Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1468.260ON29582958154890.0
YLR087C (CSF1)8.260ON29582958144460.0
Skud_12.1558.260ON29592959142750.0
Suva_10.1718.260ON29582959139890.0
NCAS0B050108.260ON2952297190920.0
NDAI0B019808.260ON2959297388060.0
KAFR0B027208.260ON2982300384290.0
CAGL0L12210g8.260ON2981300483130.0
KNAG0G020308.260ON2998302581650.0
TDEL0F038708.260ON2942298279100.0
ZYRO0C01694g8.260ON3006304371960.0
Kpol_392.78.260ON2995302669840.0
TBLA0E044208.260ON3148258062240.0
TPHA0J007308.260ON3046306460190.0
SAKL0H17072g8.260ON2997305657350.0
KLTH0G13728g8.260ON2966303350180.0
Kwal_YGOB_56.238088.260ON2941301249290.0
Kwal_56.23810singletonOFF2763280445330.0
Ecym_43108.260ON2943160523990.0
AGR088W8.260ON2887150821290.0
KLLA0F19096g8.260ON2923159020890.0
Kwal_56.23808singletonOFF62601584e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.146
         (2958 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  5970   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  5569   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  5503   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  5393   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  3506   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  3396   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  3251   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  3206   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  3149   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  3051   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2776   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  2694   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2402   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2323   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  2213   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1937   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1903   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1750   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   928   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   824   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   809   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    65   4e-12

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 5970 bits (15489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2898/2958 (97%), Positives = 2898/2958 (97%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120
            KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120

Query: 121  SKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
            SKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG
Sbjct: 121  SKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNK 240

Query: 241  FTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL
Sbjct: 241  FTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKAND 360
            DTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKAND
Sbjct: 301  DTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKAND 360

Query: 361  LDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPP 420
            LDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPP
Sbjct: 361  LDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPP 420

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIS 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIS
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIS 480

Query: 481  ITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 540
            ITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF
Sbjct: 481  ITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 540

Query: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600
            QNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL
Sbjct: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600

Query: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 661  CYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 721  AYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            AYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV
Sbjct: 721  AYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 781  TSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPMKRSDLKRTTNE 840
            TSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPMKRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPMKRSDLKRTTNE 840

Query: 841  TDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHV 900
            TDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHV
Sbjct: 841  TDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHV 900

Query: 901  SKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDS 960
            SKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDS
Sbjct: 901  SKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDS 960

Query: 961  DVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSV 1020
            DVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSV
Sbjct: 961  DVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSV 1020

Query: 1021 ISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKLRFTNFEQY 1080
            ISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKLRFTNFEQY
Sbjct: 1021 ISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKLRFTNFEQY 1080

Query: 1081 KDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXX 1140
            KDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYG                 
Sbjct: 1081 KDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLP 1140

Query: 1141 XXXXFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGA 1200
                FIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGA
Sbjct: 1141 DTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGA 1200

Query: 1201 FTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260
            FTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSN
Sbjct: 1201 FTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260

Query: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAAL 1320
            LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAAL
Sbjct: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAAL 1320

Query: 1321 ARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQ 1380
            ARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQ
Sbjct: 1321 ARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQ 1380

Query: 1381 MEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPA 1440
            MEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPA 1440

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVF 1500

Query: 1501 STWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1561 VADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDDK 1620
            VADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDDK
Sbjct: 1561 VADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDDK 1620

Query: 1621 SDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVV 1680
            SDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVV
Sbjct: 1621 SDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVV 1680

Query: 1681 IFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSSTEQT 1740
            IFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSSTEQT
Sbjct: 1681 IFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSSTEQT 1740

Query: 1741 VTAITEIRESALXXXXXXXXXXXXXXXSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRH 1800
            VTAITEIRESAL               SQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRH
Sbjct: 1741 VTAITEIRESALKIKERIKFKPKSKKKSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRH 1800

Query: 1801 EAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLIN 1860
            EAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLIN 1860

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXNIPKKEKQVPALMI 1920
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGIN            NIPKKEKQVPALMI
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLCSLKSLFFSSNIPKKEKQVPALMI 1920

Query: 1921 NWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980
            NWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI
Sbjct: 1921 NWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980

Query: 1981 KERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040
            KERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD
Sbjct: 1981 KERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040

Query: 2041 LGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLM 2100
            LGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLM
Sbjct: 2041 LGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLM 2100

Query: 2101 LGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160
            LGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK
Sbjct: 2101 LGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160

Query: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNI 2220
            RCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNI
Sbjct: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNI 2220

Query: 2221 YAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTIN 2280
            YAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTIN
Sbjct: 2221 YAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTIN 2280

Query: 2281 CTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK 2340
            CTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK
Sbjct: 2281 CTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK 2340

Query: 2341 PSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEH 2400
            PSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEH
Sbjct: 2341 PSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEH 2400

Query: 2401 PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFN 2460
            PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFN
Sbjct: 2401 PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFN 2460

Query: 2461 VKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTN 2520
            VKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTN
Sbjct: 2461 VKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTN 2520

Query: 2521 VSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANAS 2580
            VSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANAS
Sbjct: 2521 VSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANAS 2580

Query: 2581 WLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGV 2640
            WLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGV
Sbjct: 2581 WLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGV 2640

Query: 2641 LPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPV 2700
            LPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPV
Sbjct: 2641 LPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPV 2700

Query: 2701 LYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTD 2760
            LYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTD
Sbjct: 2701 LYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTD 2760

Query: 2761 LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE 2820
            LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE
Sbjct: 2761 LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE 2820

Query: 2821 KTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTXXXXX 2880
            KTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQT     
Sbjct: 2821 KTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTEEELE 2880

Query: 2881 XXXXXXXTASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQ 2940
                   TASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQ
Sbjct: 2881 ESINKEETASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQ 2940

Query: 2941 KLVYLAEKQYVKILDDTH 2958
            KLVYLAEKQYVKILDDTH
Sbjct: 2941 KLVYLAEKQYVKILDDTH 2958

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 5569 bits (14446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2678/2958 (90%), Positives = 2810/2958 (94%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            MEA+SQLRGVPLTHQKDFSWVFLVDWILT+V CLTM+FYMGRIYAYLVSFILEWLLWKRA
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120
            K+KINVETLRVSLLGGRIHFK+LSVIHKDYTIS+LEGS+TWKYWLLNCRKAELI+NNKS 
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKSS 120

Query: 121  SKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
            S    KLPCK  +ECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG
Sbjct: 121  SGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSDASI+NDRDYQETDIGKHP+ L FLPIEL FSRGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGNK 240

Query: 241  FTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYESG+GI+DVLPPKER+DLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFK+
Sbjct: 241  FTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKI 300

Query: 301  DTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKAND 360
            D GKVSKLWK F+RV Q+V+KPVV K+TKK+  +S+D+FY KWKGLSLYKA++G+AKA+D
Sbjct: 301  DRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYHKWKGLSLYKASAGDAKASD 360

Query: 361  LDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPP 420
            LDD+EFDLTNHEYAKFTSILKCPKVTI+YDVDVPGVVPHGAHPTI DIDGPDVGNNGAPP
Sbjct: 361  LDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 420

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIS 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRR+YTLFRMNIS
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLFRMNIS 480

Query: 481  ITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 540
            I EDTTWRIPTRE+SKD EFL+HYKET+EEYRPFGWMDLRFCKDTYANFNISVCPTV+GF
Sbjct: 481  IMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCPTVQGF 540

Query: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600
            QNNFHVHF+ETEIRSSVNHDILLKSKVF+IDGDIGYPLGWNSKAIWIINMKSEQLEAFLL
Sbjct: 541  QNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600

Query: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 661  CYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGDKL+IDVTVPRESILGTYTD+SYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 721  AYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            AYDFTIKG+YLLYSELDIDNVDTLVIEC S STVLHCYGFVMRYLTNVKMNYFGEFFNFV
Sbjct: 721  AYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 781  TSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPMKRSDLKRTTNE 840
            TSEEYTGVLGAR+VGDVTTKSSV DLASTVDSGYQNSS+KN SE KGPMKRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGAREVGDVTTKSSVADLASTVDSGYQNSSLKNESEDKGPMKRSDLKRTTNE 840

Query: 841  TDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHV 900
            TDIWFTFSVW+GALILPETIYSFDPCIALHF+ELVVDFRSCNYYMDIMAVL+GTSIKRHV
Sbjct: 841  TDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHV 900

Query: 901  SKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDS 960
            SKQINEVFDFIRRNNGADEQEHG LSDLTIHGHRMYGLPPTEPTYFCQWDINLGDL IDS
Sbjct: 901  SKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDS 960

Query: 961  DVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSV 1020
            D+EFIKGFF+SFYKIGFGYNDLENILLYDTETI+DMTSLTVH E+IRI L+DPVMKSQSV
Sbjct: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHVEKIRIGLKDPVMKSQSV 1020

Query: 1021 ISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKLRFTNFEQY 1080
            ISAESILFTLIDFENE YSQRIDVK+PKL ISLNCVMGDGVD SFLKFETKLRFTNFEQY
Sbjct: 1021 ISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDTSFLKFETKLRFTNFEQY 1080

Query: 1081 KDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXX 1140
            KDIDKKRSEQR+YIT HDSPYHRC FLLPLFYQDSDTYQ LYG                 
Sbjct: 1081 KDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTYQNLYGAIAPSSSIPTLPLPTLP 1140

Query: 1141 XXXXFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGA 1200
                +IIEDIVGEYATLLE  NPFK+ FAETPST+EPS+ASF+EDDNDEEA  S FKP A
Sbjct: 1141 DTIDYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVA 1200

Query: 1201 FTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260
            FTED + E+DNYVVDVSYILLD+DPLLF+F KSLLEQLYSENMVQVLDDIEIGIVKRLSN
Sbjct: 1201 FTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260

Query: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAAL 1320
            LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQM EKSLEKNRT KLLEVAAL
Sbjct: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTNKLLEVAAL 1320

Query: 1321 ARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQ 1380
            A+VKTVRVTVNQKKNPDLSEDRPPALSLG+EGFE+WSSTE RQVNSLNLTSSDITIDESQ
Sbjct: 1321 AKVKTVRVTVNQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380

Query: 1381 MEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPA 1440
            MEWLF+YCSDQ NL+QEV TSF+SIQ+TR++SKTELIS+LTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFEYCSDQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPA 1440

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ+NID+VLKE+KYTSA DAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVF 1500

Query: 1501 STWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLF+ +NEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFTAENEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1561 VADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDDK 1620
            VADANLVVDLTPPVTSL  NREETIEITGR+GSVKGKFSDRLLKLQDLIPL+AAVGEDDK
Sbjct: 1561 VADANLVVDLTPPVTSLPSNREETIEITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDK 1620

Query: 1621 SDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVV 1680
            SDPK ELSKQF+MNTVLLVDKSELQLVMD+TKLMSRTVGGRVSLLWENLKDSTSQAGS+V
Sbjct: 1621 SDPKKELSKQFKMNTVLLVDKSELQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680

Query: 1681 IFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSSTEQT 1740
            IFSQKSEVWLKH S+ILGEAQLRDFS+LATTEAWSHKPTILINNQCADLHFRAMSSTEQ 
Sbjct: 1681 IFSQKSEVWLKHTSVILGEAQLRDFSVLATTEAWSHKPTILINNQCADLHFRAMSSTEQL 1740

Query: 1741 VTAITEIRESALXXXXXXXXXXXXXXXSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRH 1800
            VTAITEIRES +               SQFV QKINTVL+CYFSNVSSE+MPLSPFYIRH
Sbjct: 1741 VTAITEIRESLMMIKERIKFKPKSKKKSQFVDQKINTVLSCYFSNVSSEVMPLSPFYIRH 1800

Query: 1801 EAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLIN 1860
            EAKQLDIYFNKFGSNEIL+SIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG+S+EGYSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLIN 1860

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXNIPKKEKQVPALMI 1920
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGIN            N+PKKEKQ P++MI
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPSIMI 1920

Query: 1921 NWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980
            NWTLDTSI+YFG+L+PVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI
Sbjct: 1921 NWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980

Query: 1981 KERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040
            KERSLPIGLSK+LDFSIKVSTLQRT+DTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD
Sbjct: 1981 KERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040

Query: 2041 LGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLM 2100
            L HYY++ HAPNIWN KMFTGKSDK KE+P+NFRSIHILSYKFCIGW+FQYG GS+PGLM
Sbjct: 2041 LSHYYSRRHAPNIWNTKMFTGKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLM 2100

Query: 2101 LGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160
            LGYNRLFSAYE+DFGKFTVVD+FFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK
Sbjct: 2101 LGYNRLFSAYEKDFGKFTVVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160

Query: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNI 2220
            RCGELKDWFFRFHGEALDVNFVPSFMDVI+STLQSMRAFQELK+NILDVSE+  +E+ N 
Sbjct: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNS 2220

Query: 2221 YAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTIN 2280
            YA++SVE+A SSLAPFL+NIRSVNSNFKYDGGVFRVYTYEDIE KSEPSFEIKSPVVTIN
Sbjct: 2221 YASTSVESASSSLAPFLDNIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTIN 2280

Query: 2281 CTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK 2340
            CTYKHDEDKV+PHK RTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK
Sbjct: 2281 CTYKHDEDKVKPHKFRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTK 2340

Query: 2341 PSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEH 2400
            PS QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFS+ TNEFDSE 
Sbjct: 2341 PSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQ 2400

Query: 2401 PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFN 2460
            PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLT+LFTHPDVISMYG GLVSDL+VFFN
Sbjct: 2401 PLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFN 2460

Query: 2461 VKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTN 2520
            VKQLQNLYLFLDIWRFSSILHTRP QR+VNK I+M SLTST++ D GTEIPWCFTLIFTN
Sbjct: 2461 VKQLQNLYLFLDIWRFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTN 2520

Query: 2521 VSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANAS 2580
            VSGDVDLGPSLG+ISLRTQRTWLATDHY+EKRQLLHAFTDGISLTSEGRLSGLFEVANAS
Sbjct: 2521 VSGDVDLGPSLGMISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANAS 2580

Query: 2581 WLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGV 2640
            WLSEVKW PEK KNTHPLVSTSLNIDD+A+KAAFDYHMFLIGTI+NIHF LHNEKDAKGV
Sbjct: 2581 WLSEVKWPPEKSKNTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGV 2640

Query: 2641 LPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPV 2700
            LPDLLQVSFSSDEIILSSTALV ANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQP+
Sbjct: 2641 LPDLLQVSFSSDEIILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPI 2700

Query: 2701 LYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTD 2760
            LYKDILRSLKLLRTDLSV+ISS KVQISPISLFDVEVLV+RIDKVSIRSETHSGKKLKTD
Sbjct: 2701 LYKDILRSLKLLRTDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTD 2760

Query: 2761 LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE 2820
            LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE
Sbjct: 2761 LQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEE 2820

Query: 2821 KTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTXXXXX 2880
            KTNNLEYLFACSFSDKISVRWNLGPV+FIKEMWTTHVKALAVRRSQ+ANISFGQT     
Sbjct: 2821 KTNNLEYLFACSFSDKISVRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTEEELE 2880

Query: 2881 XXXXXXXTASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQ 2940
                    ASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRK+FPKFTHQTAVIPVQ
Sbjct: 2881 ESIKKEEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQ 2940

Query: 2941 KLVYLAEKQYVKILDDTH 2958
            KLVYLAEKQYVKILDDTH
Sbjct: 2941 KLVYLAEKQYVKILDDTH 2958

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 5503 bits (14275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2634/2959 (89%), Positives = 2786/2959 (94%), Gaps = 1/2959 (0%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            MEA+SQLRGVPLTHQKDFSWVFLVDWILT+V CLTM+FYMGRIYAYLV+FILEWLLWKRA
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120
             +KINVETLRVSLLGGRIHFKHLSVIHKDYTIS+LEGS+TWKYWLLNCRKAELI+NNK  
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELIENNKDS 120

Query: 121  SKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
               NVKLPCKF LECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE FSDG
Sbjct: 121  LSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGK P+FLKFLPIEL F+RGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGNK 240

Query: 241  FTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYE+GEG++DVLPPKER+DLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL
Sbjct: 241  FTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKAND 360
            DTGKVSKLWK F+RVL++V+KP++SK+ KK T  S+DSF+QKWKGLSLYKA  G+AK +D
Sbjct: 301  DTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQKWKGLSLYKAAPGDAKPSD 360

Query: 361  LDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPP 420
            LDDIEFD TNHEYAKFTSILKCPK+TI+YDVDV G VPHGAHPTI DIDGPDVGNNGAPP
Sbjct: 361  LDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGNNGAPP 420

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIS 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRT+KP+KKLPPGSRR+YTLFRMN+ 
Sbjct: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFRMNVL 480

Query: 481  ITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 540
            I EDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFN+ +CPTVEGF
Sbjct: 481  IMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPTVEGF 540

Query: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600
            QNNFHVHFVETEIRSSVNHDILLKSKVFN+DGDIGYPLGWNSKAIWIINMKS+QLEAFLL
Sbjct: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLEAFLL 600

Query: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAG+PTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 601  REHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660

Query: 661  CYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGD+L ID+TVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 661  CYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720

Query: 721  AYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            AYDFT+KG+YLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV
Sbjct: 721  AYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780

Query: 781  TSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPMKRSDLKRTTNE 840
            TSEEYTGVLGAR+VG++ TKSSV+DLAST+DSGYQNSS+KN SE K P+KRSDLKRTTNE
Sbjct: 781  TSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSLKNESEDKDPVKRSDLKRTTNE 840

Query: 841  TDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHV 900
            TDIWFTFSVWNGALILPETIYS DPCIALHF+ELVVDFRSCNYYMDIMAVL+GTSIKRHV
Sbjct: 841  TDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 900

Query: 901  SKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDS 960
            SK INEVFDFIRRNNGA+EQEHG+LSDLTIHGHRM+GLPPTEPTYFCQWDINLGDL+IDS
Sbjct: 901  SKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDS 960

Query: 961  DVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSV 1020
            D+EFIKGFF+SFYKIGFGYNDLENILLYDTET+DDMTSLTVHAERI+IS  DPVMKSQSV
Sbjct: 961  DIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAERIKISFNDPVMKSQSV 1020

Query: 1021 ISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKLRFTNFEQY 1080
            ++AES+LFTLIDFENE YSQRIDVK+PKL ISL+CVMGDGVD SFLKFETKLRFTNFEQY
Sbjct: 1021 VTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFEQY 1080

Query: 1081 KDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXX 1140
            KDIDKKRSEQR+YIT HDSPYHRC FLLPLFYQDSDTYQKLYG                 
Sbjct: 1081 KDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLP 1140

Query: 1141 XXXXFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGA 1200
                FIIEDIVGEYATLLE  NPFKD FAETPSTVEPS+AS TEDDNDE A    FKP A
Sbjct: 1141 DTIDFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASSTEDDNDERADPLEFKPIA 1200

Query: 1201 FTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260
            FTE  + ++ NYV+DVSYILLD+DPLLFVFTKSLL++ YSE+MVQVLDDIEIGIVK+LSN
Sbjct: 1201 FTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSN 1260

Query: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAAL 1320
            LQEGITSISNID+HIAY+NLIWQETGEEGFELYLDRIDYQM EKSLEKNRT+KLLEVA L
Sbjct: 1261 LQEGITSISNIDVHIAYMNLIWQETGEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATL 1320

Query: 1321 ARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQ 1380
            AR+KTVRVTVNQK+NPDLSEDRPPALSLGLEGFE+WSSTE RQVNSLNLTSSDITIDESQ
Sbjct: 1321 ARIKTVRVTVNQKRNPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1380

Query: 1381 MEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPA 1440
            MEWLF+YCSDQ NL+QE   SFHSIQ TR SSKTELIS+LTAASEYYQISHDPYVITKPA
Sbjct: 1381 MEWLFEYCSDQGNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPA 1440

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ+NI+KVLKERKYTSA DAKNIFMSVF
Sbjct: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVF 1500

Query: 1501 STWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLFS DN +HKQNL+KKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1501 STWRNWEFSDVARSYIYGKLFSVDNAEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560

Query: 1561 VADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDDK 1620
            +ADANLVVDLTPPVTSLSLNREETIEITGR+GSVKGKFSDRLLKLQDLIPLVAAVG  DK
Sbjct: 1561 IADANLVVDLTPPVTSLSLNREETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGDK 1620

Query: 1621 SDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVV 1680
            SD K ELSKQF+MNTVLLVDKSE+QLVMD+TKLMSRTVGGRVSLLWENLKDSTSQAGS+V
Sbjct: 1621 SDAKAELSKQFKMNTVLLVDKSEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLV 1680

Query: 1681 IFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSSTEQT 1740
            IFSQKSEVWLKHASIIL EAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMS+TEQT
Sbjct: 1681 IFSQKSEVWLKHASIILCEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSTTEQT 1740

Query: 1741 VTAITEIRESALXXXXXXXXXXXXXXXSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRH 1800
            VT ITEIRES L               SQFVG KIN VL+CYFSNVSSEIMPLSPFYIRH
Sbjct: 1741 VTVITEIRESVLKIKDRIKFKPKSKKRSQFVGPKINIVLSCYFSNVSSEIMPLSPFYIRH 1800

Query: 1801 EAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLIN 1860
            EAKQLDIYFNKFGSNE+L+SIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG+SKE YSLIN
Sbjct: 1801 EAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLIN 1860

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXNIP-KKEKQVPALM 1919
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGIN             +P KK+K+ PA M
Sbjct: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLKSLLFTSGLPKKKKKKAPARM 1920

Query: 1920 INWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFL 1979
            INWTLDTSI+YFGIL+PVASTYFVFELHMLLLSLTNTNNGMLPEE KVTGQFSIENILFL
Sbjct: 1921 INWTLDTSITYFGILVPVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFL 1980

Query: 1980 IKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2039
            IKERSLPIGLSK+LDFSIKVSTLQRT+DTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL
Sbjct: 1981 IKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLL 2040

Query: 2040 DLGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGL 2099
            DLGHYY++ HAPNIW+IKMFTGKSDKPKEIP+NFRSIHILSYKFCIGWLFQYG GSDPGL
Sbjct: 2041 DLGHYYSRRHAPNIWDIKMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGL 2100

Query: 2100 MLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWF 2159
            MLGYNRLFSAYE+DFGKFTVVD+FFSVANGN SSTFFSEGNEKDKYNRSFLPNMQISYWF
Sbjct: 2101 MLGYNRLFSAYEKDFGKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWF 2160

Query: 2160 KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSN 2219
            KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQS+RAFQELK+NILDVSE+SH ED N
Sbjct: 2161 KRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDN 2220

Query: 2220 IYAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTI 2279
             YA SS+E+A +SLAPFL+NIRSVNSNFKYDGGVFRVYTY+DIEAKSEPSFEIKSPVVTI
Sbjct: 2221 PYATSSMESASNSLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTI 2280

Query: 2280 NCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFT 2339
            NCTYKH+E++ +PH+IR LI VDPT NTLYAGCAPLLMEFSESLQKMIKKHSTD+KP+FT
Sbjct: 2281 NCTYKHNENEAKPHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFT 2340

Query: 2340 KPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSE 2399
            KPS QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFS+TTNEFDSE
Sbjct: 2341 KPSSQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSE 2400

Query: 2400 HPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFF 2459
             PLEFSLTL+ TKASI+HIFSREVSTSFEVGFMDLT+LFTHPDVISMYG  LVSDL+VFF
Sbjct: 2401 QPLEFSLTLQQTKASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFF 2460

Query: 2460 NVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFT 2519
            NVKQLQNLYLFLDIWRFSSILHTRP Q S++K IDM SLTST++VD+G EIPWCFTLIFT
Sbjct: 2461 NVKQLQNLYLFLDIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFT 2520

Query: 2520 NVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579
            NVSGDVDLGPSLGVISLRTQRTWLATDHY EKRQLLHAFTDG+SLTSEGRLSGLFEVANA
Sbjct: 2521 NVSGDVDLGPSLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANA 2580

Query: 2580 SWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKG 2639
            SW+SEVKWS EK KN+HPLVSTSLNIDD+A+KAAFDYHMFLIGTINNI FQLHNEKDAKG
Sbjct: 2581 SWISEVKWSLEKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKG 2640

Query: 2640 VLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQP 2699
            +LPDLLQVSFSSDEI LSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGES+QP
Sbjct: 2641 ILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQP 2700

Query: 2700 VLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKT 2759
            +LYKDILRSLKLLRTDLS++ISSLKVQISPISLFDVEVLVVRI  VSIRSETHSGKKLKT
Sbjct: 2701 ILYKDILRSLKLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKT 2760

Query: 2760 DLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819
            DLQLQVLDVSAALSTSKEELDEE+GASIAIDDY+HYASKIVGGTIIDIPKLAVHMTTLQE
Sbjct: 2761 DLQLQVLDVSAALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQE 2820

Query: 2820 EKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTXXXX 2879
            EKTNN+EYLFACSFSDKISV+WNLGPVNFIKEMWTTHVKALAVR+SQIAN+SFGQT    
Sbjct: 2821 EKTNNIEYLFACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQTEEEL 2880

Query: 2880 XXXXXXXXTASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV 2939
                    T SKFNYIALEEPQI+VPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV
Sbjct: 2881 EESIKTKETTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV 2940

Query: 2940 QKLVYLAEKQYVKILDDTH 2958
            QKLVYLAEKQYVKILD TH
Sbjct: 2941 QKLVYLAEKQYVKILDGTH 2959

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 5393 bits (13989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2583/2959 (87%), Positives = 2753/2959 (93%), Gaps = 2/2959 (0%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            MEAVSQLRGVPLTHQKDFSWVFLVDWILT++ACLT +FYMGRIYAYLVSFILEWLLWKRA
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120
            K+KINVETLR+SLLGGRI+FKHLSVIHKDYTISILEGS+TWKYWLLNCRKAELI+N K+ 
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAELIENEKNS 120

Query: 121  SKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180
            S  N++LPCKF LECEGLE FIYNRT+AYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG
Sbjct: 121  SGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDG 180

