLAVPW+N+D++ N+GGAALG+SL+R+FSRWP+WSKNII+V SEN
Sbjct: 121 YGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISEN 180

Query: 181 PCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVNV 240
           P  A++SWV+AYH SLDLTGGS+EAA+V+D+ S  ++FE+VE+ ++G+NGELPNLD+VNV
Sbjct: 181 PHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVNV 240

Query: 241 AISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWRI 300
           AIS+ EHEG+KVSL GL L ++  ++Y++RLK L  G+++ AL+G +  +GNEAFSG RI
Sbjct: 241 AISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRRI 300

Query: 301 QSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYLPS 360
           Q++TLKA G  GHDITTFGRIPEA+FRS+NNLLEKFHQSFFFY L+APR FVSI SYLPS
Sbjct: 301 QALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYLPS 360

Query: 361 AVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSAGL 420
           AV LS++F IS+ +++INN Y ++ +    +++AL+++F S+ ISF+  Q+        L
Sbjct: 361 AVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQPHL 420

Query: 421 LMAISMISCFLPL--ILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478
           ++   ++  FLPL  I    + I   LSYRLK+ AF+Y SLVLTSLL++NFA+A  +G L
Sbjct: 421 MILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMGLL 480

Query: 479 AFPMTLVKTIIES-SGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQEXXXXX 537
           AFP+T  K+  E  + + +V    Y++I                                
Sbjct: 481 AFPLTFTKSCSEMITFKSKVINCFYLAI-------------------------------- 508

Query: 538 XXXXTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLAS 597
               +NPFI+I IF S F+D+   F+V + L+S++  +  W+W + CIGW   W +V  +
Sbjct: 509 ----SNPFIAIFIFVSIFEDDITNFEVFSDLISSFKYMGNWTWAITCIGWFTTWQMVYIA 564

Query: 598 SFESKRVMLKSKEKQS 613
           + ++ R  L    K++
Sbjct: 565 NLDTPRSALDGDTKKN 580

>Kwal_27.11067 s27 complement(625801..626040) [240 bp, 79 aa] {OFF}
           [contig 31] FULL
          Length = 79

 Score = 33.5 bits (75), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 463 SLLMINFAMALLIGTLAFPMTLVKT--IIESSGEHEVSAKPYISIKTE 508
           ++L ++FA  LLI  +A PMT + T  II+ +  H  SA P IS   E
Sbjct: 32  AILTLHFACILLILNMAIPMTEIMTVAIIQKTPSHRSSALPKISFCRE 79

>TPHA0E01420 Chr5 complement(287481..290837) [3357 bp, 1118 aa] {ON}
           Anc_5.301 YDR291W
          Length = 1118

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 2/73 (2%)

Query: 44  MDGQYRR--TYISENALMPSQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWL 101
           +DG  ++  T ISEN   P+  YS+F      +       +++M+N   +  NN +  ++
Sbjct: 147 IDGNMKKNWTTISENLNDPNNKYSHFNNYAKKVFHYSSEDLKKMINKRELHFNNRLIDFI 206

Query: 102 QEFGTKTAIYENE 114
            +   K    ENE
Sbjct: 207 NKCTEKNLNPENE 219

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 5/40 (12%)

Query: 216  DFFE-----YVEISYDGLNGELPNLDLVNVAISITEHEGM 250
            DFFE     Y+E +  G +G +   DL+ +   +TEHE M
Sbjct: 1026 DFFEDDDYYYIETAVHGTSGSIDLFDLIEMKTDMTEHEAM 1065

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON}
           Anc_5.500 YDR406W
          Length = 1499

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 57/129 (44%), Gaps = 33/129 (25%)

Query: 325 MFRSINNLLEKF-----------HQSFFFYLLLAPRQFVSISSYLPSAVALSVAFAISSL 373
           +F S + LLE F           H+++  Y   A   F SI S LP+ + +SV F I  +
Sbjct: 550 LFNSFSCLLEIFTLYEARPVSEKHRAYSLYHPSAD-AFASIFSELPNKIVISVVFNI--I 606

Query: 374 NAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVF------------LLLPSAGLL 421
             F+ N   +   F          W ISLV  F +S +F             ++P++ LL
Sbjct: 607 YYFMVNFRRTAGAF-------FFYWLISLVGVFAMSHLFRTVGSLTKTLSEAMVPASILL 659

Query: 422 MAISMISCF 430
           +++SM + F
Sbjct: 660 LSMSMYAGF 668

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,143,763
Number of extensions: 2529083
Number of successful extensions: 6766
Number of sequences better than 10.0: 42
Number of HSP's gapped: 6927
Number of HSP's successfully gapped: 55
Length of query: 613
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 497
Effective length of database: 40,180,143
Effective search space: 19969531071
Effective search space used: 19969531071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)