Query: 181  SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNK 240
            SSADKLDEDLSESAYTTNSD+SIINDRDYQET+IGK+P+ L F PIEL  +RGSLLLGNK
Sbjct: 181  SSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGNK 240

Query: 241  FTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKL 300
            FTPSVMILSYE+GEGI+DVLPPKER+DLYRNKT +E KNFEISIKQNIGYDDAIGLKFKL
Sbjct: 241  FTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFKL 300

Query: 301  DTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKAND 360
            DTGKVSKLWK F+RVL++V+KPV+ +R KK    S+D+F+QKWKGLSLYKA++G+AK +D
Sbjct: 301  DTGKVSKLWKTFVRVLRVVTKPVIPRRGKK-AGPSDDAFFQKWKGLSLYKASAGDAKTSD 359

Query: 361  LDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPP 420
            LDDIEFD T+HEYAKFTSILKCPKVT+SYDVDVPGVVPHGAHPTI DIDGPDVGNNGAPP
Sbjct: 360  LDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGNNGAPP 419

Query: 421  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIS 480
            DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNI 
Sbjct: 420  DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNIL 479

Query: 481  ITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 540
            I EDTTWRIPTRE+SKDAEFLQHYK+TSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF
Sbjct: 480  IMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGF 539

Query: 541  QNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLL 600
            +N+FHVHFVETEIRSSVNHDILLKSKVF++DGDIGYPLGWNS  IWIINMKSEQLEAFLL
Sbjct: 540  KNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEAFLL 599

Query: 601  REHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNEN 660
            REHITLVADTLSDFSAGDPTPYELFRPFVYK+NWEM+GYSIYLNVNDHNIVNNPLDFNEN
Sbjct: 600  REHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDFNEN 659

Query: 661  CYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 720
            CYLSLHGDKL ID+TVPRESILGTYTD+SYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR
Sbjct: 660  CYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKEVGR 719

Query: 721  AYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFV 780
            +YDFTIKG YLLYSELDIDNVD+L I CTSNSTVLHCYGFVMRYL NVKMNYFGEFFNFV
Sbjct: 720  SYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFFNFV 779

Query: 781  TSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPMKRSDLKRTTNE 840
            TSEEYTGVLGAR+VG+V TKSSVVDLAST+DS YQN S+KN++E  GPMKRSDLKRTTNE
Sbjct: 780  TSEEYTGVLGAREVGEVVTKSSVVDLASTLDSEYQNGSMKNDAEDNGPMKRSDLKRTTNE 839

Query: 841  TDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHV 900
            TDIWFTFSVWNGALILPETIYSFDPCIALHF+ELVVDFRSCNYYMDIMAVL+GTSIKRHV
Sbjct: 840  TDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHV 899

Query: 901  SKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDS 960
            SKQINEVFDFIRRNNGADEQEHG LSDLTIHGHRMYGLPPTEPTYFCQWDINLG+L+I+S
Sbjct: 900  SKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINS 959

Query: 961  DVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSV 1020
            D+EF+KGFF+SFYK+GFGYNDLENILLYDTETI+DMTSLTVHAERI ISL DPVMKSQS+
Sbjct: 960  DIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINISLNDPVMKSQSI 1019

Query: 1021 ISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKLRFTNFEQY 1080
            +S ES+LFTLIDFENE YSQRID+KVPKL +SL+CVMGDG + SFL FETKLRFTNF QY
Sbjct: 1020 VSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQY 1079

Query: 1081 KDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXX 1140
            KD DKKRSEQR+YI  +DSPYHRC FLLPLFYQDSDTYQKLYG                 
Sbjct: 1080 KDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLP 1139

Query: 1141 XXXXFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGA 1200
                +IIEDIVGEYATLLEA NPFKD FAETPSTVEP +ASFTEDD++E A    FKP A
Sbjct: 1140 DTIDYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPLRASFTEDDDEEAADPLEFKPVA 1199

Query: 1201 FTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSN 1260
            FTE+ + E+DNYV+DVSYILLDIDPLLFVFTKSLLEQ YSE+MVQVLDDIEIGIVKRLSN
Sbjct: 1200 FTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQVLDDIEIGIVKRLSN 1259

Query: 1261 LQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAAL 1320
            LQEGI SISNIDIH+AYLNLIWQETGEEGFELYLDRI+YQM EKSLEKNRT+K LEVA L
Sbjct: 1260 LQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDRINYQMSEKSLEKNRTSKSLEVAVL 1319

Query: 1321 ARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQ 1380
            A+VKTVR TVNQKKNP+LSEDRPPALSLGLEGFE+WSSTE RQVNSLNLTSSDITIDESQ
Sbjct: 1320 AKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQ 1379

Query: 1381 MEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPA 1440
            MEWLF+YCSDQ NL+QEV TS +SIQ+TR+S+KTELIS+LTAASEYYQISHDPYVITKPA
Sbjct: 1380 MEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPA 1439

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVF 1500
            FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ NIDKVLKERKY+ A DAKNIFMSVF
Sbjct: 1440 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVF 1499

Query: 1501 STWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1560
            STWRNWEFSDVARSYIYGKLF  D+ KHK N IKKLLKCTMGSFYLTVYGEGYEVEHNFV
Sbjct: 1500 STWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKLLKCTMGSFYLTVYGEGYEVEHNFV 1559

Query: 1561 VADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDDK 1620
            VADANLVVDLTPPVTSLS NREETIEITG++GSVKGKFSD+LLKLQDLIPLV AV EDDK
Sbjct: 1560 VADANLVVDLTPPVTSLSSNREETIEITGKVGSVKGKFSDKLLKLQDLIPLVVAVTEDDK 1619

Query: 1621 SDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVV 1680
            SDPK ELSKQF+MNTVLLVDKSE+Q+VMD+TK+MSRTVGGRVSLLWENLKDSTSQAGS+V
Sbjct: 1620 SDPKAELSKQFKMNTVLLVDKSEIQVVMDKTKVMSRTVGGRVSLLWENLKDSTSQAGSLV 1679

Query: 1681 IFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCADLHFRAMSSTEQT 1740
            IFSQKSEVWLKH S ILGEAQL DFSILATTEAWSHKPTIL+NNQCADLHFRAMS+TEQ 
Sbjct: 1680 IFSQKSEVWLKHGSTILGEAQLCDFSILATTEAWSHKPTILVNNQCADLHFRAMSTTEQM 1739

Query: 1741 VTAITEIRESALXXXXXXXXXXXXXXXSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRH 1800
            V AITEI+ES L               SQFVG +INTVL+CYFSNVSSEIMPLSPFYIRH
Sbjct: 1740 VNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTVLSCYFSNVSSEIMPLSPFYIRH 1799

Query: 1801 EAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLIN 1860
            EAKQLDIYFNKFGSNEIL+SIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG SKE YSLIN
Sbjct: 1800 EAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEAYSLIN 1859

Query: 1861 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXNIPKKEKQVPALMI 1920
            VDISISMIKLTFSEPRRIVNSFLQDEKLASQGIN            +    +K+ PA MI
Sbjct: 1860 VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLNSLFLTTDPMNAKKETPAKMI 1919

Query: 1921 NWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLI 1980
            NWTLDT+ISYFGIL+PVASTYFVFELHMLLLSLTNTNNG+LPE+T++TGQ SIENILFLI
Sbjct: 1920 NWTLDTNISYFGILVPVASTYFVFELHMLLLSLTNTNNGLLPEQTRLTGQLSIENILFLI 1979

Query: 1981 KERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040
            KERSLPIGLSK+LDFSIKVSTLQRT DTEQSFQVESSHFRVCLSPDSLLRL+WGA+KLLD
Sbjct: 1980 KERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLD 2039

Query: 2041 LGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLM 2100
            +  YY+K HAPNIWNI+MFTGKSDKPKEIP+NFRSIHILSYKFCIGWLFQYG G DPGLM
Sbjct: 2040 MVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLM 2099

Query: 2101 LGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFK 2160
             GYNRLFSAYE+DFGKFT+VD+FFSV+NGNTSSTFFSEGNEK+KYNRSFLPNMQISYWFK
Sbjct: 2100 FGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFK 2159

Query: 2161 RCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNI 2220
            RCGELKDWFFRFHGEALDVNF+PSFMDVIDSTLQS+RAFQELK+NILD+   S+ E+S+ 
Sbjct: 2160 RCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSP 2219

Query: 2221 YAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTIN 2280
             AA + ENA +SLAPFL+NIRSVN NFKYDGGVFRVYTY+DIEAKSEPSFE+KSPVVTIN
Sbjct: 2220 DAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTIN 2279

Query: 2281 CTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDE-KPNFT 2339
            CTYKHDE K +PH+IRTLITVDPTHNTLYAGCAPLLMEFSESLQ MIKKHST E KPNFT
Sbjct: 2280 CTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFT 2339

Query: 2340 KPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSE 2399
            KPS QNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFS+TTNEFDSE
Sbjct: 2340 KPSTQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSE 2399

Query: 2400 HPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFF 2459
             PL FSLTLE TKASIKHIFSREVSTSFEVGFMDLT+LFTHPDVISMYG  LVSD++VFF
Sbjct: 2400 QPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFF 2459

Query: 2460 NVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFT 2519
            NVKQLQNLYLFLDIWRFSSILHTRP QR  NK ++M +L+S S+VD+GTEIPWCFTLIFT
Sbjct: 2460 NVKQLQNLYLFLDIWRFSSILHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFT 2519

Query: 2520 NVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579
            N+SGDVDLGPSLGVISLR+QRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANA
Sbjct: 2520 NLSGDVDLGPSLGVISLRSQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANA 2579

Query: 2580 SWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKG 2639
            SW+SEVKW  E  KNTHPLVSTSLNIDD+A+KAAFDYHMFLIGTINNI F LHNEKD+KG
Sbjct: 2580 SWVSEVKWPLENSKNTHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKG 2639

Query: 2640 VLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQP 2699
            +LPDLLQVSFSSDEI LSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNP ES+QP
Sbjct: 2640 ILPDLLQVSFSSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQP 2699

Query: 2700 VLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKT 2759
            +LYKDILRSLKLLRTDLSV+ISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKT
Sbjct: 2700 ILYKDILRSLKLLRTDLSVNISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKT 2759

Query: 2760 DLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819
            DLQLQVLDVSAALSTSKEELDEE+GASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE
Sbjct: 2760 DLQLQVLDVSAALSTSKEELDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQE 2819

Query: 2820 EKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTXXXX 2879
            EKTNNLEYLFACSFSDKISVRWNLGP+NFIKEMWTTHVKALAVRRSQ ANISFGQT    
Sbjct: 2820 EKTNNLEYLFACSFSDKISVRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTEEEL 2879

Query: 2880 XXXXXXXXTASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPV 2939
                     ASKFNYIALEEPQIEVPQIRDLG+ATPPMEWFGVNRKR PKFTHQTAVIPV
Sbjct: 2880 EESIKREENASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPV 2939

Query: 2940 QKLVYLAEKQYVKILDDTH 2958
            QKLVYLAEKQYVKILDDTH
Sbjct: 2940 QKLVYLAEKQYVKILDDTH 2958

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 3506 bits (9092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1656/2971 (55%), Positives = 2200/2971 (74%), Gaps = 39/2971 (1%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            M+AVSQ +GVPLT Q++FSW+FLV WILT++  L+ +FY+GR  AY+++FILEWLLWK A
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELID----- 115
            KVK+N+++LR+SLLGGRI FK++++IHKD TISILEG+ITW+YWL N RK E  +     
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQEASVDE 120

Query: 116  -NNKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFP 174
               K  S  N +LPC+F +  EGLEIF+YN+TVAYDN+I + SK+ER +FEK+LNE    
Sbjct: 121  TQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNE---- 176

Query: 175  EPFSDGSSADKLDE---DLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFS 231
            +  SD ++   +D+   D SES  T  S++S  NDR +QE +      FL+FLPI+   +
Sbjct: 177  QILSDSATVKSMDDSQFDTSESTSTDKSESSATNDRVFQEEETDT-SSFLRFLPIQFLVT 235

Query: 232  RGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYD 291
            RGSL+LGNKFTPS++I+S +S + ++D   PKE++DLY+ K   E  N E ++KQNIG+D
Sbjct: 236  RGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFD 295

Query: 292  DAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKA 351
            + + +KFKLD GKVS++W  F R+L ++ KP+      +      D F  KW+GL+LYK 
Sbjct: 296  EDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKG 355

Query: 352  TSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGP 411
            T    + ND+DDIEFD  NHEYAKF+SILK PKVT +   D+PG+VPHGAHPTIS +DGP
Sbjct: 356  TGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGP 415

Query: 412  DVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRV 471
            DVGN+GAPPD++LD+QI GGS+C+GPWAQRQ  HL ++LSPVVSRTAKP+K+L PG RR+
Sbjct: 416  DVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGCRRI 475

Query: 472  YTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNI 531
            YT  ++ ++I +D TWRIPTRE+SKD EFLQHY+ET+ EYRPFGW+DL+F K+T  N   
Sbjct: 476  YTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVNTTF 535

Query: 532  SVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMK 591
            ++CPTV+GF+NN  +H  E E RSSVNHDILLK K F+ D D  +PLGWN +A W IN+ 
Sbjct: 536  ALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTINLN 595

Query: 592  SEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIV 651
            S Q+EAF+LREHITL+ADTL+DFS+G+PTPYELFRPF+Y +NW+++GYS+YLNVNDHNIV
Sbjct: 596  SSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDHNIV 655

Query: 652  NNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNE 711
            NNPLDFNENCYLS HGD+L++D  +P+ SI   +TDISY I TPMFR++LNTPPWNTLNE
Sbjct: 656  NNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWNTLNE 715

Query: 712  FMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMN 771
            FMKHKEVGR+YDF + G+YL+YS+LDIDNVDT++++CTS  T L CYGFV+RYL NVKMN
Sbjct: 716  FMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINVKMN 775

Query: 772  YFGEFFNFVTSEEYTGVLGA-RDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPMK 830
            YFG+FF+FVTSEEYTG + A  D     ++S     + +     Q +           ++
Sbjct: 776  YFGDFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQGNDAPGRRRLHTELQ 835

Query: 831  RSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAV 890
            RSDLKRTTNETD+WFTF+VW GAL+LPETIY+ DPC+ LHF ELV+D RSCNYYMD++A 
Sbjct: 836  RSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLAN 895

Query: 891  LDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWD 950
            ++  SIKR+VSK  +E+F+ I +NNG +   HGSLS LTIHGHRMYGLPP EPTYFCQWD
Sbjct: 896  MNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWD 955

Query: 951  INLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISL 1010
             +LG L I SD+EF++GFFSSF +IGFGY DLENILLY+ ET DDMTS+TV+ E++ + L
Sbjct: 956  FDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVML 1015

Query: 1011 EDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFET 1070
            ++P +   +     ++ FT IDFENE YS R+D+ +P L+ SL     DG        ET
Sbjct: 1016 QEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLET 1075

Query: 1071 KLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGXXXXXXX 1130
            K++ TNF Q +D D+ R  QR+YI  HD+PYHRCSF+LP  YQD++ YQ+L+G       
Sbjct: 1076 KVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAPSSS 1135

Query: 1131 XXXXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEE 1190
                          FIIED++GE+  LLE ++PF+  F++     + S     +D+ +E+
Sbjct: 1136 LPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYATDVS-----DDETEED 1190

Query: 1191 ASSSGFK-PGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDD 1249
                 F  P    ++   E+D++++DVS+I ++I P +     + L    +EN+VQ++DD
Sbjct: 1191 IDPLEFNTPSEAIQNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFSTENIVQIIDD 1250

Query: 1250 IEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKN 1309
            IEI  V RLSNL+EG   ++N+ I+I YL+L W    + G  +YLDRID+ M EK++E+N
Sbjct: 1251 IEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGVGIYLDRIDFAMCEKTVEEN 1310

Query: 1310 RTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNL 1369
            +  KL+E+  L ++++VR TVNQ      +E+RPPALSL +EG+EIWSST   QVNSLN+
Sbjct: 1311 KEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNI 1370

Query: 1370 TSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQI 1429
             S+DIT+DE+Q+EWLF Y  +Q   +Q++  +  +IQ  +  S+ ELIS LTAASEYYQI
Sbjct: 1371 LSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQI 1430

Query: 1430 SHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERK-YTS 1488
            SHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP+DW + I++ L + K   +
Sbjct: 1431 SHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAAT 1490

Query: 1489 ANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTV 1548
              DAK IF+SVFS WRNWEFSD+ARSYIY KLF   +   + +  KK +   + SF++TV
Sbjct: 1491 TQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQEIHTTKKSITIKIASFFVTV 1550

Query: 1549 YGEGYEVEHNFVVADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQDL 1608
            Y  GYEVEHNF++   NL+++   P +  SL+RE    ITG +G+ KGK SD+++ +++L
Sbjct: 1551 YSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTLGTAKGKLSDKIIMIKNL 1610

Query: 1609 IPLVAAVGEDDKSDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWEN 1668
            +P +  + +  KS    +  K F++NT++L ++ ELQ+ +  T+L+SR  G R+S+LWE+
Sbjct: 1611 LPSL-KITDGGKSKETFDFVKSFKLNTLILCERGELQIDIGNTRLVSRVFGARLSMLWES 1669

Query: 1669 LKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCAD 1728
             KD TSQA S+ +++Q++E+ LKH +  L E Q+RDFS++ TTE+WS+KPTIL+N+QC+D
Sbjct: 1670 PKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFSLIVTTESWSYKPTILVNSQCSD 1729

Query: 1729 LHFRAMSSTEQTVTAITEIRESALXXXXXXXXXXXXXXXSQFVGQ----KINTVLTCYFS 1784
            LH  AM++T+  V +I EI E+                 ++        K+NT+LTC+F+
Sbjct: 1730 LHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEKITKVESHGPKPKVNTILTCFFT 1789

Query: 1785 NVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGD 1844
            N+S E+MP+SPF+IRHEAKQLDIYFN+FGSNEIL+S+WD D ++TSH TK+QY RFSFGD
Sbjct: 1790 NISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGD 1849

Query: 1845 IEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXX 1904
            +++KG +  + Y  IN+ +S S++KLT S+ ++++ SFLQDEK+ ++ I           
Sbjct: 1850 LQLKGNMVNDPYH-INLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGL 1908

Query: 1905 XXNIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEE 1964
              N  K + +      +W++DT+I+YFG+L P+ S YF+FEL MLL SLT   +  +P +
Sbjct: 1909 SKN-QKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSD-IPNQ 1966

Query: 1965 TKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLS 2024
            + ++GQFS+EN+LF IKER+LP+ LSK+LDFSIKVS LQ+  +T  ++Q+ESSHFRVCLS
Sbjct: 1967 SDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLS 2026

Query: 2025 PDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKFC 2084
            P+SL+RL+W  +++     YY  HH  N W+++       K  ++PLN  S HILSY FC
Sbjct: 2027 PESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLPLNVPSFHILSYNFC 2086

Query: 2085 IGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDK 2144
            +GWLF   + S+PGL+LGYNRLFSAYE++ GK T+VD FFS+ANGN+S  FFSEG EKDK
Sbjct: 2087 VGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDK 2146

Query: 2145 YNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKR 2204
            YNRS+LPNMQISYWFK  G ++D F RFHGEALDV F+ S++DVI+S L S++ FQELK+
Sbjct: 2147 YNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKK 2206

Query: 2205 NIL-DVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIE 2263
            +++  + +     D             ++L+PFL NIRS++  FKYDGGVF++++ ED E
Sbjct: 2207 DLIPGLPKKQKVNDDKTLEL-------NTLSPFLANIRSISCQFKYDGGVFKIFSLEDAE 2259

Query: 2264 AKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESL 2323
             +SEPSFE+ SP V I+  YKH E++ + H IR+LI ++ THN LYA CAPLL +F E +
Sbjct: 2260 TQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERI 2319

Query: 2324 QKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVG 2383
            Q M+KKHS+ E+   +KPS QN+DYKRLLD FD+A+K+TSAKQQLSLSCEPKAKVQAD+G
Sbjct: 2320 QGMVKKHSSSEESTLSKPSSQNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIG 2379

Query: 2384 FESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDV 2443
            F+SF+F+VTTN+ D+  PL FSL++E T+ASIKHIFSRE STS  V F+D+T++FTHPDV
Sbjct: 2380 FQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDV 2439

Query: 2444 ISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSH 2503
            I+++G  L+S++N+FFNVKQLQNLYLFLDIWR S +L ++PA   V    D  SL+    
Sbjct: 2440 INVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTD-SSLSIAQL 2498

Query: 2504 VDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGIS 2563
             D  + IPWCFTLIFTNV GDVDLGPSLGVIS++ +RTW ATDHY   R++LHAFTDG S
Sbjct: 2499 SDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTS 2558

Query: 2564 LTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGT 2623
            L+S+GRLSG+FE+  ASW+SEV W  +   N HPLVS ++NID+++ KAAFDYHMFLIG 
Sbjct: 2559 LSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGA 2618

Query: 2624 INNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKIS 2683
            INN    LH+EKD  GV+PDLL+V+F  + I L STALVAANILDIYNT +RMRQDNKIS
Sbjct: 2619 INNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKIS 2678

Query: 2684 YMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRID 2743
            Y+ETLR+SN  ES+ P+ Y DILRSL LL+TD+SV I +L +QISPI+LFDVEVLV+ I+
Sbjct: 2679 YIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIE 2738

Query: 2744 KVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGT 2803
             +S RSETHSGKKL T+L++QV D S +LSTSKEE+DE   + I++ +Y+ YASKIVGGT
Sbjct: 2739 SISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGT 2798

Query: 2804 IIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVR 2863
            II+IPKL V MTT QEEK++ LEYL+ C F DK+SVRWNLGP+NFIKEMWTTH++A+AVR
Sbjct: 2799 IIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVR 2858

Query: 2864 RSQIANISFGQTXXXXXXXXXXXXTASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVN 2923
            RSQ+  +  GQ+              S+F Y+ALE P+I++PQIRDLGDATPPMEWFGVN
Sbjct: 2859 RSQVVGVLDGQSEEDVEKRIKEEENFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVN 2918

Query: 2924 RKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            RKRFP FTHQTAV  VQKLVY AE++Y  IL
Sbjct: 2919 RKRFPAFTHQTAVFLVQKLVYSAEREYANIL 2949

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 3396 bits (8806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1627/2973 (54%), Positives = 2197/2973 (73%), Gaps = 42/2973 (1%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            M+A+SQ + +PLT QKDFSWVFLVDWIL ++  L ++FY+ R  AY +SFILEW LWKR+
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKA-----ELID 115
             VKIN+E++R+S LGGR+ FK++ +IH+DYTIS LE ++TW+YWLLN RK+     EL D
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120

Query: 116  NNKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE 175
                 S N+VKLPC+F LE EGLEIF+YNR VAYDN+I   SK+ER++FEK+LNE  F +
Sbjct: 121  K---ASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEKFLNEQVFTD 177

Query: 176  PFSDGSSAD-KLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGS 234
              ++ S+++   +ED  ESA T  SD+S  NDR +QE ++ + PQFL FLPI+   S GS
Sbjct: 178  SKAEVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQE-ELSERPQFLDFLPIDFKVSHGS 236

Query: 235  LLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAI 294
            L++GNKFTPS+MI S  S  G++DV  P E++DLY+ +  ++FK F I IKQNIG+++  
Sbjct: 237  LIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEF 296

Query: 295  GLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSG 354
             +KFK+D  +VSK+W+ F +VL      +     + N  S  D FY+KW+GLSLY+ T  
Sbjct: 297  SMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNKVSEEDPFYEKWRGLSLYRGTIF 356

Query: 355  EAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVG 414
                +D++DI+FD  NHEYAKF+SI++ P+   +++ D+PG+VPHGAHPT++  DGPDVG
Sbjct: 357  GKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVG 416

Query: 415  NNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTL 474
            N+GAPP+F+L++QI GGSIC+GPWAQRQ++ L R+LSP+ SR AKP K+L PG  R+YT 
Sbjct: 417  NSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYTQ 476

Query: 475  FRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVC 534
            F+  IS TE+TTWRIPTRE+SKD EFLQHY+ET+EEYRPFGW+DL+F KDTY    ++ C
Sbjct: 477  FKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQC 536

Query: 535  PTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQ 594
            PT EGF+N   +H  + EIRSSVNHDILLK K FN   DIG+PLGWN +A W I+++S Q
Sbjct: 537  PTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLESTQ 596

Query: 595  LEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNP 654
            LEAF+LREHITL+ADTL+DFS+G+PTPYELFRPFVY++NW++ GYS+YLNVNDHNIVNNP
Sbjct: 597  LEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNNP 656

Query: 655  LDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMK 714
            LDFNENCYLS HGD L ID+ VP+  +   +T++SY I TPMFR++LNTPPWNTLNEFMK
Sbjct: 657  LDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFMK 716

Query: 715  HKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFG 774
            +KEVGR++DF I G+YL+YSELDIDNVDT++IEC+S STVL CYGFV+RYLTNVKMNYFG
Sbjct: 717  NKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYFG 776

Query: 775  EFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDS--GYQNSSVKNNSEAKGPMKRS 832
            +FF+FVTSEEYTG + A +V +  T   + +  +++ S    + SSV+        +KRS
Sbjct: 777  DFFHFVTSEEYTGEIRANEVQNQFTDRQLYEDKASLSSYESIETSSVRKEQTGDSKIKRS 836

Query: 833  DLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLD 892
            DLKR TNETD+WFTF+VW GA++LPETIY+ DPCI LHF EL++DFRSCNYYMD++A ++
Sbjct: 837  DLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMN 896

Query: 893  GTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDIN 952
              S++R++ KQ NE+++ +R++NG   +++GSLSD+ IH HRMYGLPP EPTYFCQWD +
Sbjct: 897  DISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFS 956

Query: 953  LGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLED 1012
            LG L ++ D+ F++GF +SF KI FG  DLENILLY+ E IDDMTSLTV  ++I I + +
Sbjct: 957  LGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISIMIRE 1016

Query: 1013 PVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKL 1072
              M +  + +AE + F+ I+FENE Y  R+D+++P   + +  + G   +  F +FETK+
Sbjct: 1017 SEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLF-EFETKV 1075

Query: 1073 RFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGXXXXXXXXX 1132
              +NFE+  DI   +S+Q++YIT HD+PYHRC+F+LP   QDS+ YQ L+G         
Sbjct: 1076 NLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDSEIYQDLFGSIAPSSSLP 1135

Query: 1133 XXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSF--AETPSTVEPSKASFTEDDNDEE 1190
                        +I++D++G +  +LE+ NPF+  F  A +P    P + S TE  +DEE
Sbjct: 1136 PLPIPLLPATIDYIVDDLLGCFPEILESENPFRIPFSPATSPKLGNPFEGSDTE--SDEE 1193

Query: 1191 ASSSGFKPGAFTEDGDDE---KDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVL 1247
                 FK       GD E    DN+V+D+SY  L I+P L+ +  +  E   S+++VQ+L
Sbjct: 1194 LDPLEFKTET---SGDSETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCSQDIVQIL 1250

Query: 1248 DDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLE 1307
            DDIEIGIV  LS+LQEGI +  NI + I YL+L W +    G  LYLDRID +M +K LE
Sbjct: 1251 DDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRIDLEMCQKMLE 1310

Query: 1308 KNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSL 1367
            +N  TK+ EV  L ++++VR T+N+  +   +++RPPALSL +EG EIWS     QVNSL
Sbjct: 1311 ENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSL 1370

Query: 1368 NLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYY 1427
            N+ S+DITIDE+Q++WLFQY   Q  L QE+A++  SIQ++R++++ +L+S+L  ASEYY
Sbjct: 1371 NILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYY 1430

Query: 1428 QISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYT 1487
            QISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHILTYLP DW   ID++  ++   
Sbjct: 1431 QISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSH 1490

Query: 1488 SANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLT 1547
            +  D  N F+SVFS WRNWEFSD+ARSYIY  +FS  + K ++N ++  +K  + S + T
Sbjct: 1491 TLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSMENSIKLKLASLFFT 1550

Query: 1548 VYGEGYEVEHNFVVADANLVVDLTPPVTSLSLNREETIEITGRIGSVKGKFSDRLLKLQD 1607
            VY  GYEVEHNF++   N+VV+  P ++  S+ +E+ I +TG +G++KGK S +L+ L+ 
Sbjct: 1551 VYSTGYEVEHNFILTRTNVVVETLPAISDSSIIQEKIINVTGSLGTIKGKTSHKLINLKK 1610

Query: 1608 LIPLVAAVGEDDKSDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWE 1667
            L+P ++         P T   + F++N +LL ++SELQ V+  +K+MSR  GG++S+LWE
Sbjct: 1611 LLPELSM---KKNLKPSTPFLRCFKLNMLLLFERSELQFVLGASKVMSRVFGGKLSMLWE 1667

Query: 1668 NLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCA 1727
            + KD  S+A S+ +++Q+SE+W+KH +IIL E+Q+R+FSI+ T E+WS+KPT+L+N QC 
Sbjct: 1668 SPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSIIITAESWSYKPTVLVNLQCT 1727

Query: 1728 DLHFRAMSSTEQTVTAITEIRES--ALXXXXXXXXXXXXXXXSQF--VGQKINTVLTCYF 1783
            D+HFRAM++T+    ++ EI E+   L               SQ+  + QKIN VLTCYF
Sbjct: 1728 DIHFRAMTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQISQYPVMEQKINMVLTCYF 1787

Query: 1784 SNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFG 1843
            +NV+ EIMPLSPF  RH AKQLDIYFN+ GSN++++S+WDTD F+ SH TKE+Y RFSFG
Sbjct: 1788 TNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEYFRFSFG 1847

Query: 1844 DIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXX 1903
            +I++KG + +     IN+D+S S++KLT  + RR++ SFLQDEK+  + +          
Sbjct: 1848 NIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQFSSLKLFQ 1907

Query: 1904 XXXNIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPE 1963
                 P  EK      + W+L+++I+YFG+L+P++STYF+ ELHMLL+SL N   G+  +
Sbjct: 1908 RKKPAPSTEKS--GRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSL-NKIQGISSK 1964

Query: 1964 ETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCL 2023
               ++GQFSI+N+ FL+KE+SLP  LSK+LDFSIKVSTLQ+   T +SFQ+ES HFRVCL
Sbjct: 1965 YNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQIESPHFRVCL 2024

Query: 2024 SPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFRSIHILSYKF 2083
            SP SL  ++W  ++ L    YY K H    W   +    ++   E+  +F S H+LSY F
Sbjct: 2025 SPGSLAHMLWRGNQALTNIRYY-KEHTSVAWEKVINFKNTNNSAEVQADFPSFHVLSYNF 2083

Query: 2084 CIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKD 2143
            C+GWLF     ++PGL++GY+RLFSAYE++FGK T++D++FSVANG TS TFFS+G+EKD
Sbjct: 2084 CVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSDTFFSKGHEKD 2143

Query: 2144 KYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELK 2203
            +YNRS+LPNMQISYW K  G L+D + RFHGEALDVNF+ SF+DVI+S+L+S++ FQELK
Sbjct: 2144 RYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSLESIQKFQELK 2203

Query: 2204 RNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIE 2263
            R+++  + N   +       S+ +     ++PF   IRS+N  F+YDGGVF+V++  +  
Sbjct: 2204 RDLVGTASNIKEQ-----TQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFSSAEAS 2258

Query: 2264 AKSEPSFEIKSPVVTINCTYKHDEDKVR-PHKIRTLITVDPTHNTLYAGCAPLLMEFSES 2322
               +PSFEIKSP V I+  YK++E K + P  IRTLIT++ THNTL+A CAPL+ EFSE 
Sbjct: 2259 NHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLIAEFSEG 2318

Query: 2323 LQKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADV 2382
            +QKM+K+HS+D +P+ T  S QN+DYKR+LD FDVAV++ SAKQ LSL CEP+AKVQAD+
Sbjct: 2319 IQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLSLCCEPRAKVQADI 2378

Query: 2383 GFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPD 2442
            GF+SF F+VTTN++D E PL F+L++E T+ASIKHIFSRE STSF V F+DLT++FTHP+
Sbjct: 2379 GFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGVDFIDLTVMFTHPN 2438

Query: 2443 VISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTS 2502
             I++ G GL+SD++VFFNVKQLQNLYLFLDIW+ S++L+++P    V    D+ SL+S  
Sbjct: 2439 SINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNSKPMNEVVKSRTDLKSLSSVQ 2498

Query: 2503 HVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGI 2562
              D  + IPWCFTLIF+N++GDVDLGP+LGV+SL  +RTW ATDHY   R++LHA+T GI
Sbjct: 2499 SKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFATDHYKSTRKVLHAYTKGI 2558

Query: 2563 SLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIG 2622
            +LTS+GRLSG+ E+  ASW+SEV W   +  N +PLVS SLNID +  K AFDYHMFL+G
Sbjct: 2559 TLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNIDRVETKVAFDYHMFLVG 2618

Query: 2623 TINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKI 2682
             INNI   +H+EKD  G+ PDLL+V+   + I L STALVAANILDIYNT++R+RQDNKI
Sbjct: 2619 AINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAANILDIYNTVMRLRQDNKI 2678

Query: 2683 SYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRI 2742
            SY+ETL++SN  E RQ + YKDILRSL L++TD+SV I +L +QISPISLFD E+LVV I
Sbjct: 2679 SYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDIYTLNIQISPISLFDAEILVVNI 2738

Query: 2743 DKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGG 2802
            + +S RSETH+G KLKT+L++QV D S ALSTSKEELDE++ A+I+++DYMHYA +I GG
Sbjct: 2739 ENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDIIATISVEDYMHYAGRISGG 2798

Query: 2803 TIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAV 2862
             II+ P+L + MTT Q+EK++ LEYL+ CSF DKISVRWNLGPVNFIKEMW THV+A+AV
Sbjct: 2799 VIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLGPVNFIKEMWATHVRAMAV 2858

Query: 2863 RRSQIANISFGQTXXXXXXXXXXXXTA-SKFNYIALEEPQIEVPQIRDLGDATPPMEWFG 2921
            RRSQI +++FG                 S+F Y+ LEEP+I++PQIRDLGDATPP+EWFG
Sbjct: 2859 RRSQI-DVTFGPVSEEDVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFG 2917

Query: 2922 VNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            +NRKRFP FTHQTAVI VQKLV+ AEK+Y  IL
Sbjct: 2918 LNRKRFPAFTHQTAVILVQKLVHTAEKEYGSIL 2950

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 3251 bits (8429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1563/3003 (52%), Positives = 2150/3003 (71%), Gaps = 68/3003 (2%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            M + S+ + VP++  K+FSWVFL+DWIL +V CL+++FY+GR  AY+ S ILEWLLWKRA
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKA----ELIDN 116
             +K+N+E+LR+SLLGGRI FK++++IHKDYTIS+L+G++TW+YWLL  RK     E  D+
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 117  NKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEP 176
            N    K N +LPC+F L CEG EIF+YNRT +YDN+INL SK+ER KF+K+L+E  F + 
Sbjct: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180

Query: 177  FS--------------DGSSADKL-DEDLSESAYTTNSDASIINDRDYQETDIGKHPQFL 221
             S              + +S  KL DED  ES Y++ S  +  NDR + +    K   FL
Sbjct: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240

Query: 222  KFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFE 281
            +  P+E+   R SL  GNKFTPS++I+S E G GI+D   PKE++DLY+ K  +E  NF 
Sbjct: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300

Query: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQ 341
            +++K NIGY + + LKFK+D GK+S+LWK F  +  ++++P+   + KK      D F Q
Sbjct: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360

Query: 342  KWKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGA 401
            KW+GLSLYK T  E   +DLDDI+FD  NHEYAKF+S++KCPK   +Y+ D+PG VPHGA
Sbjct: 361  KWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPHGA 420

Query: 402  HPTISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPI 461
            HPT S+IDGPDVGNNGAPP  +LD+QI GGSICYGPW QRQ++ +  +L+P VSRT  P+
Sbjct: 421  HPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSRTESPV 480

Query: 462  KKLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRF 521
            K+  PGS R+YT  +++ISI +DTTWRI TRE SKD  FL+HYKET+++YRPFGW+DLRF
Sbjct: 481  KRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGWIDLRF 540

Query: 522  CKDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWN 581
             K++YA F  ++ PT EGF+N+ ++H  + EIRSSVNHDIL+K K F+ D D+ YPL WN
Sbjct: 541  SKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSYPLVWN 600

Query: 582  SKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSI 641
             +A W I+M S QLE FLLREHITL+ADTL+DF++G+PTPYELFRP    +NW+M+ Y I
Sbjct: 601  DRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKMDAYFI 660

Query: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMML 701
            YLNVNDHNIVNNPLDFNENCYLSLHGD L I+VT+P E I   + +I+Y I+TPMFR++L
Sbjct: 661  YLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPMFRLLL 720

Query: 702  NTPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFV 761
            NTPPWNTLNEFMK+KEVGR+YDF+ KG+YLLYSELD+DNVDT+ I C S  T L CYGFV
Sbjct: 721  NTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQCYGFV 780

Query: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGARDV--------GDVTTKSSVVDLASTVDSG 813
            +RYL NVKMNYFG+FFNF+TSEEYTG+   RD          +++      D+ S  +SG
Sbjct: 781  IRYLANVKMNYFGDFFNFITSEEYTGI--TRDEELEEELISSNLSDNEDNGDVYSDGESG 838

Query: 814  YQNSSVKNNSEAKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSE 873
              + ++      +  +KRSDL+RT NETD++ TFSVW+GA+ILPETIY+ D C AL F E
Sbjct: 839  -MDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCTALKFGE 897

Query: 874  LVVDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGH 933
            L++D RS NYYMD++A L+ T ++R+  K   ++F  +  +N    +  G LSDL+IHGH
Sbjct: 898  LIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSDLSIHGH 957

Query: 934  RMYGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETI 993
            RM+GLPP EPTYFC+WD ++G L+++S+ +F+KGF +SF +IGFG+ DLENILLY  E I
Sbjct: 958  RMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILLYSKEVI 1017

Query: 994  DDMTSLTVHAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISL 1053
            +DMTSLTV+A+ I ++L++ V      +  + + FT IDFE+ NYS R+D+ +P LK+S+
Sbjct: 1018 NDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIPSLKMSM 1077

Query: 1054 NCVMGDGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQ 1113
              +  DG       F TK+  T+F Q K+  + RS QR YIT +D+ +HR SFLLP  +Q
Sbjct: 1078 YGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFLLPQSFQ 1137

Query: 1114 DSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSFAETPS 1173
              + Y +LYG                     FI+ED +GEY +LL+    F+  F    S
Sbjct: 1138 KKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRMPFG---S 1194

Query: 1174 TVEPSKASFTEDDNDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKS 1233
            T  P++AS     ++E+     F     + + + + DN V+D+ YI ++I+P +  + +S
Sbjct: 1195 TNTPNQAS---THHEEDMDPLEFSNSTVSTEKNYQCDNLVIDIEYISVEINPSISTYIES 1251

Query: 1234 LLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELY 1293
            L   +Y EN+VQV+DDIEI  +K LS  QEG +SI+NI + + Y ++ W E    G ELY
Sbjct: 1252 LSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKLRVLYSDIYWGERDRYGIELY 1311

Query: 1294 LDRIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGF 1353
            LD++D++M ++++EK+R   LLE+  LA+ +++R +++++ +    ++RPPALSL +EG 
Sbjct: 1312 LDKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEEGSTKNEKERPPALSLVVEGC 1371

Query: 1354 EIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSK 1413
            E+WS+T  +QVNS++  S+DITIDESQ+EWLF + ++Q   LQ + T+ +S+Q   T S+
Sbjct: 1372 ELWSATAEKQVNSIDTISTDITIDESQLEWLFLFVNEQNQNLQNIITTLNSVQAEHTVSR 1431

Query: 1414 TELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDW 1473
             +LIS+LTAA+++YQISHDPYVITKPAFI RLSKGHVRENRSWKIITRLRHILTY+P DW
Sbjct: 1432 RKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDW 1491

Query: 1474 QNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDN-EKHKQNL 1532
            ++ ++  LKE+     ++AK +FMSVFS WRNWEFSDVARSYIYG+LF T+  EKHKQ++
Sbjct: 1492 ESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSM 1551

Query: 1533 IKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSLNREETIEITGRIG 1592
             ++++K  + SF+LT Y  GY+++ NFV+ +AN+V + TPP T   ++RE+ I +TG IG
Sbjct: 1552 -RRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQTPPFTEAGVSREKLINLTGSIG 1610

Query: 1593 SVKGKFSDRLLKLQDLIPLVAAVGEDDKSDPKTE---LSKQFRMNTVLLVDKSELQLVMD 1649
            SVKG FSD LL+L++LIPL+    E  +  P  +   + K F++N +LL +K+E+QLV+ 
Sbjct: 1611 SVKGNFSDELLRLKELIPLLNKEQEKMERSPSFQVDNIPKSFKLNALLLFEKTEVQLVIG 1670

Query: 1650 ETKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILA 1709
            E+KL +R + G+VSLL ++ K++ S AGS+++++++SE  + H +  L E Q+RDFS+ A
Sbjct: 1671 ESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRSETLITHRNTTLVENQVRDFSLSA 1730

Query: 1710 TTEAWSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRESALXXXXXXXXXXXXXXXSQ 1769
            T E+WS KPT+L++ QCA  H ++M+ T   V ++ E+ ++                   
Sbjct: 1731 TVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEGEN 1790

Query: 1770 FVGQK----INTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTD 1825
               +K    +   + C  SNVS EIMP+SPFYIRHE K+ D+ F +FGS  ++I +WDTD
Sbjct: 1791 KSPKKKLKDVEIEVVCQLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTD 1850

Query: 1826 FFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQD 1885
            FF+ S  TK+QY R SFGD +I   + +  + +++ ++S SMIKLTFSEP RI++SFLQD
Sbjct: 1851 FFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQD 1910

Query: 1886 EKLASQGINXXXXXXXXXXXXNIPKKEKQV-PALM--INWTLDTSISYFGILIPVASTYF 1942
            E+ AS+                +P+ E ++ PA    + W LDT I YFGIL+P+++TYF
Sbjct: 1911 ERTASESFKLLKALKPFL----LPQTEGRLQPATTKEMRWLLDTDIKYFGILVPISTTYF 1966

Query: 1943 VFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTL 2002
            VFE H L+LS+++ +     E+ +   Q SIEN++FLIK+R +P  LS++LDFSI  ST+
Sbjct: 1967 VFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTI 2026

Query: 2003 QRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGK 2062
            Q+ ++ + SFQVES+HFR+ LSP SL+RL+WG  + L L +YY +    ++W+IK    K
Sbjct: 2027 QKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIKASKLK 2086

Query: 2063 SDK--PKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVV 2120
             +K     I +N  S H+LSY FCIGW+F     S PG+MLG++RLFSAYE  +GK T+V
Sbjct: 2087 KEKKGSSSIGMNMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLV 2146

Query: 2121 DSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVN 2180
            D+FFSVA G TS+TF+   +E +  NRS+LPNMQI+YW K+ G +KD F RFHGEALDV+
Sbjct: 2147 DAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVS 2206

Query: 2181 FVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNI 2240
            F+ +F+ VI+S LQS + FQELK ++  +  N+ + ++N       E    SLAPFL+NI
Sbjct: 2207 FLTTFITVIESMLQSFQVFQELKTSL--IQPNTSTTENN------TEPKIKSLAPFLSNI 2258

Query: 2241 RSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLIT 2300
            +SVN  FKYDGGVF+V+++EDIE+  EPSFE+K+P V I+  YKH+   ++PH IR L+ 
Sbjct: 2259 KSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVA 2318

Query: 2301 VDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEK-----PNFTKPSPQNVDYKRLLDQF 2355
            +  THNTL+A CAPL+ EF E + +M+KKHS++ K      N +K   QN+DYKRLLD F
Sbjct: 2319 IGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGF 2378

Query: 2356 DVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASI 2415
            D+A KLTS++Q+LSLSCEPKAKVQADVGF+SF+  + TN  D   PL FSL+++ TKASI
Sbjct: 2379 DIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASI 2438

Query: 2416 KHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWR 2475
            KHIFS+E STSF +  +DL  +FTHPD+I+MYG GL+S+++++FNVKQLQNLYLF+DIW+
Sbjct: 2439 KHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWK 2498

Query: 2476 FSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVIS 2535
             SS +   P  +S N   +   LT     +L  EIPW FTLIFTN++G  DLGPSLGV+S
Sbjct: 2499 LSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLS 2558

Query: 2536 LRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNT 2595
            L+ +RTW+A+DHY +KRQ++ AFTD +S  S+GRLSG+FE+  ASW+SEV W  EK  + 
Sbjct: 2559 LKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHN 2618

Query: 2596 HPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEII 2655
            +PLV+ S+NID++++KAAFDYHMFLIGTI+   F LH+EKD  G +PDLL+V+F+ + I 
Sbjct: 2619 YPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMIN 2678

Query: 2656 LSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESR-QPVLYKDILRSLKLLRT 2714
            + STALVAANILD+YNT++RMRQDNKI Y+ETLR+S+  E+R  P  Y+DILRSL LL+T
Sbjct: 2679 ICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQT 2738

Query: 2715 DLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALST 2774
            D+S +I  LK+Q+SPI+LFD+EVLV+ I+ +S R+ T +G+KLKT L+L+V D   ALST
Sbjct: 2739 DVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALST 2798

Query: 2775 SKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFS 2834
            SK E+DE+  ++I++ DYM YASKI GGTII++PKL + MT+ QEE ++ LEYL+ C+F 
Sbjct: 2799 SKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFE 2858

Query: 2835 DKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTXXXXXXXXXXXXTASKFNY 2894
            DKI+V+WNLGPVNFIKEMWTTHVKALAVRRSQ    +  QT              SK  Y
Sbjct: 2859 DKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEVQKRIKEEENISKLKY 2918

Query: 2895 IALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            + +EEP+I++PQIRDLGDATPP+EWFGVNRKR P FTHQT V+PVQKLV+ AEKQY  +L
Sbjct: 2919 VPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLL 2978

Query: 2955 DDT 2957
            D++
Sbjct: 2979 DNS 2981

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 3206 bits (8313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1583/3004 (52%), Positives = 2141/3004 (71%), Gaps = 82/3004 (2%)

Query: 2    EAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAK 61
            ++ +  RG  L  +++FSWVFLVDWILT++  L  +FY+ R +AY V+FILEWLLWK+AK
Sbjct: 5    QSSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAK 64

Query: 62   VKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRK-----AELIDN 116
            VK+++  LR+SLL GR+ FK+L++I KD TI+ILEGSITW+YWL+  RK     A++   
Sbjct: 65   VKVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHA 124

Query: 117  NKSPSKNN---------------VKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDER 161
            +   S N+               +KLPC+F  ECEG E+FIYNRT AYDN++N+LSK ER
Sbjct: 125  SAGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVER 184

Query: 162  DKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFL 221
            +KFEK++ E+ F +P SDGSS DK++E  + SA  +  + +I NDR +Q       P++L
Sbjct: 185  EKFEKFMAENDFLDPSSDGSSDDKIEE--TSSATNSTDEETIANDRTFQNDTRKTLPRYL 242

Query: 222  KFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFE 281
            + LPIE   ++GS+L+GNKFTP V+ILS+ES   + DV     ++DLYR K ++  KN E
Sbjct: 243  EALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLE 302

Query: 282  ISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQ 341
            I +KQNI YD+     F+ D GK+S+LW  F R+ +LV  P  S R K+     +D+F Q
Sbjct: 303  IMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKSNRRKEQ---PHDNFMQ 359

Query: 342  KWKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGA 401
            KWKGLS+Y+      + ++ DDIEFD+++HEYAKFTS+LK P+VTI +D D+PG VPHGA
Sbjct: 360  KWKGLSMYR-NDMFGEFDEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGA 418

Query: 402  HPTISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPI 461
            HP  S  DGPDVGNN APP +  ++ I GG++CYGPWAQRQ +HLQ +LSP VSRTAKPI
Sbjct: 419  HPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPI 478

Query: 462  KKLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRF 521
            KKL PGS+R+YT+ ++ I+  ED TWRIPTRE+SKD EFL HYKET+++YRPFGW+D++ 
Sbjct: 479  KKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIKV 538

Query: 522  CKDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWN 581
             +D+   F++++CPT +GF+N   V  V+TEIRSSVNHDI LKSK F+ + DIGYPLGWN
Sbjct: 539  SRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWN 598

Query: 582  SKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSI 641
            ++A W I M S QLE FLLREH+TL+ADTL+DFS+G+P PYELFRPFVY + W M+GYS 
Sbjct: 599  AEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSF 658

Query: 642  YLNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMML 701
            YLNVNDHNIVNNPLDFNENCYLS+HGD L ++V VP+++I   +T+++Y+I TPMFR++L
Sbjct: 659  YLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRLLL 718

Query: 702  NTPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFV 761
            NTPPWNTLNEFM++KEVGR++DF +KG+YL+YSELDIDNVDTL +EC+S  T LH YGFV
Sbjct: 719  NTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGFV 778

Query: 762  MRYLTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKN 821
            +RYL NVKMNYFGEFF+FVTSEEYTG     D+ ++ ++    D  S+ +S  + SS  +
Sbjct: 779  IRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNSS 838

Query: 822  NSEAKGP-------MKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSEL 874
            +   K P       +K+SDLKRT+NETDIWFTFSVW+GALILPETIY+ DPCIALHF+EL
Sbjct: 839  D---KNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAEL 895

Query: 875  VVDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHR 934
            +VD RSCNYYMDI+A     ++KR+V K+ +E+++++  NNG D + HG+LSD+ IHGHR
Sbjct: 896  IVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHR 955

Query: 935  MYGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETID 994
            MYGLPPTEPTYFCQWD++ G L+IDS++ F++G F +FYKIGFGY DLENILLY+TE ID
Sbjct: 956  MYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIID 1015

Query: 995  DMTSLTVHAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLN 1054
            DMTSLT+    I I L D    + + +  E   FTLIDFENE YS+R+D+K+P L+   N
Sbjct: 1016 DMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENERYSKRMDIKIPSLE--FN 1073

Query: 1055 CVMGDGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQD 1114
                +  D+S L F+  + FTNF Q +D +K R  QR YI  +D+PYHRC+FLLP  YQ 
Sbjct: 1074 IFSNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQK 1133

Query: 1115 SDTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSFAETPST 1174
            S  Y +L+G                     +++ED++ +Y  L E     K+S  E    
Sbjct: 1134 SRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGNYDIKESSVE---N 1190

Query: 1175 VEPSKASFTEDDNDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSL 1234
            +E S    T       A  +   P   + D   E DNYVV V  I++DI+P L+   + L
Sbjct: 1191 LELSAIEATRAITGIGAERTHSNPITLS-DYAVESDNYVVKVESIVIDINPALYTTIEKL 1249

Query: 1235 LEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYL 1294
            L+ +Y ++ VQ++D IEIGIVKRLS++ +G+T+++N+ + I + NL W E   +   ++ 
Sbjct: 1250 LKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMFF 1309

Query: 1295 DRIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFE 1354
            D++D+ + EK+LE+N    LLE+  LA++K VR+TV Q+     +++RPPA+++G+EGFE
Sbjct: 1310 DKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFE 1369

Query: 1355 IWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKT 1414
             WS+   +QVNS++++S+DIT+D++Q+EW F+Y   Q     ++  S++ IQ+ R  S+ 
Sbjct: 1370 FWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQSYNRIQNNRIESQK 1429

Query: 1415 ELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ 1474
            ELIS LTAASEYYQISHDPYVITKPAFIMRLS+GHVREN+SWKIITRLRHILTYLP DW 
Sbjct: 1430 ELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWY 1489

Query: 1475 NNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIK 1534
             N+ + L++RK+  + DA++IFMS+FS WR+WEFSDVARSYIYGKLF  D+ + K+  ++
Sbjct: 1490 LNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLFLNDHAEKKKQSLQ 1549

Query: 1535 KLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSL---SLNREETIEITGRI 1591
            KL K  +G+F++TVY   Y+V+H+ VV++A L+++LTP  T     SL REE I+I+G +
Sbjct: 1550 KLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSSTEPKENSLQREELIDISGTV 1609

Query: 1592 GSVKGKFSDRLLKLQDLIPLVAAVGEDDKSDPKTE-LSKQFRMNTVLLVDKSELQLVMDE 1650
              +KGK S +LLKLQ LIP++    E     P  + + K F+MN   +V+  ++QLVMD 
Sbjct: 1610 DVIKGKLSTKLLKLQKLIPILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDA 1669

Query: 1651 TKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILAT 1710
            TKL      GR+S+LWENL+DST+QAGSVV+FS+ +E+ LKH + +L E ++ +F    T
Sbjct: 1670 TKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTELVLKHINSVLAEGRVSNFYATFT 1729

Query: 1711 TEAWSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRESALXXXXXXXXXXXXXXXSQ- 1769
            T+ W+ +PT LI+++ + +HFR M+ TE+ V AI +I+   L               +Q 
Sbjct: 1730 TDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDIK---LKIDQISEQLELERRLTQH 1786

Query: 1770 ---FVGQKINTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDF 1826
               +   K N + +C FSNVS +IMP+SPF +++ AKQ+D ++NKF S+  LI + DTDF
Sbjct: 1787 PTVYDPNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDF 1846

Query: 1827 FMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDE 1886
            F+TS QTKEQY+R S   ++I+  VS     L+++++S +++KLTFSEP+ IV SFL+DE
Sbjct: 1847 FLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDE 1906

Query: 1887 KLASQGINXXXXXXXXXXXXN----IPKKEKQVPALMINWTLDTSISYFGILIPVASTYF 1942
            ++AS+ ++            +     P+  ++    +  W+LD+SI YFGILIP+ STY+
Sbjct: 1907 RVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYL--WSLDSSIDYFGILIPMTSTYY 1964

Query: 1943 VFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTL 2002
            V E H  + S++N  NG       +TG  S+ENILFLIKE SLP GLSKV+D ++ VSTL
Sbjct: 1965 VMEFHSYVSSISNA-NGAPSGNLDITGHMSVENILFLIKESSLPDGLSKVIDIAVNVSTL 2023

Query: 2003 QRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGK 2062
            QR  D  +S QVESSH R+CLSPDSLLRL+WG ++   L  +Y K+H+ ++W  + F   
Sbjct: 2024 QRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLW--QSFAKS 2081

Query: 2063 SDKPKE---IPLN-------FRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYER 2112
             DK ++   I  N         SIH LSY  C+GWLF+Y  G   GL+ GY+RLFSAYE 
Sbjct: 2082 DDKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYEN 2141

Query: 2113 DFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRF 2172
              GK TV+DS+F+ A GNTSSTF+ E N K+ +NR +LPNMQI +W+K    +KD + RF
Sbjct: 2142 CMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRF 2201

Query: 2173 HGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSS 2232
             GE LDV ++  FM  I+STL S++ FQ+LK+ +  + E    E  +I     V ++ + 
Sbjct: 2202 TGETLDVKYLSDFMLTIESTLHSIKMFQKLKKEL--IVETPKREVVHIKEDKPVNSSNN- 2258

Query: 2233 LAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRP 2292
                L NI+SVN +FKYDGG + V+   D      P+ EIKSPV++++  YKH++   + 
Sbjct: 2259 ---ILKNIKSVNCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKH 2315

Query: 2293 HKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKP-SPQNVDYKRL 2351
            H IR L+ +DPTHN LYA CAPL+  F E ++ +  ++ ++ K + T P S QN+DY++L
Sbjct: 2316 HSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSETTPTSVQNIDYEKL 2375

Query: 2352 LDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHT 2411
            L+ +D+A+ +TSAKQQLSLSCEPKAKVQADVGFE+   S+TTN FD + PL FS +++ T
Sbjct: 2376 LEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDT 2435

Query: 2412 KASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFL 2471
            KASIKH+FSRE STSF VG++DLT+LFTH + I+ YG  L+SD++++FNVKQLQNLYLFL
Sbjct: 2436 KASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFL 2495

Query: 2472 DIWRFSSILH-TRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPS 2530
            DIW+ S +L+    +Q  V +     S+    H +  +++PWCFTLIFTNV GD+DLGPS
Sbjct: 2496 DIWQLSELLNPVTSSQEQVIRKDKKKSVDKPIHNE--SQLPWCFTLIFTNVKGDIDLGPS 2553

Query: 2531 LGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPE 2590
            LG+ISLR  RTWLATDH+  KRQ+LHAF D + L SEGRLSG+  +  ASW+SEV W  +
Sbjct: 2554 LGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQD 2613

Query: 2591 KGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFS 2650
              ++  PLV+ SLN D + IKAAFDYHMFLIGT+NNI FQLH+E+D  GV PDLL+VSFS
Sbjct: 2614 SKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFS 2673

Query: 2651 SDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLK 2710
             +EI L STALVAANILDIYNTI+RMRQD KISY+ETL+DSN   ++Q + Y+DIL+SL+
Sbjct: 2674 CEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQ 2733

Query: 2711 LLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSA 2770
            LLRTDL+VSI SL++QISPISLFDVEV+V+ +  VS RSETHS  KL T L ++V D + 
Sbjct: 2734 LLRTDLTVSICSLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYDATL 2793

Query: 2771 ALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFA 2830
            +LST+K+ELDE+  + I + DYM YASKI GGTII+IP++ V MTT QEEK++ LEYL++
Sbjct: 2794 SLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYS 2853

Query: 2831 CSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTXXXXXXXXXXXXTAS 2890
            C F DK++VRWNLGPVNF+KEMWTTHVKA+AVRRSQ+   SF  +              +
Sbjct: 2854 CKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEENIT 2913

Query: 2891 KFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQY 2950
            K NY+ +EEPQI++PQI+DLGDATPP+EWFGVNRKRFP FTHQTAV+PVQ LVYLA+KQY
Sbjct: 2914 KLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQY 2973

Query: 2951 VKIL 2954
             K L
Sbjct: 2974 AKTL 2977

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 3149 bits (8165), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1541/3025 (50%), Positives = 2109/3025 (69%), Gaps = 105/3025 (3%)

Query: 2    EAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAK 61
            + VSQ   + L   KDFSWVFLVDWILT++  +T++FY+GR  A+ +SFI EWLLWKR +
Sbjct: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62

Query: 62   VKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELI------D 115
            +K+N+E+LRVSLLGGRI FK+L++I KDYTIS L G I+W+YWL   R  + +      D
Sbjct: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122

Query: 116  NNKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPE 175
            ++ +  + N KL C+  LECEG+E+F+YNRTVAYDN I + SK+ER KFE++LNEH F +
Sbjct: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182

Query: 176  ----------PFSDGSSADKLD-EDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFL 224
                         +  + D+++ +  +ES++  ++++ + NDR + + + GK+  FL +L
Sbjct: 183  RASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKN-LFLNYL 241

Query: 225  PIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISI 284
            P+++  S  S ++GNKFTPS++I+S +S EG++D   PKE++D+Y+ K  M+ KN  +S+
Sbjct: 242  PLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVSL 301

Query: 285  KQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWK 344
            KQNIGY++ + LKFKL TGK+SKLW  F++    V KP+   R KKN  S   +F+QKW+
Sbjct: 302  KQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKWR 361

Query: 345  GLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPT 404
            GLSLYK    E   NDLDDIEFDL  HEYAKFTSI+KCP+  ++Y+ D+PG VPHGAHPT
Sbjct: 362  GLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHPT 421

Query: 405  ISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKL 464
            +S IDGPD+GNNGAPP F L++Q+ GGS+CYGPWAQRQV+ +Q +L+P +SR  KP+K L
Sbjct: 422  LSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQKPVKPL 481

Query: 465  PPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKD 524
             PG RR+YTLF++ I + ED TWRIPTRE+SKDAEFL+HYK T+E+YRPFGW+DL+F KD
Sbjct: 482  QPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDLKFSKD 541

Query: 525  TYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKA 584
            +YA+FN ++C T +G QN   +H  ++EIRSSVNHDI +KSK  + D ++G+PLGWN KA
Sbjct: 542  SYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLGWNEKA 601

Query: 585  IWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLN 644
             W IN+ S QLE FLLREHITL+ADT+SDFS G+PTPYELFRPF+Y +NW+++GYSIYLN
Sbjct: 602  KWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGYSIYLN 661

Query: 645  VNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTP 704
            VNDHNIVNNPLDFNENCYLS HGD L +D+TVP++ I    TDISY I TPMFR+MLN P
Sbjct: 662  VNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRLMLNAP 721

Query: 705  PWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRY 764
            PWNTLNEFMKHKEVGRAYDF   G YL+Y+ELD+DNVD + I C+S STVLHCYGFV+RY
Sbjct: 722  PWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYGFVIRY 781

Query: 765  LTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSE 824
            L N+KMNYFG+FF+FVTSEEYT  + ++  G+ +      D AST  S +     KNN E
Sbjct: 782  LMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFD----KNNEE 837

Query: 825  ---AKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSC 881
                K P   +D++R TNETD+W TF++W GAL+LPETIY+ DPCIALHF EL +D RS 
Sbjct: 838  DDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHFGELAIDVRST 897

Query: 882  NYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPT 941
            NYYMD++A LD   ++++ + Q NE+F+ +R+ NG D + H  +S++ IHGHRMYGLPPT
Sbjct: 898  NYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYISNINIHGHRMYGLPPT 957

Query: 942  EPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTV 1001
            EPTYFC+WD +LG + ++S+V+F+KG  +SF KIGFG++DLEN+LLY+ E +DDMT++TV
Sbjct: 958  EPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEKEVVDDMTAVTV 1017

Query: 1002 HAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGV 1061
            + +  +I + +P + S++ +   ++ F  IDFENE YS R+D+++P LK+SL     +  
Sbjct: 1018 NVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLKLSLYGYNYEAS 1077

Query: 1062 -DMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQK 1120
             ++SF  FETK+ FTNF  YK+  + R+ QR YIT +D+P+HRC F+LP  YQ+S  YQK
Sbjct: 1078 KELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILPASYQNSVIYQK 1137

Query: 1121 LYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYAT----------LLEAANPFKDSFAE 1170
            LYG                     FII+D + EY T            ++ N   DSF  
Sbjct: 1138 LYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEYNTTSDCIILNLPYPDSTNLNSDSFNS 1197

Query: 1171 TPSTVEPSKASFTEDDNDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVF 1230
             P T   +             S +  +     ED   E+DNYV+D  YI + IDP LF +
Sbjct: 1198 YPDTAPHT------------LSDTIIRKSPLPED---ERDNYVIDFRYISISIDPELFFY 1242

Query: 1231 TKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGF 1290
             + LL   Y ++  QV+D IEIG+VKRLSN QEGI+SI+N  I I + ++ W +    G 
Sbjct: 1243 IEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVFWGQRDTGGI 1302

Query: 1291 ELYLDRIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGL 1350
            ELYLD +D++M EKS+EKNR   L EV  L ++ ++R +VN K +   +E +PPALSL +
Sbjct: 1303 ELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEGQPPALSLMV 1362

Query: 1351 EGFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRT 1410
            EG + WS+T  + +NS+ LTS D TIDE+Q+ WLF +  DQ  L+  V  +F  +Q  RT
Sbjct: 1363 EGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKTFEKVQKLRT 1422

Query: 1411 SSKTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLP 1470
             S+ ELIS LT ASEYYQISHDPYVITKPAFI RLS+GHVRENRSWKIITRLRHI+TYLP
Sbjct: 1423 QSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHIMTYLP 1482

Query: 1471 DDWQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQ 1530
            DDW   + K LKERKY ++ DAK+IFMSVFS+WRNWEFSDVARSYIY K+F  +  + +Q
Sbjct: 1483 DDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVFLANQAEKQQ 1542

Query: 1531 NLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSLNREETIEITGR 1590
              + K  K    S Y+TVY  G  V+H+F+V  +NLV + TP  T    N+E+ I +TG 
Sbjct: 1543 KTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVFEETPDTTESGYNQEKVINVTGN 1602

Query: 1591 IGSVKGKFSDRLLKLQDLIPLVAAVGEDDKSDPKTELSKQFRMNTVLLVDKSELQLVMDE 1650
            +GS+KGK SD++ KL +L+ LV    ED      +  S+ F++N  LL D S+L  V  E
Sbjct: 1603 LGSIKGKISDKMFKLHNLMNLVQQ-QEDPALKSISSFSRSFKLNIALLFDSSDLLFVFGE 1661

Query: 1651 TKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILAT 1710
            T L +    G+ S LWEN K  T +  S+V+++++ E  +KH + +L E Q+   ++ A 
Sbjct: 1662 TSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSMLFENQITGIALSAA 1721

Query: 1711 TEAWSHKPTILINNQCADLHFRAMSSTEQTVTAITE-------IRESALXXXXXXXXXXX 1763
             ++    P+I+ N QC D++ R M  TE  VT + E       ++ES             
Sbjct: 1722 ADSIISHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKES--FETDDLPKPTP 1779

Query: 1764 XXXXSQFVGQKINTVL------TCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEI 1817
                 +    KIN  L      TC+FSNVS +IMP+ PF  R E K+++  F+   +   
Sbjct: 1780 TNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNF 1839

Query: 1818 LISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRR 1877
              +IWD+D ++ SH TK+QY R S G+I +     +   ++ N+D+S S++KLTFSEP R
Sbjct: 1840 QFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHR 1899

Query: 1878 IVNSFLQDEKLASQGINXXXXXXXXXXXXNIPKKEKQV---PA-LMINWTLDTSISYFGI 1933
            ++ SFLQDE+  S+ +             N+   E ++   PA   I+W L+  I Y GI
Sbjct: 1900 MLFSFLQDEREVSRSVKKLQVLG------NLFSSEPEINTIPAGAKIDWRLNADIKYLGI 1953

Query: 1934 LIPVASTYFVFELHMLLLSLTNTNNGMLPEET-KVTGQFSIENILFLIKERSLPIGLSKV 1992
            LIPV++T+FVFE+H LL SL + + G +  E  + +GQ S++NILFLIK+R++P  LS++
Sbjct: 1954 LIPVSTTFFVFEMHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRI 2013

Query: 1993 LDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPN 2052
            +D S K+S +Q+ +++  S+Q+ES H R C SP SL+R++WG H+LL L  +Y +HH+ N
Sbjct: 2014 IDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKN 2073

Query: 2053 IWNIKMFTGKSDKPKEIP-----LNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLF 2107
            +W+      K  +  +       L F S HILSY FC+GWLFQ    +D GL+LGYNRLF
Sbjct: 2074 LWDFLPKKEKKVEEDKTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDAGLILGYNRLF 2133

Query: 2108 SAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKD 2167
            SAYE+  GK T+VD+FFSV+NG TS TF+S+GNE+DKYNRSFLPN+QI YW K   E+KD
Sbjct: 2134 SAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKD 2193

Query: 2168 WFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILD-------------VSENSH 2214
             F R HGE LDVNF+ SF+ +I++TLQS++ FQELK+ +++                  H
Sbjct: 2194 VFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQSEARSEEEEEESEEH 2253

Query: 2215 SEDSNIYAASSVENAP-SSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIK 2273
            +    +      E+AP   +APFL++IR VN  FKYDGG+F+VY++EDIE+  +PSFEI+
Sbjct: 2254 NRRETVPGKEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIR 2313

Query: 2274 SPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTD 2333
            SP VTI+  YK++   V+PH IRTLITV+ THN L+A CAPLLM  S+ +Q M+KKHS+ 
Sbjct: 2314 SPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSK 2373

Query: 2334 EKP----NFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLF 2389
            +KP      ++PS QN+DYKRLL+ FD+  K+ S++Q+LSLSCEPKAKVQA+VGF+SF+F
Sbjct: 2374 KKPEPKQRVSRPS-QNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMF 2432

Query: 2390 SVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGI 2449
            ++ TN+ D+  PL F+L +++T+++I+HIFSRE S SF +  +D+T +FTHP++I+M+G 
Sbjct: 2433 AILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGA 2492

Query: 2450 GLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTE 2509
             L+SD+ V+FNVKQLQNLYLFLDIW+ S++L  +P ++  +  + + +  S S +D+G  
Sbjct: 2493 CLISDVEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKPEDHHVAIDAPPS-SPMDVGNI 2551

Query: 2510 IPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGR 2569
            IPWCFTLIF N++G VDLGPSLG++SL  ++ W A+DHY+ KRQLLHA+ D I LT++GR
Sbjct: 2552 IPWCFTLIFANINGKVDLGPSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGR 2611

Query: 2570 LSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHF 2629
            LSG+ E+  A W +EV W   K  + +PLV+ S  I ++++K AFDYHMFLIGT+ N  F
Sbjct: 2612 LSGIVELDGALWAAEVNWP--KYDDPYPLVALSFVISNISLKVAFDYHMFLIGTVLNTVF 2669

Query: 2630 QLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLR 2689
             LH+E+D  G +PDLL+V  + ++I + STALVAAN+LD+YNTI+RMRQD  +SY+ETLR
Sbjct: 2670 HLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLR 2729

Query: 2690 DSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRS 2749
            +SN  ++++ V YKDIL+ L L++TD+ V I++L VQISPISLFDVEVLVV I  V    
Sbjct: 2730 ESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANV 2789

Query: 2750 ETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPK 2809
            +TH+G+KL+T L LQ+ +   +LS+SK E+DE++ + I+++DYM YASKIVGGTI DIPK
Sbjct: 2790 KTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPK 2849

Query: 2810 LAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIAN 2869
            L + M T Q+  ++ LEY +  +F DKI+VRWNLGPVNFIKEMWTTH+KALAVRRSQ   
Sbjct: 2850 LEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRRSQSLV 2909

Query: 2870 ISFGQTXXXXXXXXXXXXTASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPK 2929
             + G              T SK  YIA+EEPQI+ PQI+DLGDATP +EWFG+NRK+FP 
Sbjct: 2910 GTTGDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPI 2969

Query: 2930 FTHQTAVIPVQKLVYLAEKQYVKIL 2954
            FTHQT ++PVQKL++ AEK+Y  I+
Sbjct: 2970 FTHQTVIVPVQKLIHSAEKEYANIV 2994

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 3051 bits (7910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1494/2982 (50%), Positives = 2056/2982 (68%), Gaps = 74/2982 (2%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            ME  SQ   V L+++++FSWVFLVDW+L  V  LT++FY+GR++AY ++ +LEW LWK  
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAEL------- 113
            KVKI+VE+LR++ L G I F++L +I KD TISIL+GS+ W+Y LL  R+++        
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 114  ----IDNNKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLN 169
                +      S  N+ LPC+F L CEG EIFIYNRTVAY+N+I + S++ER +FEK+++
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 170  EHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELN 229
            +    E F   S              ++ SD   INDR + E    K   F++FLP+EL 
Sbjct: 181  KQEMSELFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLPMELQ 240

Query: 230  FSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIG 289
             SRGS++LGNKFTPS++I S  SG G+VD+  PKE++DLY+   Q++F + +ISI+QNI 
Sbjct: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300

Query: 290  YDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLY 349
            Y+     K     GK+S++W  F++VL +   P  +K +  N  + ++ F  KWKGL LY
Sbjct: 301  YNRK---KATFKNGKLSRMWATFVKVLHI---PFYNK-SHNNKGTESEPFMTKWKGLGLY 353

Query: 350  KATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDID 409
            K  + +    D D++ FD  NHEYAK ++I+K P+  ++Y  D+PGVVPHGAHPT+   +
Sbjct: 354  KGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL---E 410

Query: 410  GPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSR 469
            GP+VGNNGAPP+F +D+Q +G +ICYGPWAQR++ HL R++SP V+R++ PIK L PGSR
Sbjct: 411  GPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKTLSPGSR 470

Query: 470  RVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANF 529
            R+YT+F+    + + ++WRIPTRE SKD EFL+ +K TSEEYRPFGW+DL+F  D+Y + 
Sbjct: 471  RIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSV 530

Query: 530  NISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIIN 589
               +CP  EGF N  ++HF E E  SSVNHD++LK   F++ GD+GYPLGWNS A W IN
Sbjct: 531  TTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSSATWTIN 590

Query: 590  MKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHN 649
            + S QLE FLLREH+TLVAD  +DFS+G+PTPYELFRPF+Y++NW ++GYSIYLNVNDHN
Sbjct: 591  LHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYLNVNDHN 650

Query: 650  IVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTL 709
            IVNNPLDFNENCYLSLHG++L IDVT P +SI G Y D+ Y+ISTPMFR++LNTPPWNTL
Sbjct: 651  IVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNTPPWNTL 710

Query: 710  NEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVK 769
            NEFMK+KEVGR+Y F + G Y +YSELDIDNVDTL +ECTS  T LHCYGFVMRYL NVK
Sbjct: 711  NEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVK 770

Query: 770  MNYFGEFFNFVTSEEYTGVLGARDVGDV--TTKSSVVDLA---STVDSGYQNSSVKNNSE 824
            MNYFG+FF+F+TSEEYTGV+ A++   V  T + S+ D +   ST   G  +  V+    
Sbjct: 771  MNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTNLSTDSGGLSDPYVR--LR 828

Query: 825  AKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYY 884
            A  P+ RSD+KRTTNETDIWFTFSVW GAL+LPETIY+ DPC+ALHF EL+VD RSCNYY
Sbjct: 829  ADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIVDLRSCNYY 888

Query: 885  MDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPT 944
            MD++A +  TSIKR+VS+Q +E+F+ IRR+NG  E+EHGSL+ LTIHGHRMYGLPP EPT
Sbjct: 889  MDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPT 948

Query: 945  YFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAE 1004
            YFCQW I+L  L+I+SD EF KGFF+ F  IGFGY +LEN LLYD ET DDMTS+TV   
Sbjct: 949  YFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDMTSVTVRVR 1008

Query: 1005 RIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMS 1064
             + + +E+    S++V+   ++ FT IDFENE YSQRID+KVP L I L     D   + 
Sbjct: 1009 DMNVVVEND--SSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIR 1066

Query: 1065 FLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGX 1124
             +   TK+  T+F Q +D  K RS+QR YIT +DSP++RCSFLLP + Q+S  Y+ L G 
Sbjct: 1067 LMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPCYLQESPLYKSLLGS 1126

Query: 1125 XXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTE 1184
                                FIIED++GE+A  L+     + +  + P +   S  +  E
Sbjct: 1127 ISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRT-VDDPDSPSESFDTSQE 1185

Query: 1185 DDNDEEASSSGFK--PGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSEN 1242
             +  ++     F   P   + +  ++ DN ++DV ++ +D+DPL+  +   LL + +  N
Sbjct: 1186 HEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVN 1245

Query: 1243 MVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMR 1302
             V ++D+IE+ IVKRL  L    T + N+ +++  +N  W +   +  +LY D++D+ + 
Sbjct: 1246 TVDIIDEIEMSIVKRLGQLWNN-TCVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFDLG 1304

Query: 1303 EKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGR 1362
            +++ + +  T + E   L+++++VR TV  +   +  E+RPPALSL +EG+E +S    +
Sbjct: 1305 QRTRDLDGETIVSEKITLSKLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMREK 1364

Query: 1363 QVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTA 1422
             V S++L S+DIT+DESQ+EWL  Y ++Q +L++ + TSF  + +    ++ +L+ ++T 
Sbjct: 1365 IVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITT 1424

Query: 1423 ASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLK 1482
            ASE+YQISH+PYVITKPAFIMRLS GHVREN SW+IITRLRHILTYLP++W+NN    ++
Sbjct: 1425 ASEHYQISHEPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNN--SAIQ 1482

Query: 1483 ERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMG 1542
                  + DA     SV S WR WE SD+ RSYIY  +F +D  K +   +KK+LK    
Sbjct: 1483 VSPTVDSTDA-----SVASHWRRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFH 1537

Query: 1543 SFYLTVYGEGYEVEHNFVVADANLVVDLTPPV----TSLSLNREETIEITGRIGSVKGKF 1598
            SF+ T+Y EGY V HNFV+  AN+V +  P         +L+ +  + +T  +G++KG+ 
Sbjct: 1538 SFFFTIYSEGYRVAHNFVITRANIVGEEIPAAELSKVQQALDYDNVMNLTVSLGAIKGEL 1597

Query: 1599 SDRLLKLQDLIPLVAAVGEDDKSDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTV 1658
            +D+LLKL+++    A      +S     +SK +++N +L  D+SELQ V+ +T+L +R +
Sbjct: 1598 NDQLLKLRNIFS-KAQTPALKRSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRIL 1656

Query: 1659 GGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKP 1718
             G+ +LL E LK+S + A S V F+++SE WLKHA ++L EA  R+ S+  T E WS+ P
Sbjct: 1657 NGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMP 1716

Query: 1719 TILINNQCADLHFRAMSSTEQTVTAITEIRESALXXXXXXXXXXXXXXXSQFVGQKI--- 1775
            ++ IN QC++ H RAM+STE  V +I +I ES +                Q     +   
Sbjct: 1717 SLSINIQCSNSHIRAMTSTELLVNSIKQIMES-ISELKRHFAMEKTTPNVQGTSTNLSIP 1775

Query: 1776 --NTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQT 1833
              NT LT  FS+V++E+MPL+PF +RHE KQL +Y N+  SNEILISIWD +  + SHQT
Sbjct: 1776 LQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQT 1835

Query: 1834 KEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGI 1893
             EQY  F+ GD+++K  +  E  +++NV +S S++KLT SEPRRI++SFLQDEKL  + +
Sbjct: 1836 TEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESL 1895

Query: 1894 NXXXXXXXXXXXXNIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSL 1953
                           P    +  +  + W+LD +++YFGIL+P+AST+FVFE+HMLL ++
Sbjct: 1896 GYIKGLLQLFS----PLARNKTQSSALRWSLDANLNYFGILVPMASTFFVFEIHMLLAAM 1951

Query: 1954 TNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQ 2013
             N ++G    +  VTGQ SIEN L LIKE SLP  LSK+LDFSI+V + Q+  ++ QS+Q
Sbjct: 1952 NNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADLSKLLDFSIRVMSSQKVPNSPQSYQ 2011

Query: 2014 VESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPN--IWNIKMFTGKSDKPKEIPL 2071
            +ESSHFRVCLSP SL++++WG H+L  L  Y+ KH   +  I    +F G +   ++I  
Sbjct: 2012 IESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADRQI-- 2069

Query: 2072 NFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNT 2131
            +FRSIHILSY  CIGW+FQ G     GL++G++RLFSAYE+ +GK T++D +FSVANG +
Sbjct: 2070 DFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQS 2129

Query: 2132 SSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDS 2191
            + TF+S+G+EK +YNRSFL N+QI+YW K    +KD F R +GEAL+V+ + +  D+I+S
Sbjct: 2130 TDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIES 2189

Query: 2192 TLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKYDG 2251
            TL S++ FQ LK+      E  H  DS      ++EN  ++++PFL++IR+++  FKY G
Sbjct: 2190 TLASIQKFQTLKK------ERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVG 2243

Query: 2252 GVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAG 2311
            GV ++Y+ +D+     PS EIKSP V I   Y H+E + RPH+IR L+++DPTHN LY+ 
Sbjct: 2244 GVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQ 2303

Query: 2312 CAPLLMEFSESLQKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLS 2371
            C P+L +  E+ Q+M++KHS DE P     S Q++DYK LLD FD+A K+TS +QQLSLS
Sbjct: 2304 CVPILNDIVEASQRMVQKHSPDETP---LESSQSIDYKSLLDSFDIAFKVTSGRQQLSLS 2360

Query: 2372 CEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGF 2431
            CEP+AKVQADVGF+SF F VTTN+    +P   SL++E  ++S++HIFSRE S SF V F
Sbjct: 2361 CEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDF 2420

Query: 2432 MDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNK 2491
            +D T +FTHPDV   +G+ LVSD+NVFFN+KQLQNL LFLDIW+ +  L+ +   +  ++
Sbjct: 2421 VDFTSIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKDDDR 2477

Query: 2492 GIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDEK 2551
                 S+T +      T I W FTLIFTNV GDVDLGPSLGV+SLR  RTW ATDHY  +
Sbjct: 2478 KKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQ 2537

Query: 2552 RQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIK 2611
            R++LHAF D +S+ SEGRLSG+F++ NA+W+SEV +           +S SL++  +AIK
Sbjct: 2538 RRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIK 2597

Query: 2612 AAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIYN 2671
             AFDYHMFLIGTI+ + F L +E D  G+LPDLL V+ S  E+   +TAL AANILDIYN
Sbjct: 2598 TAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYN 2657

Query: 2672 TIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPIS 2731
            TI RMRQDN+ISY+ETLR+SN  E+R  +LY DIL+SL LLRTDLS  I++ K QISPIS
Sbjct: 2658 TITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPIS 2717

Query: 2732 LFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDD 2791
            LFDVEVLV+ ID VS RSET SG+KLKT+L LQV +   +LSTSKEELDEE  A I+I+D
Sbjct: 2718 LFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIED 2777

Query: 2792 YMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIKE 2851
            YM YASKI GGTI+ +P+L V MTT Q+ K++ +EYLF C F D+++V+WNLGP+NFIKE
Sbjct: 2778 YMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKE 2837

Query: 2852 MWTTHVKALAVRRSQIANISFGQTXXXXXXXXXXXXTASKFNYIALEEPQIEVPQIRDLG 2911
            MW+TH+K+LAVR++Q +N +  +              A K  Y+ L+EP IE+PQI+DLG
Sbjct: 2838 MWSTHIKSLAVRQTQ-SNKTMSEKDKQADLDPEEEIKA-KLQYVPLDEPYIEMPQIKDLG 2895

Query: 2912 DATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKI 2953
            DATPPMEWFGV+RKR P  THQ A++ +QKLV+ AEK+Y K+
Sbjct: 2896 DATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKV 2937

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2776 bits (7196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1393/3043 (45%), Positives = 2009/3043 (66%), Gaps = 131/3043 (4%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            M+  S  + V L   ++FSWVFLVDW+LT +  LT++FY+GRI+ +L++FILEW++WKR 
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKA--------- 111
            KVKIN+E+LR++ LGG I F++L +IH+DYTIS LEG+I W+YWL N RK+         
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNE 120

Query: 112  -ELIDNNKSPSKNN-VKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLN 169
             E ++N + P  N+  K PC+F L CEGLEIF+YN+T +Y+N+I++ SK+ER +FEK+++
Sbjct: 121  EERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180

Query: 170  EHSFPEPFSDGSSADKLDEDLSESAYTTNSDAS--------------------------- 202
            + +  E F++    +K+  + + S+ T  +  S                           
Sbjct: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPNN 240

Query: 203  IINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPP 262
            + ND  +++    +   +++FLPI+++  R SL+LGN+FTPS++++S ++ +GI+D+ PP
Sbjct: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300

Query: 263  KERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKP 322
            KE++DL++ K + E  + + S+KQNIG+DD I   FK   G++SKLW+ F R+  L   P
Sbjct: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIFLL---P 357

Query: 323  VVSKRTKKNTRSSND-SFYQKWKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILK 381
             +     K+ ++  D +F + WKGLSLY+    E   ++L++++FD  NHEYA+  SILK
Sbjct: 358  TLGP---KHLQTQEDITFRENWKGLSLYRQNMEE---DELENVDFDFANHEYARVISILK 411

Query: 382  CPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQR 441
              K+  +Y+ D+PG+VP     T+    GP+VGN+GAPP+F +D+Q++G +ICYGPWA+R
Sbjct: 412  SAKIVFTYEYDIPGLVPKEPEETLQ---GPEVGNSGAPPEFGVDIQLYGANICYGPWAER 468

Query: 442  QVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFL 501
            Q+S+L+ +LSPVVSRT KPIK L PGS+R+YT+F+ +ISI E++TWRIPTRE SKD EFL
Sbjct: 469  QLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFL 528

Query: 502  QHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDI 561
            +HY ET EE+RPFGW+DL+F KD+Y   +  +CPT EG  NN + HF   EIR+SVNH++
Sbjct: 529  RHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHEL 588

Query: 562  LLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTP 621
            LL++K F+ + D+GYPLGWN +A W IN+ S QLE F+LREHITL++D  +DFS+GDPTP
Sbjct: 589  LLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTP 648

Query: 622  YELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESI 681
            YELFRPF+Y++NW ++GYSIYLNVNDHNIVNNPLDFNENCYLSLHGD L  DV +PR+++
Sbjct: 649  YELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTV 708

Query: 682  LGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNV 741
                T+I+Y ISTPMFR++LNTPPWNTLNEFMK+KEVGR+Y+F + G Y ++SELDIDNV
Sbjct: 709  ANRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNV 768

Query: 742  DTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGARD-----VGD 796
            DT+ +EC+S  T LHCYGFV+RYL NVKMNYFG+F +FVT+EEYT      +     +GD
Sbjct: 769  DTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGD 828

Query: 797  VTTKSSVVDLASTVDSGYQNSSVKNNSEAKG-PM-KRSDLKRTTNETDIWFTFSVWNGAL 854
               + S  +++ST D     ++ +     KG PM KRS+LKRT NE DIWF FSVW GAL
Sbjct: 829  ---EHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGAL 885

Query: 855  ILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRN 914
            ILPETIY+ DPCIALHF+EL VD RS NYYMD++A ++ T +KR+VS+  +++F+ +R++
Sbjct: 886  ILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKD 945

Query: 915  NGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYK 974
            NG  E+ HG LS LTIHGHRMYGLPPTEPTYFCQW +++  L I+SD+EF KGF + F K
Sbjct: 946  NGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSK 1005

Query: 975  IGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSVISAESILFTLIDFE 1034
            IGFG+ +LENILLY+T T+ DMTS+TV  + ++  + D    S+SV+ A+ I FT IDFE
Sbjct: 1006 IGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTAIDFE 1065

Query: 1035 NENYSQRIDVKVPKLKISLNCVMGDGVDMSFL-KFETKLRFTNFEQYKDIDKKRSEQRKY 1093
            NE YSQR+D K P +   +  +  +  +  FL   +T+L FT+F Q +     R  QR+Y
Sbjct: 1066 NEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREY 1125

Query: 1094 ITFHDSPYHRCSFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGE 1153
            IT HDS Y+RCSFLLP F+Q+S  Y++L G                     +IIED +GE
Sbjct: 1126 ITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLGE 1185

Query: 1154 YATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGA--FTEDGDDEKDN 1211
            YA  +      K   + +  T E  +   T +D   +A+S  F P       +  D  +N
Sbjct: 1186 YAPTV------KPDDSSSSDTSEGQRTPLTNEDTRFQANSGFFSPHMPHNPPNNRDRYNN 1239

Query: 1212 YVVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNI 1271
            YV+DV Y+ L++ P +     + L++ Y+E+   ++D  EI IVK+L NLQ G + ++  
Sbjct: 1240 YVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASFVTTS 1299

Query: 1272 DIHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVN 1331
             +H+  L+ ++      G EL L+  D+ +R K++E      +LE    + + T+R+++ 
Sbjct: 1300 RLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLRISL- 1358

Query: 1332 QKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQ 1391
             + +P     +P AL L +E  E+WSST    VNS+N+TS   T+DESQ+E +  Y   Q
Sbjct: 1359 LEAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQ 1418

Query: 1392 ANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVR 1451
              +L++  TS   +++ R  ++ +LI +LT+ASEYYQISHDPYVITKPAFIMRLS+GHVR
Sbjct: 1419 IKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVR 1478

Query: 1452 ENRSWKIITRLRHILTYLPDDWQ--NNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFS 1509
            ENRSW+IITRLRHILTYLP+DW+  +++  V            ++IF+SVFS WRNW+ S
Sbjct: 1479 ENRSWRIITRLRHILTYLPNDWRTADHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLS 1538

Query: 1510 DVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVD 1569
            D+ RSYIY K+F   NE   +  ++ +LK    SF+ TV   GYEV  + +    N++VD
Sbjct: 1539 DITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARSTIFTRTNIIVD 1598

Query: 1570 LTPPVTSLS----LNREETIEITGRIGSVKGKFSDRLLKLQDL----------------- 1608
            + PP  + S      +E+ I +T  +G++KG++ + + KL++L                 
Sbjct: 1599 VLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSENELDDLSNLGS 1658

Query: 1609 IPLVAAVG---------EDDKSDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVG 1659
            I   A++          E  ++    +  +  ++   ++ ++ +L  V+ +T+L +R + 
Sbjct: 1659 ISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVVGDTRLTNRIIN 1718

Query: 1660 GRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPT 1719
            G+ S+L EN K++T  A S V F+Q+ E+WLKH++ +L E  L+   + AT +     P 
Sbjct: 1719 GKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVAATAQL-GVIPF 1777

Query: 1720 ILINNQCADLHFRAMSSTEQTVTAITEIRESALXXXXXXXXXXXXXXXSQFVGQKINTVL 1779
            + +N Q  +   RAM ST     ++ +I+                   S  V +K   + 
Sbjct: 1778 VSLNCQATNSFIRAMPSTVVLRNSVEKIKRQV--EVLIPQFKSHEVKNSSAVTKKTPRIP 1835

Query: 1780 TCY-----FSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTK 1834
              +     F+++SSEIM LSPFY+  + KQL IY +   + E+++   + D ++ S  + 
Sbjct: 1836 IKFDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFLEYDVYLKSQLSS 1895

Query: 1835 EQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGIN 1894
            EQ+ +FS  D++ K  V+ E   ++ V IS S++KLT  EPRR +++ LQDE+   + ++
Sbjct: 1896 EQFFKFSSTDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVD 1955

Query: 1895 XXXXXXXXXXXXNIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSLT 1954
                        +      + P+    W LD ++ YFG+L+PV+S  ++FELH L  SLT
Sbjct: 1956 HIQKLWNFLRSAS--GGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIFELHSLFASLT 2013

Query: 1955 NTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQV 2014
            N N      +   +GQ  +E+   L+KE SLP  LSKVLDFSI+  T Q+  ++ QS+Q+
Sbjct: 2014 NANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQI 2073

Query: 2015 ESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLNFR 2074
            ESS+FR+CL P+ L+ ++W  H L  L +++ KHH P  W +   + K+ K  E  L+FR
Sbjct: 2074 ESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTP--W-LPYSSNKTAKSGESTLDFR 2130

Query: 2075 SIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSST 2134
            SIHILSY FC+GWLF+ G  S+PGL+LGY+RLFSAYE+ FGK T++D + SVANGNTS T
Sbjct: 2131 SIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDT 2190

Query: 2135 FFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQ 2194
            F+S+ +EKD Y R++L NMQI YW K    LKD F RFHGE +DV F+ +   +++ TL 
Sbjct: 2191 FYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLH 2250

Query: 2195 SMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVF 2254
            S++ F E+K+  +  + +S     N+ AAS+      +LAPFL +IR++NS   + GGVF
Sbjct: 2251 SIKRFNEMKKAKIKQTGSSTKSKLNMEAASN------TLAPFLAHIRTINSQLNFAGGVF 2304

Query: 2255 RVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAP 2314
            +VY+  ++++K+EP  EIKSP V +   Y+ +E + + H IR   T++PTHN L+A CAP
Sbjct: 2305 KVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAP 2364

Query: 2315 LLMEFSESLQKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEP 2374
            LL +F+ +++ MI+  S+++K + +KP   ++DYK LL+ +D+A ++ S KQ+LS SCEP
Sbjct: 2365 LLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLSFSCEP 2424

Query: 2375 KAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDL 2434
            KAKVQ D GF SFLF VTT++ DS  P   S +++  ++S++HIFSR+ S +F + ++D+
Sbjct: 2425 KAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDI 2484

Query: 2435 TILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGID 2494
             ++FT+P+V   YG+ LVSD+N++ N+KQ QNL +FLDIWR S+   T+P++       D
Sbjct: 2485 VMMFTYPNV---YGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSD 2541

Query: 2495 MHSLTSTSHVDLGTE----IPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDE 2550
                 S        +     PW FT+IFTN+ G VDLGPSLGV++L  ++ W+ T H  +
Sbjct: 2542 AKKSLSPPFSPSSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGD 2601

Query: 2551 KRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAI 2610
            +++  H F  GI++ SEGRLSG+FE+  AS +SE+ W  E      PL+S S+ I+ M+I
Sbjct: 2602 QKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSI 2661

Query: 2611 KAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIY 2670
            K+AFDYHMFLIG++ ++   LHNE D   +LPDLLQVS   + I+L +TAL AAN LDIY
Sbjct: 2662 KSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALDIY 2721

Query: 2671 NTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPI 2730
            NTI+RM+QDN+ISY+ETL++SN   S   V Y+++L SL LLRTD+SV +  LKV ISP+
Sbjct: 2722 NTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPM 2781

Query: 2731 SLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAID 2790
            SLFD EVLVV +  V+ RSET SG+KLKT+LQLQ+ DV+A+LS+SKEELDEE  + IA+D
Sbjct: 2782 SLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVD 2841

Query: 2791 DYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIK 2850
            DYM YASK  GGTII +P+L V MTT Q++ +  LEYLF C F DKIS++WNLGPVNFIK
Sbjct: 2842 DYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIK 2901

Query: 2851 EMWTTHVKALAVRRSQIANISFGQTXXXXXXXXXXXXTASKFNYIALEEPQIEVPQIRDL 2910
            EMW THV++LAVRR+Q+ N S                  SKF Y+ L+EP IE+PQI+DL
Sbjct: 2902 EMWATHVRSLAVRRTQLGNSS--PELEVANESDKEDTVKSKFIYVPLDEPYIEMPQIKDL 2959

Query: 2911 GDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKI 2953
            GDATPP+EWFGV+RK  P  THQTAV+ +QKLV+ AEK+Y K+
Sbjct: 2960 GDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKL 3002

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 2694 bits (6984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1371/3026 (45%), Positives = 1956/3026 (64%), Gaps = 100/3026 (3%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            ME  SQ   + L  +K FSWVFL  W+LT +A LT++FY+ R++  + +FIL W +WK+ 
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAEL-IDNNKS 119
            KVKIN+E++RVS LGG +  K++S+I++D+T+S LE  I W+YWLLN R+ E  +  N S
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 120  PSKN-------------NVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEK 166
              ++             N KLPC   +EC+G E+F+YNR  AY+NV+ L +K+ER+KF  
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 167  YLNEHSFPEPFSDGSSADKLDEDLSESAYTTNS-DASIINDRDYQETDIGKHPQFLKFLP 225
            +LNEH   +  S+ ++ + +D+D  ES  T NS ++++INDR Y++    +      FLP
Sbjct: 181  FLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSILFNFLP 240

Query: 226  IELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIK 285
            I+L    G++ LGN+FTPS+++ SYE+  G++DV    E++DLY++K  M+F++  IS+K
Sbjct: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300

Query: 286  QNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKP---VVSKRTKKNTRSSNDSFYQK 342
             N+ YD     +  +D GK+S++W  FI ++ ++  P   +  K  KK        F  K
Sbjct: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360

Query: 343  WKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAH 402
            W+GLSLYK    +A    LD+  +D  N EYAKF+SILKCP  T+SY +D PG+VPHGAH
Sbjct: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420

Query: 403  PTISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIK 462
             T    DGPD+GN+G+PP+F +D+Q+   SI YGPW  RQVS+L R+LSPVVS+   PIK
Sbjct: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480

Query: 463  KLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFC 522
            KL PGSRR++T+F+M++ I ++++WRIPTRE SKD EF++ + +T++++RPFGW+D    
Sbjct: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540

Query: 523  KDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNS 582
            K T A FN S+ PT++G  NNF +HF++ E+ +SVNHDILLKSK F++  DIGYPLGWNS
Sbjct: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600

Query: 583  KAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIY 642
            +A W  ++ ++QLE FLL+EHI+L +D  SDF++ DPTPYELFRPF Y +NW++EGYSIY
Sbjct: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660

Query: 643  LNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLN 702
            LNVND NIVNNPLDFNENCYLSLHGD+L ID  +P   I   YT+I++ I TPMFR++LN
Sbjct: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720

Query: 703  TPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVM 762
            TPPWNTL+EFMK KEVGRA+DF I+G+YL+YS+LDIDNVDT+ +ECTS ST L CYG V+
Sbjct: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780

Query: 763  RYLTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSS---- 818
            RYL NV+ NYFG+F +F+TSEEY+ +L   +      + S      +  S  QNSS    
Sbjct: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGS---FTYSTTSSVQNSSSDDT 837

Query: 819  ---VKNNSEAKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELV 875
                K    +K  ++R+D+ RT NE DIWFTF VW+GALILPE +Y+ + C +L FSEL+
Sbjct: 838  VLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELM 897

Query: 876  VDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRM 935
            + FR  NYYMD +  L    I R ++   +E+F ++R  +      HG+LSD+TIH HRM
Sbjct: 898  ISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRM 957

Query: 936  YGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDD 995
            +GLPP + TYFCQW I+ G L IDS++EF+  FF  F K+GFGY++LEN L+Y  E+ DD
Sbjct: 958  FGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDD 1017

Query: 996  MTSLTVHAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNC 1055
            MT LT++ E++ I + D V + Q+ +    +    IDF+NE YS+RI++K+P+  IS+  
Sbjct: 1018 MTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFD 1077

Query: 1056 VMGDGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDS 1115
            V    +    L F+TK+ FTNF   +D     + QR YIT HDSPYHRC F+LP  YQ+S
Sbjct: 1078 VRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQES 1137

Query: 1116 DTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSFAETPSTV 1175
              Y +LYG                     F++ED + EY+ LLE  NPF +    + + +
Sbjct: 1138 FLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLE--NPFLN--IRSINNL 1193

Query: 1176 EPSKASFTEDDND----EEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFT 1231
            + S + F E   D    E+A     +      D   E DNY+++V YI +DI+PL   F 
Sbjct: 1194 DTS-SLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINPLFSDFI 1252

Query: 1232 KSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFE 1291
             S+  +LYSENMV ++D+IE+ IV+RL + ++ +   +N+ + I+Y+++ W     EG E
Sbjct: 1253 DSMSTKLYSENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIE 1312

Query: 1292 LYLDRIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLE 1351
            +YLD++D++MR++  +      L E   L+++K++R + ++ +  ++  +RPPALSL +E
Sbjct: 1313 IYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVE 1372

Query: 1352 GFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTS 1411
            G E+WS T   Q NS+N+ S+DIT+D SQ  WL +Y + Q      +  S   +Q    +
Sbjct: 1373 GLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVT 1432

Query: 1412 SKTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPD 1471
             +  LIS+LT ASEYYQI HDPYVITKPA IMRLS  HVRENRSW+I+TRLRHIL YLP+
Sbjct: 1433 LQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPE 1492

Query: 1472 DWQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQN 1531
             W+ +    ++ R   S +D KN+F+SVFS WRNWE SDVARSYIY ++F  D EK   N
Sbjct: 1493 GWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEK---N 1549

Query: 1532 LIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLT----PPVTSLSLNREETIEI 1587
            LI    K  M SFY T+Y + Y V+HN VV   N+++D       P  + +   ++  +I
Sbjct: 1550 LINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYDI 1609

Query: 1588 TGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDDKSDPKTELSKQFRMNTVLLVDKSELQLV 1647
            TG +G+ KG+  D+L++L+ L     A    +KS     + K F++N VL+V+K EL L 
Sbjct: 1610 TGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKS-TDFSIPKFFKINIVLIVEKGELTLA 1668

Query: 1648 MDETKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSI 1707
               TKL+SR   G++S  +EN +D  + +GS+V ++ ++E+WLKH  +IL +A L D  I
Sbjct: 1669 AANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFI 1728

Query: 1708 LATTEAWSHKPTILINNQCADLHFRAMSSTEQTVTAITEI-RESALXXXXXXXXXXXXXX 1766
                E    KPTIL+N + + L F+A+ +T+  V  + E  RE +               
Sbjct: 1729 SVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRH 1788

Query: 1767 XSQ---FVGQKINTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWD 1823
             S    F  +KI+        ++SSEI+ LSPF ++H  K+L I FN+ G N+ + SI D
Sbjct: 1789 TSTSPIFSTKKIDISFDINIFDISSEIVILSPFTVKHSMKELKIVFNREGDNDTIFSILD 1848

Query: 1824 TDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFL 1883
             D ++TS+Q   QY R S+ DI ++  ++     LI ++I  S+IKLT ++P++I NS L
Sbjct: 1849 ADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSLL 1908

Query: 1884 QDEKLASQGINXXXXXXXXXXXXNIPKKEKQVPAL------MINWTLDTSISYFGILIPV 1937
            QDEK   Q +                 +E +  A+      M+N+ L    +YFG+L PV
Sbjct: 1909 QDEKTFEQSLESIKTLNTLFSS----NREVRTSAVDNPYKFMVNFDL----TYFGLLFPV 1960

Query: 1938 ASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSI 1997
             ++YF+ ELH LL + +N        + K+T   +++N LF+IK   +   +SKVLDFS+
Sbjct: 1961 DTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSV 2020

Query: 1998 KVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIK 2057
             +ST  + +++++SF+VESSHFRVCL+P+SLL+++ G  +      YY +H    I+  K
Sbjct: 2021 NLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTK 2080

Query: 2058 MFTG-KSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGK 2116
                  S+     PL   SIH LSY FCIGW+F+    S PGL++GY+RLFSAYE  +GK
Sbjct: 2081 KKASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGK 2140

Query: 2117 FTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEA 2176
             TVVD FFS+ANG +S TF+S+GNEK+KYNRS+LPN+QI YW K    +K  F RF+GE 
Sbjct: 2141 LTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGET 2200

Query: 2177 LDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSV--ENAPSSLA 2234
            +DV F+ +F  +I+ T++S++ FQ +K+  +         + N+ A   V  ++  +  +
Sbjct: 2201 IDVRFLSNFATIINLTIESVQHFQMIKKETV--------REMNVEAEKKVGEDDISTKFS 2252

Query: 2235 PFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHK 2294
             F + ++ +N    YDGGVF VY        +E + EI +P V I+  YK+  D  +PH 
Sbjct: 2253 LFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHW 2312

Query: 2295 IRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQ 2354
            IR+ I ++PT+NTL +  A  L EF ES+ +M+ K S  E+P   K     +DYKR+L+ 
Sbjct: 2313 IRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILED 2372

Query: 2355 FDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKAS 2414
            FDV+  +++ KQ++SLSCEP AKV A+VGFESF+FS+ TN+ D   PL  SLT+   K S
Sbjct: 2373 FDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTS 2432

Query: 2415 IKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIW 2474
            I H FS E + SF V F+D+T LFTHPD+   YG  L+SD++++FN+KQLQNL +FLDIW
Sbjct: 2433 INHEFSTEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQNLMVFLDIW 2489

Query: 2475 RFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVI 2534
                ++  RP +    K  +    +ST      T IPW FT+I T+++GD+ LGPSLG +
Sbjct: 2490 NLKRLIKLRPQKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDINGDIHLGPSLGNL 2549

Query: 2535 SLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKN 2594
            SL+ ++ W++T+H+ ++R+ L  FTD +SLTS GRL GL +VAN SW+  V++   +  +
Sbjct: 2550 SLKLKKNWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLD 2609

Query: 2595 THPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEI 2654
              PLV  +LN++++A+KAAFDYHMFLIG ++NI F L +EKD  G LPDLL++    DEI
Sbjct: 2610 QSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEI 2669

Query: 2655 ILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRT 2714
             + STALVA+NILDI NTI R RQD++ SY+ETL +SNP   +  + Y DIL+SL LLRT
Sbjct: 2670 DICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRT 2729

Query: 2715 DLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALST 2774
            D+ + I  ++VQISPISLFDVEV+V  ++ VS RS T SG+KL TDLQ+++   + +LS 
Sbjct: 2730 DVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSK 2789

Query: 2775 SKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFS 2834
            S EELDEE  + I++DDYM YA K+ GG I+ IPKL V MTT Q E +  +EYLFAC F 
Sbjct: 2790 SNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFH 2849

Query: 2835 DKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTXXXXXXXXXXXXTAS---- 2890
            DKISVRWNLGPVNFIKE+W THVK+LAVRR+Q+      Q             ++     
Sbjct: 2850 DKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGEPSPLVSSEELEM 2909

Query: 2891 -------------------KFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFT 2931
                               KF Y+ L+EPQIE+P+I+DL DATPP+EWFGVNRK+FP+ T
Sbjct: 2910 LRSESSNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVT 2969

Query: 2932 HQTAVIPVQKLVYLAEKQYVKILDDT 2957
            HQTA+I +QK+V++A+K+Y K+L D+
Sbjct: 2970 HQTAIILIQKIVHVAQKEYAKVLGDS 2995

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2402 bits (6224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1204/2580 (46%), Positives = 1701/2580 (65%), Gaps = 66/2580 (2%)

Query: 415  NNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTL 474
            N  APP+  ++ Q+   SI YGPWA R + ++QR+ SP+VSRT +      PG  R YT+
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 475  FRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVC 534
             ++++SI ED++WR+PTRE SKD +FL+ Y +T++  R FGW DL F +++ A F IS  
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 535  PTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQ 594
            P V G+ N  ++ F + E+RSSVNHDI  +SK + +D DIGYPLGWN +  W     S Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 595  LEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNP 654
            LE F LREH+ L+ADT SDFS+G+PTPYE FRP +YKV+W   GYS YLNVNDHNI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 655  LDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMK 714
            LDFNENCY+S+HGD   I V +PR  I  TYTDI ++ISTPMFR++LNTPPWNTLNEFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 715  HKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFG 774
            +KE+GR YDFT +G+Y++YS+LDIDNVD+L IEC++    L  YGFV+ YL NV+MNYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 775  EFFNFVTSEEYTGVLGARDVGDVTTKS--SVVDLASTVDSGYQNSSVKNNSEAKG----- 827
            EF +F+T+EEYT ++   D   V+T +  SV+   ++V S   NS    ++ +K      
Sbjct: 950  EFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSETNSV-SNVSNSQHNPDNSSKSNIIDP 1008

Query: 828  ----PMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNY 883
                P+++ D+KR  NETDIWFTFSVW GAL+LPE +Y+ DPCIAL F EL++DFR+C+Y
Sbjct: 1009 LYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNCDY 1068

Query: 884  YMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEP 943
            Y+D++A L+GTS KR + K  N++F+ +  N   + +EHGS+S+++IHGHRMYG PPT P
Sbjct: 1069 YLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIKNLEEHGSVSNISIHGHRMYGAPPTSP 1128

Query: 944  TYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHA 1003
            +YF  W +++ +LSI+SD+ FI+GF S   K+GF +++L+NILLYD   +D+MTS+TVH 
Sbjct: 1129 SYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMTSVTVHG 1188

Query: 1004 ERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDM 1063
              I I + D    +Q +++ + I F  I+F N+ YS RID++VP L  +     G  +D 
Sbjct: 1189 TGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAF-FDNGSSMDK 1247

Query: 1064 SFL-KFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLY 1122
            + L +F+TK+ FTNF Q KD +    +Q+++I  +DS +HRCSFLL    Q+S  Y +LY
Sbjct: 1248 TCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLLYHELY 1307

Query: 1123 GXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSFAETP--STVEPSKA 1180
            G                     FII+D +G +   + +          TP  S+ +P K 
Sbjct: 1308 GGITPSSSVPPLPIPVQAETIAFIIDDFLGPFG--INSTELLGSISTSTPIHSSNKPLKP 1365

Query: 1181 SFTEDDNDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYS 1240
              +   +  E+  S   P      G     NY++D+SYI LDI+PL F +  + L++ YS
Sbjct: 1366 PSSSVIHPIESMQSHLVPSQSVTHG-----NYIIDISYITLDINPLFFTYASNFLDEFYS 1420

Query: 1241 ENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQ 1300
            EN+++ +D IE+ IV RL    E + S++NI + I YL+  + +   EG ELY+D+ID +
Sbjct: 1421 ENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELYVDQIDLE 1480

Query: 1301 MREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEIWSSTE 1360
            + +K+ +K  T  L E+A L+R  ++R ++N+KK  +  ++RPPALSL LEG+E WSST 
Sbjct: 1481 VSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTA 1540

Query: 1361 GRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISEL 1420
              QVNSLN++S+DIT+DESQ+EWL  Y +     + E+  S  SIQ      + +L+S+L
Sbjct: 1541 SSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDL 1600

Query: 1421 TAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKV 1480
            T ASEYYQISHDPYVITKPA++MR+SKGHVR+NRSW+I+TRLRHI TYLPDDW+ ++ + 
Sbjct: 1601 TLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEE 1660

Query: 1481 LKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCT 1540
            ++ +     +D+ +IF++VFS WRNWE SDVARSYIY K+F +++E   +  ++  +K  
Sbjct: 1661 MRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKLQTTVKLN 1720

Query: 1541 MGSFYLTVYGEGYEVEHNFVVADANLVVDLT------PPVTSLSLNREETIEITGRIGSV 1594
            + S + T+Y  GY ++HN ++  A ++++LT      PP+    LN      +TG +GS+
Sbjct: 1721 LNSIFFTIYSTGYAIDHNIILTKAVILLELTTETAVSPPIEKSILN------MTGSLGSI 1774

Query: 1595 KGKFSDRLLKLQDLIPLVAAVGEDDKSDPK-----TELSKQFRMNTVLLVDKSELQLVMD 1649
            KG+FSD+ L+L +LIP  +   ED KS  +     +E S  F ++  LL +   LQL M 
Sbjct: 1775 KGEFSDKFLRLLELIPDFSK-EEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMG 1833

Query: 1650 ETKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILA 1709
            +T L +    G++S L E    S   + S   + +KSE+ LKH   I+ E QL    +++
Sbjct: 1834 DTTLSNNVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHLGLIS 1893

Query: 1710 TTEAWSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRESALXXXXXXXXXXXXXXXSQ 1769
            T       P ILIN + ADLHF++++STE+ V  I +I E ++               ++
Sbjct: 1894 TGIYTPICPVILINLRSADLHFKSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTK 1953

Query: 1770 FVGQKINTV-----LTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDT 1824
             V QK   +     + C  S VS+E+  +SPFY+R+E KQLD+YFN+ G  EIL+S+WDT
Sbjct: 1954 -VDQKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDT 2012

Query: 1825 DFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQ 1884
            D F+TSH TKEQY RFS+ DI+I      E   ++ V +S S++KLTFSEPRRI  SFLQ
Sbjct: 2013 DIFVTSHHTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLVKLTFSEPRRIFASFLQ 2072

Query: 1885 DEKLASQGINXXXXXXXX--XXXXNIPKKEKQVPA--LMINWTLDTSISYFGILIPVAST 1940
            DE++  +                 N+ K    VP       W L+ +I+YFGIL+P+AST
Sbjct: 2073 DERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIAST 2132

Query: 1941 YFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVS 2000
            +FV ELHMLL SLTNT   +     +++GQ S+ENILFLI +RSLP+ LSK++DFSI++S
Sbjct: 2133 FFVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKLVDFSIRIS 2192

Query: 2001 TLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMF- 2059
            TLQ+T  + +S Q+ESSHFR+C SP+SL+ ++WG  +L +   YY  H     WN+    
Sbjct: 2193 TLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLSSHK 2252

Query: 2060 TGKSDKPKEIPLN-FRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFT 2118
            TG      E PLN FRSIHILSY FCIGW+        PG M GY+RLFSAYE+++GK T
Sbjct: 2253 TGTKSSTSESPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLT 2312

Query: 2119 VVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALD 2178
            +++ + SV N N+S+ FFS+G EK+++NRSFLP+MQI YW K     KD F R HG+ALD
Sbjct: 2313 LIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALD 2372

Query: 2179 VNFVPSFMDVIDSTLQSMRAFQELKRN--ILDVSENSHSEDSNIYAASSVENAPSSLAPF 2236
            V+ + +F+++I+   +S + F++ +++  + ++ +  H E  +I + ++ E  P+    F
Sbjct: 2373 VDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHE--HIKSENATEFVPT----F 2426

Query: 2237 LNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIR 2296
            L++I S+N  FKY+GG  RV++ +D+E  S PS E+ +P V+I   YKH +D  +PH +R
Sbjct: 2427 LSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPHWLR 2486

Query: 2297 TLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQFD 2356
             +I +  +HN LY+ CAP ++EF ES+Q++++    + K + +K +  N  YKR+L  FD
Sbjct: 2487 CVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRILAPFD 2546

Query: 2357 VAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIK 2416
            +A ++ +AKQ LS SCEP AKVQA+VG +SFLF ++T     E PL  +L +     S++
Sbjct: 2547 IAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQ 2606

Query: 2417 HIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRF 2476
            HIFS+E S SF + F+DLT +FT P   ++Y +GL+SD+++FFN+KQ QNL LFLDIW  
Sbjct: 2607 HIFSKEASASFSLNFIDLTFIFTQP---TLYCVGLISDIDIFFNMKQQQNLLLFLDIWHL 2663

Query: 2477 SSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISL 2536
            S  +  RP ++                   G  IPW F +IFTNV+ D+ LGP+LG++S 
Sbjct: 2664 SESIGIRPNRKKRKHKKHKGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSA 2723

Query: 2537 RTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTH 2596
            + ++TW  +D Y +KRQ+L  FTDG+ L S GRLSG+ +++NA W  EV ++  +     
Sbjct: 2724 KLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNS 2783

Query: 2597 PLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIIL 2656
            P+V+  ++I  +A+K AFDYHMF+I  +NNIHF+LH+E+D +G LPDLL  +   +EI +
Sbjct: 2784 PIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDLLLTTLLCEEISI 2843

Query: 2657 SSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDL 2716
             ST LVA+NILDIYNTI+R RQD K SY ETL +SN  ++R  + Y DIL+SL LLRTD+
Sbjct: 2844 CSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDV 2903

Query: 2717 SVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSK 2776
             + +S L++QISPISLFD EVLV+ ID +S RSET S  KLKT L+LQV + S ALST+K
Sbjct: 2904 QIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAK 2963

Query: 2777 EELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDK 2836
            EELDEE    I++ DYM YASKI GGTI+ IPKL V MTT Q+  +N +EY F C F  K
Sbjct: 2964 EELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGK 3023

Query: 2837 ISVRWNLGPVNFIKEMWTTHVKALAVRRSQIAN--ISFGQTXXXXXXXXXXXXTASKFNY 2894
            +SVRWNLGPVNFIKEMW THVK+LAVR+++I        +                KF Y
Sbjct: 3024 VSVRWNLGPVNFIKEMWATHVKSLAVRQARIEEPVEYSSEELESSPESIYLEPAQPKFTY 3083

Query: 2895 IALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            +AL EP IE+PQI+DL DATPPMEWFG+NRK+FP FTHQTAVI VQKLV+  EK+Y KI+
Sbjct: 3084 VALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKII 3143

 Score =  187 bits (475), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 124/172 (72%), Gaps = 9/172 (5%)

Query: 9   GVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAKVKINVET 68
            V L+ +K FSWVFLV WILT + CL M FY+ R++AY ++FIL+WLLW+  KVKI+ E+
Sbjct: 9   SVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHCES 68

Query: 69  LRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKA--ELIDNNK-----SPS 121
           +R+SLL  RI FK+L +I ++ TISILEG I W+YWLLN R +  EL    K     +P 
Sbjct: 69  IRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYITPG 128

Query: 122 KN--NVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEH 171
               N++LPCKF  +CEG EIF+YN+T AY+N+I+  S DE+ K++++L++H
Sbjct: 129 SGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLHKH 180

 Score =  152 bits (384), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 117/190 (61%), Gaps = 12/190 (6%)

Query: 221 LKFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKE-RVDLYRNKTQMEFKN 279
           L F P  L  ++GS++ GNKFTPS++I+SY+S EGIVDVLP    RVDLY+ K +++F+N
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 280 FEISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVS----KRTKKNTRSS 335
           FEI +K NI Y+D    K       +S+LW  F  +  ++  P+       R  KN+   
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417

Query: 336 NDS------FYQKWKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISY 389
            D+      F +KWKGLSLYK  +   + N  + IEFD  NHEYA++ SI+K P++  + 
Sbjct: 418 EDNIFEDEDFEKKWKGLSLYK-DAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476

Query: 390 DVDVPGVVPH 399
           + D+PG+VP+
Sbjct: 477 EYDIPGIVPY 486

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2323 bits (6019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1218/3064 (39%), Positives = 1840/3064 (60%), Gaps = 142/3064 (4%)

Query: 5    SQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAKVKI 64
            ++   V L+ ++ FSWVFLV WIL +VA  T VFY+ +++ + ++F  EWLLWK   +K+
Sbjct: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65

Query: 65   NVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAE------------ 112
             +E++R+S L G I FK++ +I +D TISILE S+TW+YWLLN RK+E            
Sbjct: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125

Query: 113  ----LIDNNKSPSKN----------------------------------------NVKLP 128
                ++DNN    ++                                        N KL 
Sbjct: 126  NGDDMLDNNTIHDRSNNDNNDNNDNNDNNDNNNNNDNNDNNETNNYNDIDYDYNKNKKLD 185

Query: 129  CKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSD--------- 179
              F + C G EIF+YNR  AY+ +I   SK+E+ +F  +L +H   + F +         
Sbjct: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245

Query: 180  --------------GSSADKLDED-----LSESAYTTNSDASIINDRDYQETDIGKHPQF 220
                          GSS     E      +S  +   +SD S I++R+     I +    
Sbjct: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHIMRKLH- 304

Query: 221  LKFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNF 280
            L  LP+++N ++G++ +GNKFT S++++++    G++D   P  ++D+++NK   E  + 
Sbjct: 305  LDILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDI 364

Query: 281  EISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFY 340
            ++SIK+NIGY+  +  +F    G ++++W     VL L+    +    +      + +F 
Sbjct: 365  DMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFV 424

Query: 341  QKWKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHG 400
            +KW GL LYK +   +     DD++FD  NHEYAK ++  K P++  S + D+PG+VPHG
Sbjct: 425  KKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHG 484

Query: 401  AHPTISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKP 460
            +HP +S   GPD+GN+ +PP F +D+Q+   SI +G W  R +  L+ ++ PV+S+  KP
Sbjct: 485  SHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQKP 544

Query: 461  IKKLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLR 520
            + KL PG  RV+++F  ++S+ +D++ R+PTRE SKD++FL+ Y ET +++R FGW+DL 
Sbjct: 545  LNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWIDLS 604

Query: 521  FCKDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGW 580
            F K +    NI + PT  GF+N     F E E+ +SVNH++L KS   NI  +IGYPLGW
Sbjct: 605  FKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPLGW 664

Query: 581  NSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYS 640
            N    WI N+ S+QL+ FLLREHITL++D + DFS  +PTPYELFR F Y +N ++ GYS
Sbjct: 665  NDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGGYS 724

Query: 641  IYLNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMM 700
             Y NVND NI+NNPLDFNENCYLS HGD    ++T+P  S+   Y  ISYEI TPMFR+ 
Sbjct: 725  FYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFRLF 784

Query: 701  LNTPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGF 760
            LNTP WNTL+EFM++KE+GR++DF + GTYL+YSELDIDNVD+L I+  SNSTVL+C+GF
Sbjct: 785  LNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCFGF 844

Query: 761  VMRYLTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVK 820
            V++Y+ N + NYFG F  F+T+EEY+ ++   +V D     +  DL S ++   +  S+ 
Sbjct: 845  VIKYMMNFQANYFGSFIKFITTEEYSELI-RNNVNDNLGSINTNDLTS-IEGLQKMDSIT 902

Query: 821  NNSE--AKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDF 878
            N+ E   +  +KRSDL RT NETDIW  F V +GALILPE +Y+ D C++L F EL ++ 
Sbjct: 903  NDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGELFINM 962

Query: 879  RSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGL 938
            R+CNYYMD+   L   ++ R      +E+F++I+  N +   E G++SD+TIHGHRMYGL
Sbjct: 963  RTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRSSSVE-GNISDITIHGHRMYGL 1021

Query: 939  PPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTS 998
            PP E TYFCQW IN+G   IDSD+ F+  F  S  KIGF  ++ EN LLY+++T++DMT 
Sbjct: 1022 PPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVNDMTL 1081

Query: 999  LTVHAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMG 1058
            L+V  E +++ L DP++++++ I A SI+   IDFENE Y++R+DV   +   SL+ +  
Sbjct: 1082 LSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLDSLKI 1141

Query: 1059 DGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTY 1118
            D    + L   TKL  TNF +  +       QRK+I  HDSPYHRC FLLP  +Q+S +Y
Sbjct: 1142 DSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQESSSY 1201

Query: 1119 QKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSFAETPSTVE-- 1176
            ++LYG                     FI+E I+ +Y+  L + +  + S     ++V+  
Sbjct: 1202 KELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNSVDTT 1261

Query: 1177 PSKASFTEDDNDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDP-LLFVFTKSLL 1235
            P K SF       +   + F+    TED   E DN+VV+V Y+ + ++P ++F   K   
Sbjct: 1262 PLKDSF-------DMQITNFQNILTTEDP-YETDNFVVNVKYLTVTVNPDIVFTIEKFST 1313

Query: 1236 EQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLD 1295
            E     +M   +D IE+ IV RLS+L+E I+S  N+++++  ++  W          Y++
Sbjct: 1314 EFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVCFIGTYIN 1373

Query: 1296 RIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFEI 1355
             + +++ ++S   N      ++  L + ++VR+ +        S+DRPP LSL LEGFE 
Sbjct: 1374 MLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEA 1433

Query: 1356 WSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTE 1415
            WSST  +Q+ +LNLTS DIT+DE Q+ WL  Y   Q  L  ++  S   I D + S +  
Sbjct: 1434 WSSTTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKT 1493

Query: 1416 LISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQN 1475
             I+ L  A E YQI HDPYVITKPA ++RLS  H+RENRSW+I+T+LRHILTYLP+DW++
Sbjct: 1494 FITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPEDWED 1553

Query: 1476 NIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKK 1535
             +D+    ++     +A + F++VFS WRNWE SD+ +SYIY  +F    E+  + +++ 
Sbjct: 1554 RLDEEDLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFV---EEVSKRILQN 1610

Query: 1536 LLKCTMGSFYLTVYGEGYEVEHNFVVADANLVV-DLTPPVTSLSLNR--EETIEITGRIG 1592
             +K  + +FY T+Y   Y  + NF++  AN+++ +    V  + L R  EE +++  +IG
Sbjct: 1611 SIKVFLETFYFTIYSRNYSADQNFLITKANILINNEADQVNEVDLIRKQEEIVDVVTKIG 1670

Query: 1593 SVKGKFSDRLLKLQDLIPLVAAVGEDDKSD-PKTELSKQFRMNTVLLVDKSELQLVMDET 1651
            S+K +F++ +LKL+  I  +     D KS+  K  ++K F++N   + D  +       +
Sbjct: 1671 SIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNGQFYNS 1730

Query: 1652 KLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATT 1711
             L SR     +   +EN  +S++ +GS V ++ ++ + LKH + IL + Q+R+     T 
Sbjct: 1731 SLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLFASTTA 1790

Query: 1712 EAWSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRE-----SALXXXXXXXXXXXXXX 1766
            E  S   +++IN +C++LHF+++  TE  V AI  I+      SA               
Sbjct: 1791 ELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTDNINTE 1850

Query: 1767 XSQFVGQ-----------KINTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSN 1815
             +  V +           K N  L+  F+NVSSEI  L P Y++HE   ++I +N    +
Sbjct: 1851 HTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINID 1910

Query: 1816 EILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEP 1875
            E+L+ + DTD ++ S  TKEQY R S+  +E+   +      LI+++IS S++KLT S+P
Sbjct: 1911 ELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKLTTSDP 1970

Query: 1876 RRIVNSFLQDEKLASQGINXXXXXXXXXXXXNIPKKEKQVPALMINWTLDTSISYFGILI 1935
            RR++ SFLQDEK     +             N    E    +    W ++    Y G+L+
Sbjct: 1971 RRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSY--EWIVNFKSKYMGVLL 2028

Query: 1936 PVASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDF 1995
            P+ +TY+VFELH  L +++N          K  G  S ++I+FLIK++S+P   SK+LDF
Sbjct: 2029 PIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKILDF 2088

Query: 1996 SIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPN--I 2053
            SIK+ST +   + ++SF++ESS FRVCL+P SL++ MWG ++LL L + Y      N  +
Sbjct: 2089 SIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYYDQSTVNFFV 2148

Query: 2054 WNIKMFTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERD 2113
            +N     G ++  KE   + RS HILSY F IGWL+Q    + PGL+LGYNRLFS YE +
Sbjct: 2149 FNDNNIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDN 2208

Query: 2114 FGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFH 2173
             GK T+VD FFS+ANG++  TF+S G+E  K+NRS+LPN+QI YW K   ++K  F +FH
Sbjct: 2209 HGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIKFH 2268

Query: 2174 GEALDVNFVPSFMDVIDSTLQSMRAFQELKR---NILDVSENSHSEDSNIYAASSVENAP 2230
            GE LDVNF  +F+++I+ST++S+  FQ LKR   N L  ++    E SN    S++ N  
Sbjct: 2269 GETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSN----SALTNIK 2324

Query: 2231 SSLAPFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKV 2290
                P    ++ VN  F YDGG+FR+++   +  K EP+  IKSP V I  +Y + E ++
Sbjct: 2325 ---GPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKEL 2381

Query: 2291 RPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSPQNVDYKR 2350
            + H I  LI ++PT N L +GC P L +F   ++ +++    + + N        ++   
Sbjct: 2382 KKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPINITS 2441

Query: 2351 LLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEH 2410
            LL+ FD+  KL S  Q ++L CEPKAK+  DVGF SF FS+ T   +   PL+ SL +  
Sbjct: 2442 LLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISLKIND 2501

Query: 2411 TKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLF 2470
             K S+KH FS E S SFEV  +D+ ++FTHP+V   +G GLV D+ + FN+KQ QN+ +F
Sbjct: 2502 IKTSVKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQFQNISIF 2558

Query: 2471 LDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPS 2530
            LDIW  S     +  ++  N  +D  S      +   + +PW F  I TN++GD+++G +
Sbjct: 2559 LDIWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNINGDINMGST 2618

Query: 2531 LGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPE 2590
            LG ++L  QRTW++TDH+  KRQLLH FTD + ++SEGRL G  E+ + +W  +V +  +
Sbjct: 2619 LGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDITWKLDVNYVDK 2678

Query: 2591 KGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFS 2650
                  PLV    ++  +++K AFDYHMFLI T+ ++ F + +EKD   +LPDLL V+ +
Sbjct: 2679 YKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDILPDLLTVNLT 2738

Query: 2651 SDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLK 2710
             DEI + +TALVA+NILDIYNTI+R RQDNK SY+ETL +SN    ++  LY+DIL+SL 
Sbjct: 2739 CDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKPLYEDILKSLN 2798

Query: 2711 LLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSA 2770
            LL+T LS +I  L +QISP SL+D EV+++R+  V   +ET +G+K+KTDL+++V + + 
Sbjct: 2799 LLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKTDLEMRVYNATL 2858

Query: 2771 ALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFA 2830
            +L++  +EL EE  A ++ + Y+ YAS +  G I +IP+L ++MTT Q      L+Y ++
Sbjct: 2859 SLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQNADNMILQYTYS 2918

Query: 2831 CSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTXXXXXXXXXXXXTAS 2890
            CSF  K+ V WNLGP+NFIKE+W THV++L VR  Q    +   +              S
Sbjct: 2919 CSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMG-NHDISLENEGDTDESVKVLS 2977

Query: 2891 KFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQY 2950
               YIALEEP IE+PQI+DL DATPP+EWFG+NRK FP  THQ+ ++P+QKLV +A+K+Y
Sbjct: 2978 NIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEY 3037

Query: 2951 VKIL 2954
             K+L
Sbjct: 3038 AKVL 3041

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 2213 bits (5735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1212/3056 (39%), Positives = 1803/3056 (58%), Gaps = 160/3056 (5%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            M+A SQ + +P++ + +FSWVFLVDW+L +V  L++VFY GR  AY ++ +++W+LW+R 
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120
            KVKIN+++L++S LGGR+ FK+L+VI KD TIS L+GS TW+YWLLN RK  L +  KS 
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSG 120

Query: 121  SKNNVK---LPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPF 177
             + + K   L C+F LE +G E+FIYNRTVAYD ++  ++KD+++ F+K+       E  
Sbjct: 121  EEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKKFF------EGG 174

Query: 178  SDG--SSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSL 235
             D   SS +KL ED + ++ ++ S+    NDR++QE D       L+FLPI L  +RG++
Sbjct: 175  EDSLHSSEEKL-EDETLASDSSVSNVDSTNDRNFQEQD--SRSMLLQFLPIHLKVNRGAV 231

Query: 236  LLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIG 295
            LLGN  TPSVMI+ YES EG+VDV    E++DLY+ +  ++F N ++ IK NI + D   
Sbjct: 232  LLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENP 291

Query: 296  LKFKLDTGKVSKLWKAFIRVL-QLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKA--- 351
            +K  +   ++S++WK F ++  + +S  +     +K     +  F++KW+GL+LY     
Sbjct: 292  IKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNV 351

Query: 352  -----TSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTIS 406
                 + G+ +  + +++  D+ NHEYAK+T ILK  KV ++Y  D+PG+VPHGA  T+ 
Sbjct: 352  TTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTME 411

Query: 407  DIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPP 466
              DGPDVGN+GAPP+F+LD +++G +ICYGPWA RQ+ +LQR+L P+VSR A P+KKL P
Sbjct: 412  QRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTP 471

Query: 467  GSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTY 526
            GSRR+YT F +++ + ED  WRIPTRE+SKD +FL+ Y+E+  + RPFGW+D++  K+T 
Sbjct: 472  GSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETD 531

Query: 527  ANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIW 586
                + +CPT+ GF+N    H V+ EIRSSVNHDI  K+    I  D+GYPLGWNS+A W
Sbjct: 532  LFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQW 591

Query: 587  IINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVN 646
            +    S+Q+  F LR+HI L++D   DF +G PTPYELFRPFVY+  W ++ YSIYLNVN
Sbjct: 592  VFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVN 651

Query: 647  DHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPW 706
            D NI+NNPLDFNENCYLSLHGD L ID +V  ++I G  T ++Y I TP F + L+TP W
Sbjct: 652  DANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSW 711

Query: 707  NTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLT 766
            +TL+EFMK+KEVGR+YDF + G+Y  +S++D+ N+DT++IEC S  T L C GFV+RYL 
Sbjct: 712  STLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLM 771

Query: 767  NVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSS---VKNNS 823
            N+ MNYFG+F +F T+EEYT  L  +    + T+ + V   +  D   Q SS   V N+ 
Sbjct: 772  NINMNYFGDFIHFKTTEEYTRELQEK----LETREAEVIADNVSDESSQMSSTSFVTNDK 827

Query: 824  EA---------KGP-MKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSE 873
            E          + P +KR+DLKR  NE D+WFTF V +G L+ PE IY    CI LHF  
Sbjct: 828  ETTEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDS 887

Query: 874  LVVDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGH 933
            L VD R  NYYMD+ A L  T IKRH       +FD +R   G  +   G LS+L IH H
Sbjct: 888  LDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAH 947

Query: 934  RMYGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETI 993
            RM+GLP  E TYFC+WD  +G L IDSD++F KG   +F KIGFGY D EN+L+Y+    
Sbjct: 948  RMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKP 1007

Query: 994  DDMTSLTVHAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKI-- 1051
             DMTSLT+  + I   + D        +  + I  ++IDFENE YS ++  K+P +K+  
Sbjct: 1008 IDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLV 1067

Query: 1052 ----SLNCVMGDGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFL 1107
                S N V G         FET L    F Q +D D  R+ QR +IT HDSPYHRC+FL
Sbjct: 1068 SEKSSKNEVQG--------LFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFL 1119

Query: 1108 LPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDS 1167
            LP+ YQ +  Y KL+G                      I E ++G++    E  +   D+
Sbjct: 1120 LPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCS---DA 1176

Query: 1168 FAETPSTVEPSKASFTEDDND----EEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDI 1223
                 + +    +SF +        +E SS      ++  +   E D++++++   ++ I
Sbjct: 1177 NYSKETAITEENSSFIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAI 1236

Query: 1224 DPLLFVFTKSLLEQLYSENMVQVLDDI----EIGIVKRLSNLQEGITSISNIDI------ 1273
            +P     ++  L  +Y +  V  +DDI    EI IV++ S      ++++N+ +      
Sbjct: 1237 NPS----SEKCLLSIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAPKIC 1292

Query: 1274 ----------HIAYLNLIWQETGEEGFELYLDRIDYQMREKSLEKNRTTKLLEVAALARV 1323
                       ++  + ++ E      +L   +I  Q     LE        EV +  + 
Sbjct: 1293 FTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTE-----EVTSSLKA 1347

Query: 1324 KTVRVTVNQKK-NPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQME 1382
             ++   +NQ++  P       P  S+  E  E WS +     NSLN  + D  ++ SQ+E
Sbjct: 1348 SSINFFINQQQLKPKTLLKARPVFSIVFEELEFWSDSSESSKNSLNARAVDFFVNHSQLE 1407

Query: 1383 WLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPAFI 1442
            WL  Y         ++  SF   +    + + ELI     AS  Y I HD  VITKPA+I
Sbjct: 1408 WLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYI 1467

Query: 1443 MRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVFST 1502
             RLSK H+RENRSW+IITRLRHIL YLP  W    ++ LK+ ++   +DA++ F+ +FS 
Sbjct: 1468 TRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSN 1527

Query: 1503 WRNWEFSDVARSYIYGKLFSTDNEKHKQNLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVA 1562
            WR+WEFSDV + YIY ++F + + K K  +     K  +     ++    +E E   VV 
Sbjct: 1528 WRSWEFSDVQKCYIYKRVFLSRSMK-KNRITGADFKVNLERISFSLSSSTHEDEDFMVVK 1586

Query: 1563 D-----ANLVVDLTPPVTSLSLNREETIE---ITGRIGSVKGKFSDRLLKLQDLIPLVAA 1614
            +     +N +++ + P ++ +     + E   I+  I S++G   D ++KL  +   ++ 
Sbjct: 1587 NLKSVISNELIESSLPPSAKNTEDSASTEKMIISCNIKSIRGDLGDNIVKLVRMYDGLSN 1646

Query: 1615 VGEDD------KSDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWEN 1668
            + + +      K D K +L     +  VLLVD+++  + +D  +L+ R+   R S   E 
Sbjct: 1647 LSDTNLKTTSVKHDVKPKL-----IQGVLLVDRTDTNIHLDGKRLILRSFRNRFSTFMER 1701

Query: 1669 LKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCAD 1728
            +   +    S+      SE W++H S +L E+ L+D ++  +   +       +  +   
Sbjct: 1702 VPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQSLFHEHLITKVVLRSGG 1761

Query: 1729 LHFRAMSSTEQTVTAITEIRESA------LXXXXXXXXXXXXXXXSQFVGQKINTV-LTC 1781
            L   AM+STEQ +  I  I+ S       L                     ++NTV L  
Sbjct: 1762 LSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDA 1821

Query: 1782 YFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFS 1841
              S  S  I PL+PF I      ++++  K       I+I D D  + S ++K++YL+FS
Sbjct: 1822 TLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFS 1881

Query: 1842 FGDIE-IKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXX 1900
               +  +     ++    +NV ++  + KLT S+PR  + S ++DE LA +         
Sbjct: 1882 QSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLA 1941

Query: 1901 XXXXXXNIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGM 1960
                  N  +K KQ     I W L  ++ Y GI++ + S  +V EL+ +L SL+N  +  
Sbjct: 1942 EKFPSKN-QEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISAR 2000

Query: 1961 LPEET---KVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESS 2017
               E     + G FSIEN+L LI    L   LSK++D ++ +   Q   D  Q+ Q+ESS
Sbjct: 2001 KYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESS 2060

Query: 2018 HFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGKSDKP---KEIPLNFR 2074
            HFRV L P SL +++W  ++   +   Y    +       +   K   P    E+   FR
Sbjct: 2061 HFRVALCPMSLTKVLWAINEFTRVSEAYKTRSS-------LLQHKKTAPTDISELSNKFR 2113

Query: 2075 SIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSST 2134
            SI ILSY FCIGW+F  G+ +DPGL+ GY RLF+AY++ +GK T++D++FS+A+G +S T
Sbjct: 2114 SIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDT 2173

Query: 2135 FFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQ 2194
            FFS G EKD++NRS+LP+MQI YWF + G+  + F R  GE LDVNF+ S + + +  ++
Sbjct: 2174 FFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVK 2233

Query: 2195 SMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVF 2254
            S++ FQELK+ ++D    + + +  + +    E AP  L P L+ IR+ N   KY GGVF
Sbjct: 2234 SIQTFQELKKTMVDPFATNKTTEKPVNS----EAAP--LDPILSKIRAFNCIVKYAGGVF 2287

Query: 2255 RVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAP 2314
            ++++ EDI+  S+PSFE++SP V +   YKH  D ++ H IR L+TVDP++NTL+  C P
Sbjct: 2288 KLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVP 2347

Query: 2315 LLMEFSESLQKMIKKHSTDEKPNFTKP-SPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCE 2373
            +L   ++ ++ M+K  ++  KP+     S   ++YK+LL  FD+A  +   KQ +SLSCE
Sbjct: 2348 ILSGMTKDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCE 2407

Query: 2374 PKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMD 2433
            PKAKVQADVGFE     + TN  D+  PL  S+ +EH +A+ +HIFSREVSTSF++  +D
Sbjct: 2408 PKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHID 2467

Query: 2434 LTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGI 2493
               + THP++I  YG  LVSD+ ++FN+KQLQ+L LFLDIW+  S +   P      KG 
Sbjct: 2468 AVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMP------KGG 2521

Query: 2494 DMHSLTSTSHVDL---------GTE-IPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWL 2543
            +  + + +SH  L         GT   PW +TLIF+N+ GD+DLGPSLGV+S+R  R+W 
Sbjct: 2522 NTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWA 2581

Query: 2544 ATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSL 2603
             +DH+ + RQ L  F + I L+S+GRL G   +    W SE+ W  + G    PL+S SL
Sbjct: 2582 ISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSL 2641

Query: 2604 NIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVA 2663
             +  +A+K +FDYHMFLI  + ++  +L+NE+D  G+L DLL VS +  +I L  TAL +
Sbjct: 2642 ELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALAS 2701

Query: 2664 ANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSL 2723
            AN +DIYNTI+RMRQDNK SY+ETL+DSN   ++     +++L SL LLRTDLSV I   
Sbjct: 2702 ANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLF 2761

Query: 2724 KVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEV 2783
             +Q+ P +LFD+EVLV++ + +S  ++T    K+KT L  Q+ +   +LS  K + +EE+
Sbjct: 2762 YLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEI 2821

Query: 2784 GASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNL 2843
             + I + +Y+ +A+K+ GGTI+  P + V MTT QE  +N +E L+  SF  K+ V+WNL
Sbjct: 2822 VSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNL 2881

Query: 2844 GPVNFIKEMWTTHVKALAVRR---SQIANISFGQTXXXXXXXXXXXXTASKFNYIALEEP 2900
            GP+NFI+EMW THV+ALA+RR    +  N SF +               +K+ YI LEEP
Sbjct: 2882 GPINFIREMWATHVRALALRRVHDMRDKNKSFFEDEHIEEKIKDVDL-GNKYVYIPLEEP 2940

Query: 2901 QIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKILDD 2956
            +IE+PQI+DLGDATPP+EWFGVNR+RFP  THQ+ V+P+QKL ++AE++Y ++L +
Sbjct: 2941 RIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1937 bits (5018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1096/3033 (36%), Positives = 1692/3033 (55%), Gaps = 153/3033 (5%)

Query: 4    VSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAKVK 63
             SQ + V L+  +DFSWVFLVDW+L +   L   FY GR++ Y ++F+LEWL WKR KVK
Sbjct: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61

Query: 64   INVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSPSKN 123
            I++++L++S LGGRI FK+L+V+ ++ T S L+GSITW+YWLLN RK      +++  K+
Sbjct: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKS 121

Query: 124  NVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSDGSSA 183
              KLPC+F +EC+GLE FIYN+T A+DN++N L +++ ++F+ +  ++S        +  
Sbjct: 122  VEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNS-----DKNTDE 176

Query: 184  DKLDED-------LSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLL 236
              +DED       L  S  + +S +  +NDR +Q  D    P FLK LP+E +  +G+++
Sbjct: 177  CSVDEDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPD--STPPFLKLLPLEYSVQKGAVV 234

Query: 237  LGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGL 296
            +GNK + SVM+LSYE  +G++D   P  ++DLY+ K + EF+ F IS+K N+  +    L
Sbjct: 235  IGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPL 294

Query: 297  KFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEA 356
            K  +   K+SKLW    ++      P  SK    + +    +  ++W+GL LY     E 
Sbjct: 295  KSFVKRSKLSKLWHRSYQLFFKTDSPS-SKNPANSAKDGTRNPLKRWRGLGLYWK---EE 350

Query: 357  KANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNN 416
             A   D  +FDL+ HEYA++T ++KC  + + Y  D PG+VPHGA PT   +DGPDVGN+
Sbjct: 351  DAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNS 410

Query: 417  GAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFR 476
            G PPD+++D+QI G S+ YGPW+  ++  LQ++ SPVVSR ++P+++L PGS+R+YT  R
Sbjct: 411  GPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLR 470

Query: 477  MNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPT 536
            ++I I  ++ WRIPTRE SKD EFL+ ++ET +E RPFGW+++   + +   FNI++CPT
Sbjct: 471  LSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPT 530

Query: 537  VEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLE 596
              GF N   +HFV+ EIR+SVNHDILL ++  ++   +GYPLGWN KA W+ +  S Q +
Sbjct: 531  ATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQ 590

Query: 597  AFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLD 656
             F+L++HITL+ D +SDF +G+PTPYELFRPF Y  NW   GYSIYLNVND NIVNNP++
Sbjct: 591  IFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANIVNNPVN 650

Query: 657  FNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHK 716
            FNENCYLS HGD L ++  VP+E+I G  T I+YE+ TP+FR+ +NTP WNTL+EFMK K
Sbjct: 651  FNENCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDK 710

Query: 717  EVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEF 776
            EVGR+ +F++ G+YL +S+LD+DN+DT++IEC S ST L CYG+V+RY   VKMNYFG+F
Sbjct: 711  EVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDF 770

Query: 777  FNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKGPM--KRSDL 834
             +F T+EEY   L   +    TT  S  ++        ++SS +     K P+  K++ L
Sbjct: 771  VHFKTTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMDEDSS-QREQHIKDPLTAKKTSL 829

Query: 835  KRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGT 894
            KR  NE D+WFTF V +G  ILPE +Y  D C AL F  L +D R  NYYMD+ A L   
Sbjct: 830  KRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPL 889

Query: 895  SIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLG 954
             I+R +     EVF+   R     E   G LS L IH HRM+GLPP E TYFC+WD +LG
Sbjct: 890  RIRRLIDCGCEEVFEQKGR-ALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLG 948

Query: 955  DLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPV 1014
             L + SD+ F  GF +++ K+GFG+ D ENI+ Y    I DMTS+T+  + I    +   
Sbjct: 949  TLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIK 1008

Query: 1015 MKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFETKLRF 1074
             ++   ++A+ I     D EN  YS R+D+ V  L  S+  +  +  + +   F T ++ 
Sbjct: 1009 DETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTASI--IDKNKSNKAIASFMTSIKI 1066

Query: 1075 TNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGXXXXXXXXXXX 1134
            +NF Q +D+     +Q+ +I  +D+P+HRC FL+PL  Q+S  Y+ L+G           
Sbjct: 1067 SNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSL 1126

Query: 1135 XXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSF----------AETPSTVEPSKASFTE 1184
                         E++   +   L+A N  KD             +  S+++  K     
Sbjct: 1127 AVPLQT-------ENVKAVFQGYLKAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQLQP 1179

Query: 1185 DDNDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMV 1244
              +D  + SS F    F      E +  VV++    L I P  +    + +EQ + + + 
Sbjct: 1180 ILDDNTSLSSSFSDPTF------EHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIE 1233

Query: 1245 QVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREK 1304
            Q +D+IE+ +V     +     +  NI + +  L+++++   +E       ++     + 
Sbjct: 1234 QFIDNIELDVVLHFIKMASRQKNYKNIRVLMPTLDVLFETYNKENTYDVEGQVKVTANQV 1293

Query: 1305 SLEKNRTTKLL---------EVAALARVKTVRVTVNQK--KNPDLSE-DRPPALSLGLEG 1352
            SL+ +    L          +  +L +++++ + V  K  K    +E D   A    ++ 
Sbjct: 1294 SLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFNKLDKKTKFAEMDENIAFGCSVKE 1353

Query: 1353 FEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSS 1412
             E WS   G   +SL L S + ++   +  WL  +     N  +++             +
Sbjct: 1354 LEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKA 1413

Query: 1413 KTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDD 1472
            + E    ++ AS+ YQI+HDP VITKPA+I RL   HVRE+RSWKI+TRLRHIL YLP  
Sbjct: 1414 EQEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTRLRHILNYLPTT 1473

Query: 1473 WQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFST---DNEKHK 1529
              ++I   LK  +Y   + A+  F+ +FS W NW++SDV + Y+Y ++F+    D   H+
Sbjct: 1474 LISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWDYSDVEKCYMYRRVFTNTLDDTVAHE 1533

Query: 1530 QNLIKKLLKCTMGSFYLTVY-----GEGYEVEHNFVVADA-NLVVDLTPPVTSLSLNREE 1583
             +      K   G+F L  +     G    +  N           D      S   N E+
Sbjct: 1534 SS-----TKIETGTFMLNFFDSINTGSDSVILKNLKAQRTLEACKDEAAEKRSNMSNAED 1588

Query: 1584 TIE--ITGRIGSVKGKFSD----RLLKLQDLIPLV---AAVGEDDKSDPKTELSKQFRMN 1634
             +E  ++  I   +   SD    +LL +++L       AAV E++K          F+  
Sbjct: 1589 DLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAAVKENEK-------LPAFQQY 1641

Query: 1635 TVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHAS 1694
            T  LVD+ ++QL+    +   ++ G  ++++ EN K   + A S        E  ++H +
Sbjct: 1642 TA-LVDRCDIQLLCGANRANLKSFGNTLTIVREN-KSEDADAFSTAFAWSWFEFGIRHRN 1699

Query: 1695 IILGEAQLRDFSILATTEAWSHKPTIL-INNQCADLHFRAMSSTEQTVTAITEIRES--- 1750
             IL +A  R  ++ A    +S K +   ++ +      +  S ++   T I  + ES   
Sbjct: 1700 TILLDAFSRSSAVGA--HGFSGKNSRRKLDLRAKKFRLKLPSESKHYCTFIDSLEESWNN 1757

Query: 1751 ---ALXXXXXXXXXXXXXXXSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDI 1807
               AL                +   Q     L    S+++++I  LS   I    K+L +
Sbjct: 1758 LRLALGPNTGFLEKPHSAATEKVAPQ---FALNIDISDLTTDISLLSSLAITKNFKKLTL 1814

Query: 1808 YFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIK-GGVSKEGYSLINVDISIS 1866
             + +  S+ + ++    D  + S +T +QYL+ S  +I        K   S   V +  +
Sbjct: 1815 AYEQSASSALKLAFETLDIDVFSTRTTQQYLKISQSNISFSLHRPKKNNASPPTVKLDSN 1874

Query: 1867 MIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXXN---IPKKEKQVPALMINWT 1923
            + KL   +PR I     +D   A   +             N   I  +         +W 
Sbjct: 1875 ITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSASWI 1934

Query: 1924 LDTSISYFGILIPVASTYFVFELHMLLLSLTN---TNNGMLPEETKVTGQFSIENILFLI 1980
                ++Y G+LIP+ ST ++ EL+ +   +T    TN      +  + G  S  +I FLI
Sbjct: 1935 FQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSAASIAFLI 1994

Query: 1981 KERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLD 2040
             +R LP  LS+V+DF++ +   + + +  +S Q+ES +FR+ LSP SL+R+++  ++L  
Sbjct: 1995 NDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILFLVNELSR 2054

Query: 2041 LGHYYTKHHAPNIWNIKMFTGKSDKPKEIPLN------FRSIHILSYKFCIGWLFQYGTG 2094
            L     +             GK  +  E+         FRS+ +LSY FC+GW+F     
Sbjct: 2055 LSELQKRQTV----------GKLPESVEVRETFRFRRAFRSVQVLSYNFCLGWIFDVNDS 2104

Query: 2095 SDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQ 2154
             +PGL+ GY RLF+A+E+ +GK T++D++FS+A G+TS  F++  N  +  NRSFLP+MQ
Sbjct: 2105 PEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSDDFYAHKNSFENPNRSFLPSMQ 2164

Query: 2155 ISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSH 2214
            I YW +  G   + F R +GE LDV F+   +DV    ++S+  F ELK+  +D  ++  
Sbjct: 2165 IRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDPFKS-- 2222

Query: 2215 SEDSNIYAASSVENAPSSLAPF--LNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEI 2272
                   A     +A S+ + F  L+ I+ V+   +Y GGVFR+Y+ +D++ ++ PSF++
Sbjct: 2223 ------VANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLYSLDDVQNEAGPSFQL 2276

Query: 2273 KSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIKK-HS 2331
            +SP V I   Y+        H +R  + V  +HNT++  C P+L E +  +++++K  + 
Sbjct: 2277 ESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMARDIRQLLKGFNR 2336

Query: 2332 TDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSV 2391
            + ++ +    S +++DY+  L   D++  +   KQQ+S SCEPKAKVQAD+GFE     V
Sbjct: 2337 SPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFEKLAVKV 2396

Query: 2392 TTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGL 2451
             TN+ D   PL  S+ +    A  +HIFSREVSTS ++  +    + THPD I  YGI  
Sbjct: 2397 FTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIHTYGIMH 2456

Query: 2452 VSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGIDMHSLTSTSH-------- 2503
            + +++V+FN+KQLQ+L +F++IW+  S + T+P   S       HS   TS         
Sbjct: 2457 IPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDS------EHSRALTSEEKPLVAKF 2510

Query: 2504 --VDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDG 2561
              V   T  PW F LI + + GD+DLG SLGV+SL T R W  TDHY +  Q L    + 
Sbjct: 2511 KKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQMEK 2570

Query: 2562 ISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLI 2621
            I L+S+GRL G   + N SW+S ++W   +G    PLV+  + +D+  +K +FDYH+ LI
Sbjct: 2571 ILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLILI 2630

Query: 2622 GTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNK 2681
             ++  +  +L N++D +G+  +LL V+ SS+   L  TAL  ANILD+YNTI+RMR+DN+
Sbjct: 2631 ASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKDNR 2690

Query: 2682 ISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVR 2741
             SY ETL DSN  ++R     KDIL SL  LRT+L VS+  + +QI P  LFD+EVL  +
Sbjct: 2691 KSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLTFK 2750

Query: 2742 IDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVG 2801
                  +S+    +KLKT L+ Q+  V  ALS  K +L E+  + I + +Y+ +A K  G
Sbjct: 2751 AKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKADG 2810

Query: 2802 GTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALA 2861
            GTI+ IP + + MTT  +  TN +E L++ SF  KI +RWNLG +NF++EMW THV+A+A
Sbjct: 2811 GTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRAMA 2870

Query: 2862 VRRSQIANISFGQTXXXXXXXXXXXXTASKFNYIALEEPQIEVPQIRDLGDATPPMEWFG 2921
            +RRS                         ++ Y+ LEEP IE+PQ +DLG+ATPP+EWFG
Sbjct: 2871 LRRSHNGQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFG 2930

Query: 2922 VNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            VNRK+FP  THQ  ++P+QKL ++AE ++ +IL
Sbjct: 2931 VNRKQFPGLTHQAMIVPLQKLAHIAETEWARIL 2963

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1903 bits (4929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1097/3012 (36%), Positives = 1673/3012 (55%), Gaps = 138/3012 (4%)

Query: 5    SQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAKVKI 64
            S+ R VP++  +DFSWVFL DW+L +   L   FY GR+  Y ++ ILE+L WKR  VK+
Sbjct: 3    SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

Query: 65   NVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSPSKNN 124
                       GR+ FK+L+VI +D T SIL GSITW+YWLL+ RK  L    +S S+  
Sbjct: 63   -----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSL----ESQSEKA 107

Query: 125  VKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFS------ 178
             KLPC+F +EC+GLE FIYNRT A+DN+++ L +++++  +K+ ++   P P +      
Sbjct: 108  AKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSD---PSPRATEETST 164

Query: 179  -DGSSADK--LDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSL 235
             + S+A K  L+  +S  + +T S    +NDR YQ  +    P FL+ LP+E +  +G+L
Sbjct: 165  ENDSAAQKSHLETSMSSPSASTES----LNDRTYQLPN--SMPSFLRLLPLEYSVQKGAL 218

Query: 236  LLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIG 295
            ++GNK T SVM+ S+E  +G +D   P  ++DLY+ K Q +   F++S++ N+ YD+   
Sbjct: 219  IIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEP 278

Query: 296  LKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTK-KNTRSSNDSFYQKWKGLSLYKATSG 354
            LK      ++ KL   +      V K  +S+ +K ++TR    +  ++W+GL LY     
Sbjct: 279  LKNLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLY----- 333

Query: 355  EAKAND--LDDI-EFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGP 411
              K ND   DD+  F+L  HEYA+++ ++KC  + I Y  D PGVVPHGA PT+  +DGP
Sbjct: 334  -WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGP 392

Query: 412  DVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRV 471
            DVGN GAPPDF+LD+Q+ G +I YGPWA  ++  +Q+V SPVVSR + P ++L  GS RV
Sbjct: 393  DVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRV 452

Query: 472  YTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNI 531
            +T  R++I I  D+ WRIPTRE SKD +FL+ YKET ++ RPFGW++L   + +    NI
Sbjct: 453  FTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNI 512

Query: 532  SVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMK 591
            ++CPT  GF N   +HF++ EIR+SVNHDILL ++  +I+  IGYPLGWN+KA W  ++K
Sbjct: 513  AMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLK 572

Query: 592  SEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIV 651
            S Q   F+L++HITL+ D LSDF  GDPTPY+LFRPF+Y+ NWE+ GYS+YLNVND NIV
Sbjct: 573  SHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIV 632

Query: 652  NNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNE 711
            NNP+DFNENCYLS HGD L I   VP++SI G  T I Y + TP+FR+ +NTP WNTL+E
Sbjct: 633  NNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHE 692

Query: 712  FMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMN 771
            FMK KEVGRA DF++ G+YL +S+LD++N+DT++IEC S  T L CYG+V+R+L  VKMN
Sbjct: 693  FMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMN 752

Query: 772  YFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGY---QNSSVKNNSEAKGP 828
            YFG+F +F T+EEY   L    V          +   T  +G    + ++ KN++     
Sbjct: 753  YFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVM 812

Query: 829  MKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIM 888
             K+  LKR  NE D+WFTF V +G LILP+ +Y  + C A  F  L +D R  NYYMD+ 
Sbjct: 813  AKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQ 872

Query: 889  AVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQ 948
            A L    ++         +F              GS+SDL IH HRM+GLPP E TYFC+
Sbjct: 873  AALSPVIVRNLSDCDPAHLFSG-SEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCK 931

Query: 949  WDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRI 1008
            WD ++G L I SD+  I  F  ++ K+ F + D ENI+ Y    I DMTS+  HA  IR+
Sbjct: 932  WDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRV 991

Query: 1009 SLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFL-K 1067
             + D  +    ++  E++    +DFENE YS R DV +  + +    V   G D S +  
Sbjct: 992  KINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQ---VKEGGKDGSLIGD 1048

Query: 1068 FETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGXXXX 1127
            F + L+ T F Q K+      +Q+ +I  +D+P+HRCSFLLPL  Q SD Y+KL G    
Sbjct: 1049 FSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVP 1108

Query: 1128 XXXXXXXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDN 1187
                              ++E I  E  T++       +      ++++     F     
Sbjct: 1109 GVSIPG------------MVEPITPENVTMI-----LDEFLKGEKNSLQMGNEHFCS-KK 1150

Query: 1188 DEEASSSGFKPGAFTEDGDD---EKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENMV 1244
            +E+  +  F  G  +   +D   E ++ VV +      I        +S  +Q YS  + 
Sbjct: 1151 EEDGYAFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVE 1210

Query: 1245 QVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYLDRIDYQMREK 1304
            Q++D  EI +V              N+ +      +     G +      D +D  ++E 
Sbjct: 1211 QLIDSNEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEI 1270

Query: 1305 SLE----------KNRTTKLLEVAALARVKTVRVTV-NQKKNPDLSEDRPPAL-SLGLEG 1352
            S++           +  + + ++ AL +V+++ + V N  +N  L       L S  ++ 
Sbjct: 1271 SVDISMREEPSPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQLCSTSIKD 1330

Query: 1353 FEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSS 1412
             E W ++E  + +S N TS D  +   + E    +  + A  +  +       ++    +
Sbjct: 1331 LEFWMTSEDIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKA 1390

Query: 1413 KTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDD 1472
            + +    ++ AS+ YQI HDP VITKPA+I RL   HVREN+SWKIITRLRHIL YLP  
Sbjct: 1391 QRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPS 1450

Query: 1473 WQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQ-- 1530
                I   LK   + +  +A  IF+++FS WR+WE SDV + Y+Y K F +  E      
Sbjct: 1451 LLAEIYGALKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGPL 1510

Query: 1531 NLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLTPPVTSLSLNREETIE---I 1587
            NL  ++  C+  +   + + EG  +    +      ++      + L+++     +   +
Sbjct: 1511 NLRVEVDSCS-ATVSDSTHKEGDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATDGNSL 1569

Query: 1588 TGRIGSVKGKFSDRLLKLQDLIPLVAAVGEDD-----KSDPKTELSKQFRMNTVLLVDKS 1642
            +  + +VK   S+  +KL     L  +    D     +  P  ++ K   M   LL+D+ 
Sbjct: 1570 SCSLKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILK--LMELALLIDRC 1627

Query: 1643 ELQLVMDETKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQL 1702
            E+++ +D      ++ G  +S    + + +     S+ +     E  ++H + I+ +A  
Sbjct: 1628 EIKISLDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFA 1687

Query: 1703 RDFSILATTEAWSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRESALXXXXXXXXXX 1762
            R  S+ +            ++     L  +  SST+     I  + ES            
Sbjct: 1688 RRGSLGSFISQSESTTLHRVHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNT 1747

Query: 1763 XXXXXSQFVGQKINTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIW 1822
                 S  +          +  + +SEI  LSP  I    K L + F K  ++ + + + 
Sbjct: 1748 RSKDLSPEMKNFSKVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVE 1807

Query: 1823 DTDFFMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLIN-VDISISMIKLTFSEPRRIVNS 1881
            + D  + S  T +QYL+ S   +E+   +  +   + + + +  ++ K    +PR I+ +
Sbjct: 1808 NFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIET 1867

Query: 1882 FLQDEKLASQGINXXXXXXXXXXXX-NIPKKEKQVPALMI---NWTLDTSISYFGILIPV 1937
              QD   A Q +                   +++V A  +    W     + Y G+L+P+
Sbjct: 1868 LTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPL 1927

Query: 1938 ASTYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSI 1997
             +T ++ E++ L  SL+            V G+ S+  I FLI ++ LP  LSKVL+F+ 
Sbjct: 1928 GTTSYISEINELSSSLSCDEAAEFSFPL-VHGELSVAGISFLINDKELPEDLSKVLEFAF 1986

Query: 1998 KVSTLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIK 2057
            ++   +   ++ +S Q+ES+HFR+ L P SL+R++  A         Y   H   +  +K
Sbjct: 1987 RIKLAKVAENSMKSLQIESTHFRIALCPFSLIRILSLA---------YEATHLSGLQALK 2037

Query: 2058 MFTG--KSDKPKE---IPLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYER 2112
               G   SD  K+   I   F SI ILSY FC+GW+F     S+ GL  GY RLF+A+E+
Sbjct: 2038 DNAGVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEK 2097

Query: 2113 DFGKFTVVDSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRF 2172
             +GK T++D++F +A G+TS+ F+ + +E D+ NRS LP+MQI YWF+  G   + F R 
Sbjct: 2098 PYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRI 2157

Query: 2173 HGEALDVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSS 2232
            +GE LDV+F+   + +     +S+  FQELKR  LD                 V+  P+ 
Sbjct: 2158 NGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLD----------PFKPEEPVKRVPAG 2207

Query: 2233 LA----PFLNNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDED 2288
             A    P L++I  VN   +Y GGVF++Y+ +DI+ K+ PSF+++SP V +   Y     
Sbjct: 2208 SAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLT 2267

Query: 2289 KVRPHKIRTLITVDPTHNTLYAGCAPLLMEFSESLQKMIK--KHSTDEKPNFTKPSPQNV 2346
              R H +R L++VD +HNTL+  C P++ E +  +++++K    S+ E P  T    + +
Sbjct: 2268 GKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPR-TSNMQEGI 2326

Query: 2347 DYKRLLDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSL 2406
            +Y+ LL   D++  +   KQQ+SLSCEPKAKVQADVGFE F   + TN+FD   PL  SL
Sbjct: 2327 NYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSL 2386

Query: 2407 TLEHTKASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQN 2466
             + +  A+ +HIFSREVSTS  +  +    + THPD I  YGI  +  ++V+FN+KQLQ+
Sbjct: 2387 DIHNITATSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQD 2446

Query: 2467 LYLFLDIWRFSSILHTRPA--QRSVNKGIDMHS-LTST-SHVDLGTEIPWCFTLIFTNVS 2522
            L +F++IW+  S + ++P    + V    ++   LTS    V   +  PW F +I + + 
Sbjct: 2447 LNVFINIWKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIR 2506

Query: 2523 GDVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWL 2582
            G++DLG SLGV+SL T++ W  TDHY +  Q L    D +SL+S+GRL G F + N  W+
Sbjct: 2507 GEIDLGISLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWM 2566

Query: 2583 SEVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLP 2642
            S++KW   +G    PLV  ++ +D+ A+K  FDYH+ LI ++  +   L N++D +GV+ 
Sbjct: 2567 SQIKWPLNEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIR 2626

Query: 2643 DLLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLY 2702
            +LL VS SSD   +  TAL  ANI D+YNTI+RMR+DN+ SY+ETL DSN  +++     
Sbjct: 2627 NLLSVSLSSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSS 2686

Query: 2703 KDILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQ 2762
             +IL SL  LRT+LSV +  + +Q+ P +LFD+EV+  +    S  S+T   KKLKT L+
Sbjct: 2687 HEILSSLSFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLK 2746

Query: 2763 LQVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKT 2822
            L+V +V  ALST K +L E V + I + +Y+ +ASK+ GGTI+  P + + MTT  +  T
Sbjct: 2747 LKVHNVKLALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVAT 2806

Query: 2823 NNLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTXXXXXXX 2882
            N +E L++ SF  KI VRWNLG +NF++EMW TH +A+A+RRS                 
Sbjct: 2807 NKVELLYSNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSHNGQSKSFFEDEHLGDK 2866

Query: 2883 XXXXXTASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKL 2942
                    ++ YI LEEP IE+PQ +DLG+ATPP+EWFGVNRK+FP  THQ  ++P+QKL
Sbjct: 2867 LKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKL 2926

Query: 2943 VYLAEKQYVKIL 2954
             +LAE ++ +IL
Sbjct: 2927 AHLAESEWARIL 2938

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1750 bits (4533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1013/2804 (36%), Positives = 1547/2804 (55%), Gaps = 107/2804 (3%)

Query: 204  INDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPK 263
            +NDR YQ  +    P FL+ LP+E +  +G+L++GNK T SVM+ S+E  +G +D   P 
Sbjct: 11   LNDRTYQLPN--SMPSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPD 68

Query: 264  ERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPV 323
             ++DLY+ K Q +   F++S++ N+ YD+   LK      ++ KL   +      V K  
Sbjct: 69   TKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRY 128

Query: 324  VSKRTK-KNTRSSNDSFYQKWKGLSLYKATSGEAKAND--LDDI-EFDLTNHEYAKFTSI 379
            +S+ +K ++TR    +  ++W+GL LY       K ND   DD+  F+L  HEYA+++ +
Sbjct: 129  LSRGSKTESTRKDLRNPLERWRGLGLY------WKENDPAWDDVFHFELPKHEYARYSKV 182

Query: 380  LKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWA 439
            +KC  + I Y  D PGVVPHGA PT+  +DGPDVGN GAPPDF+LD+Q+ G +I YGPWA
Sbjct: 183  MKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWA 242

Query: 440  QRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAE 499
              ++  +Q+V SPVVSR + P ++L  GS RV+T  R++I I  D+ WRIPTRE SKD +
Sbjct: 243  HHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLD 302

Query: 500  FLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNH 559
            FL+ YKET ++ RPFGW++L   + +    NI++CPT  GF N   +HF++ EIR+SVNH
Sbjct: 303  FLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNH 362

Query: 560  DILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDP 619
            DILL ++  +I+  IGYPLGWN+KA W  ++KS Q   F+L++HITL+ D LSDF  GDP
Sbjct: 363  DILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDP 422

Query: 620  TPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRE 679
            TPY+LFRPF+Y+ NWE+ GYS+YLNVND NIVNNP+DFNENCYLS HGD L I   VP++
Sbjct: 423  TPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQD 482

Query: 680  SILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDID 739
            SI G  T I Y + TP+FR+ +NTP WNTL+EFMK KEVGRA DF++ G+YL +S+LD++
Sbjct: 483  SIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVE 542

Query: 740  NVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTT 799
            N+DT++IEC S  T L CYG+V+R+L  VKMNYFG+F +F T+EEY   L    V     
Sbjct: 543  NIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKAN 602

Query: 800  KSSVVDLASTVDSGY---QNSSVKNNSEAKGPMKRSDLKRTTNETDIWFTFSVWNGALIL 856
                 +   T  +G    + ++ KN++      K+  LKR  NE D+WFTF V +G LIL
Sbjct: 603  SEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLIL 662

Query: 857  PETIYSFDPCIALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNG 916
            P+ +Y  + C A  F  L +D R  NYYMD+ A L    ++         +F        
Sbjct: 663  PKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSG-SEGRC 721

Query: 917  ADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIG 976
                  GS+SDL IH HRM+GLPP E TYFC+WD ++G L I SD+  I  F  ++ K+ 
Sbjct: 722  PSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLA 781

Query: 977  FGYNDLENILLYDTETIDDMTSLTVHAERIRISLEDPVMKSQSVISAESILFTLIDFENE 1036
            F + D ENI+ Y    I DMTS+  HA  IR+ + D  +    ++  E++    +DFENE
Sbjct: 782  FSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENE 841

Query: 1037 NYSQRIDVKVPKLKISLNCVMGDGVDMSFL-KFETKLRFTNFEQYKDIDKKRSEQRKYIT 1095
             YS R DV +  + +    V   G D S +  F + L+ T F Q K+      +Q+ +I 
Sbjct: 842  RYSSRADVDIHSITVQ---VKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIA 898

Query: 1096 FHDSPYHRCSFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYA 1155
             +D+P+HRCSFLLPL  Q SD Y+KL G                      ++E I  E  
Sbjct: 899  TNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPG------------MVEPITPENV 946

Query: 1156 TLLEAANPFKDSFAETPSTVEPSKASFTEDDNDEEASSSGFKPGAFTEDGDD---EKDNY 1212
            T++       +      ++++     F     +E+  +  F  G  +   +D   E ++ 
Sbjct: 947  TMI-----LDEFLKGEKNSLQMGNEHFCS-KKEEDGYAFNFASGLMSSTENDSNVESESL 1000

Query: 1213 VVDVSYILLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNID 1272
            VV +      I        +S  +Q YS  + Q++D  EI +V              N+ 
Sbjct: 1001 VVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKNVK 1060

Query: 1273 IHIAYLNLIWQETGEEGFELYLDRIDYQMREKSLE----------KNRTTKLLEVAALAR 1322
            +      +     G +      D +D  ++E S++           +  + + ++ AL +
Sbjct: 1061 VFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVK 1120

Query: 1323 VKTVRVTV-NQKKNPDLSEDRPPAL-SLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQ 1380
            V+++ + V N  +N  L       L S  ++  E W ++E  + +S N TS D  +   +
Sbjct: 1121 VESLALCVSNTSRNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDK 1180

Query: 1381 MEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPA 1440
             E    +  + A  +  +       ++    ++ +    ++ AS+ YQI HDP VITKPA
Sbjct: 1181 TELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPA 1240

Query: 1441 FIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVF 1500
            +I RL   HVREN+SWKIITRLRHIL YLP      I   LK   + +  +A  IF+++F
Sbjct: 1241 YITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIF 1300

Query: 1501 STWRNWEFSDVARSYIYGKLFSTDNEKHKQ--NLIKKLLKCTMGSFYLTVYGEG--YEVE 1556
            S WR+WE SDV + Y+Y K F +  E      NL  ++  C+  +   + + EG    V+
Sbjct: 1301 SKWRSWESSDVEQCYMYRKAFYSQYEGQAGPLNLRVEVDSCS-ATVSDSTHKEGDMIAVK 1359

Query: 1557 HNFVVADANLVVDLTPPVTSL-SLNREETIEITGRIGSVKGKFSDRLLKLQDLIPLVAAV 1615
               ++    L  ++   + ++      +   ++  + +VK   S+  +KL     L  + 
Sbjct: 1360 GLKLLKKFILKSEMVGSILAIDDGTATDGNSLSCSLKAVKASISETAIKLLAFRELFESQ 1419

Query: 1616 GEDD-----KSDPKTELSKQFRMNTVLLVDKSELQLVMDETKLMSRTVGGRVSLLWENLK 1670
               D     +  P  ++ K   M   LL+D+ E+++ +D      ++ G  +S    + +
Sbjct: 1420 NSQDILSNTQVLPSGKILK--LMELALLIDRCEIKISLDSKTANLKSFGNSISFALVDTE 1477

Query: 1671 DSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILATTEAWSHKPTILINNQCADLH 1730
             +     S+ +     E  ++H + I+ +A  R  S+ +            ++     L 
Sbjct: 1478 SARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHRVHLGSQKLR 1537

Query: 1731 FRAMSSTEQTVTAITEIRESALXXXXXXXXXXXXXXXSQFVGQKINTVLTCYFSNVSSEI 1790
             +  SST+     I  + ES                 S  +          +  + +SEI
Sbjct: 1538 LKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKDLSPEMKNFSKVAFEAHVDDFTSEI 1597

Query: 1791 MPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQYLRFSFGDIEIKGG 1850
              LSP  I    K L + F K  ++ + + + + D  + S  T +QYL+ S   +E+   
Sbjct: 1598 SALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELTAK 1657

Query: 1851 VSKEGYSLIN-VDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXXXXXX-NI 1908
            +  +   + + + +  ++ K    +PR I+ +  QD   A Q +                
Sbjct: 1658 IHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALFGT 1717

Query: 1909 PKKEKQVPALMI---NWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGMLPEET 1965
               +++V A  +    W     + Y G+L+P+ +T ++ E++ L  SL+           
Sbjct: 1718 DSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFSFPL 1777

Query: 1966 KVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRVCLSP 2025
             V G+ S+  I FLI ++ LP  LSKVL+F+ ++   +   ++ +S Q+ES+HFR+ L P
Sbjct: 1778 -VHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIESTHFRIALCP 1836

Query: 2026 DSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTG--KSDKPKE---IPLNFRSIHILS 2080
             SL+R++  A         Y   H   +  +K   G   SD  K+   I   F SI ILS
Sbjct: 1837 FSLIRILSLA---------YEATHLSGLQALKDNAGVKSSDDAKDFFNISQTFHSIQILS 1887

Query: 2081 YKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGN 2140
            Y FC+GW+F     S+ GL  GY RLF+A+E+ +GK T++D++F +A G+TS+ F+ + +
Sbjct: 1888 YDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPD 1947

Query: 2141 EKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQ 2200
            E D+ NRS LP+MQI YWF+  G   + F R +GE LDV+F+   + +     +S+  FQ
Sbjct: 1948 EVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQ 2007

Query: 2201 ELKRNILDVSENSHSEDSNIYAASSVENAPSSLA----PFLNNIRSVNSNFKYDGGVFRV 2256
            ELKR  LD                 V+  P+  A    P L++I  VN   +Y GGVF++
Sbjct: 2008 ELKRQYLD----------PFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKL 2057

Query: 2257 YTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLL 2316
            Y+ +DI+ K+ PSF+++SP V +   Y       R H +R L++VD +HNTL+  C P++
Sbjct: 2058 YSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPII 2117

Query: 2317 MEFSESLQKMIK--KHSTDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEP 2374
             E +  +++++K    S+ E P  T    + ++Y+ LL   D++  +   KQQ+SLSCEP
Sbjct: 2118 SEMALDIRQLLKDLNKSSVETPR-TSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEP 2176

Query: 2375 KAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDL 2434
            KAKVQADVGFE F   + TN+FD   PL  SL + +  A+ +HIFSREVSTS  +  +  
Sbjct: 2177 KAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSF 2236

Query: 2435 TILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPA--QRSVNKG 2492
              + THPD I  YGI  +  ++V+FN+KQLQ+L +F++IW+  S + ++P    + V   
Sbjct: 2237 VFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGP 2296

Query: 2493 IDMHS-LTST-SHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDHYDE 2550
             ++   LTS    V   +  PW F +I + + G++DLG SLGV+SL T++ W  TDHY +
Sbjct: 2297 TNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSD 2356

Query: 2551 KRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDDMAI 2610
              Q L    D +SL+S+GRL G F + N  W+S++KW   +G    PLV  ++ +D+ A+
Sbjct: 2357 WTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAV 2416

Query: 2611 KAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANILDIY 2670
            K  FDYH+ LI ++  +   L N++D +GV+ +LL VS SSD   +  TAL  ANI D+Y
Sbjct: 2417 KLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVY 2476

Query: 2671 NTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQISPI 2730
            NTI+RMR+DN+ SY+ETL DSN  +++      +IL SL  LRT+LSV +  + +Q+ P 
Sbjct: 2477 NTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPS 2536

Query: 2731 SLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEVGASIAID 2790
            +LFD+EV+  +    S  S+T   KKLKT L+L+V +V  ALST K +L E V + I + 
Sbjct: 2537 TLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVK 2596

Query: 2791 DYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPVNFIK 2850
            +Y+ +ASK+ GGTI+  P + + MTT  +  TN +E L++ SF  KI VRWNLG +NF++
Sbjct: 2597 EYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLR 2656

Query: 2851 EMWTTHVKALAVRRSQIANISFGQTXXXXXXXXXXXXTASKFNYIALEEPQIEVPQIRDL 2910
            EMW TH +A+A+RRS                         ++ YI LEEP IE+PQ +DL
Sbjct: 2657 EMWATHARAMALRRSHNGQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKDL 2716

Query: 2911 GDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            G+ATPP+EWFGVNRK+FP  THQ  ++P+QKL +LAE ++ +IL
Sbjct: 2717 GEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARIL 2760

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  928 bits (2399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1605 (34%), Positives = 845/1605 (52%), Gaps = 101/1605 (6%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            M+  ++   + + +++ F WVFLV+W   I+  +   FY+ R   Y+V+ IL W++WKR 
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAELIDNNKSP 120
            KV IN+++L  S++GG+++FK++S+  +D TISIL+G+ TW+YWLLN R  +L    K+ 
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQL----KNS 116

Query: 121  SKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYL--NEHSFPEPFS 178
            + N+    C+F LEC+G+E+FIYN+   Y++++N L+K ++D   K+   +E  F    +
Sbjct: 117  NINDENSKCRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRKFATDDESIFGRVKT 176

Query: 179  DGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLG 238
            D S    + + L ES+  +    +I+N    Q       P +L FLP E+  S G++++G
Sbjct: 177  DSSV---MFDPLDESSEQSKVGQTILNSVSNQSA----VPLYLDFLPAEVILSSGAVVVG 229

Query: 239  NKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKF 298
            NK TPSV I+ Y   EGI+DV  P   +D Y+ +++ E  +  +S+K NI + +    K 
Sbjct: 230  NKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKK 289

Query: 299  KLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKA 358
                GK   LW+     L      +++    K   +  + F   WKGL++Y   + +  +
Sbjct: 290  HKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTFS 349

Query: 359  NDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGNNGA 418
               D+I FDL NHEYAK+T+IL   ++ + Y  D PGV+      T + I G + G+   
Sbjct: 350  ---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVI------TETLIKGYENGDIPP 400

Query: 419  PPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRMN 478
             P++++DVQ++  +  YGPWA RQ+ +  ++ SP VSR     +K   G  R +  FR  
Sbjct: 401  SPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCE 460

Query: 479  ISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPTVE 538
            I I ED+ WRIPT+E SKDA FL  YK T++E R FGW+D++  KDT  +  + +  +  
Sbjct: 461  IVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASEC 520

Query: 539  GFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLEAF 598
            GF+N FH + V   I +SVNHD+L  +K   I     YP  WNS   W ++  S  LE F
Sbjct: 521  GFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELF 580

Query: 599  LLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLDFN 658
            +LR+H  L+ D  +DF++GD  PYELFRP +Y+ +W++  YS+YLN ND NIVNNPLDFN
Sbjct: 581  ILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFN 640

Query: 659  ENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHKEV 718
            ENCY+S+HG+   I V +P E+I      ISYEI TP F + L TPPW+TL+EFM  + V
Sbjct: 641  ENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTLHEFMAQRFV 700

Query: 719  GRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEFFN 778
            GR+++F+  G+YL Y+++DIDNVDT+ +EC +N      YGF++RY+ N+K+NYFGEF  
Sbjct: 701  GRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQ 760

Query: 779  FVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSSVKNNSEAKG--------PMK 830
            F T+EEY+  L  R+  DV T     D+ +  D       V+ NS  +          + 
Sbjct: 761  FRTTEEYSEELAQRN--DVAT-----DIFNNNDDDQTTELVEPNSYGESGFDILHGKKID 813

Query: 831  RSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIMAV 890
            ++ LKRT NE DIW TF   +G  +LPE+ Y F  C  LHF  +  D R  +YY D+   
Sbjct: 814  KASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFS 873

Query: 891  LDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGLPPTEPTYFCQWD 950
            ++ T IKR+     N VFD    N        G LS+  IH HRM+GLPP E TY  + D
Sbjct: 874  MNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKID 933

Query: 951  INLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAERIRISL 1010
            ++LG LS +SD+E +KGF     K  FG+++ E++L Y+     D++ L+  A+ I I L
Sbjct: 934  VSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDISIRL 993

Query: 1011 EDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMSFLKFET 1070
             +        +S  ++   L+DF    YS R ++ +P     ++ +  D  ++      T
Sbjct: 994  NNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSM--DDHNIVLGTIST 1051

Query: 1071 KLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTYQKLYGXXXXXXX 1130
             + F  F +  D     + Q ++I   D+P+ RCSFL P  YQ SD Y+ LY        
Sbjct: 1052 SISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKLLYASIPPSSS 1111

Query: 1131 XXXXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFTEDDNDE- 1189
                           I E+++G+          ++D  +E   T + S  +  + + DE 
Sbjct: 1112 IPLLPEPIGPNNFDTIFENLLGDI---------YQDYISE--GTFDISNDTKLQLNIDEF 1160

Query: 1190 ----EASSSGFKPGAFTEDGDDEKD---NYVVDVSYILLDIDPLLFVFTKSLLEQLYSEN 1242
                E S S  K    T D  DE     ++V ++ +I +DI   +      L  QL +  
Sbjct: 1161 KKHSENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFT 1220

Query: 1243 MVQVLDDIEIGIVKRLSNLQEGITSIS-------NIDIHIAYLNLIWQETGEEGFELYLD 1295
            +   +D + + IV   S    G +S++        ID  +        E  +  F   ++
Sbjct: 1221 ISDTIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDIN 1280

Query: 1296 RIDYQMREK--------SLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALS 1347
            ++D  +R +        + E N   KL      A +    ++      P  SE    +  
Sbjct: 1281 KLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYP--SESSEFSYK 1338

Query: 1348 LGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQD 1407
               E  E ++  +   V   NL    + I++   + + ++             S    ++
Sbjct: 1339 STFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKN 1398

Query: 1408 TRTSSKTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILT 1467
               S K EL+  +  A + Y I HDP VITKPA I RLS+ HVRE+RSW+I+TRLRH+L 
Sbjct: 1399 FNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLN 1458

Query: 1468 YLPDDWQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGK-------- 1519
            YLP  W       L++ K+ S  DAK  F+ +F+ WR+WEF+DV R ++Y K        
Sbjct: 1459 YLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYIPAEVT 1518

Query: 1520 -----LFSTD------NEKHKQNLIKKLLKCTMGSFYLTVYGEGY 1553
                  FS+D      NE+ K++L        M SF + +  + Y
Sbjct: 1519 FAKTICFSSDLLTISFNERDKEHLF-------MNSFMIDIRNDCY 1556

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1195 (35%), Positives = 664/1195 (55%), Gaps = 57/1195 (4%)

Query: 1786 VSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEIL---ISIWDTDFFMTSHQTKEQYLRFSF 1842
            ++ ++  L PF +R+  K+ +I  + FG   IL   +S+ DT   + S + +E Y+++S 
Sbjct: 1777 INIQLQLLLPFILRYSCKEFEINVD-FG--RILQSSLSLQDTSVELLSLEFQEPYMKYSH 1833

Query: 1843 GDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINXXXXXXXX 1902
              +++ G       +L  + +  S  KL+  EP++ +  FL D + A + I         
Sbjct: 1834 SYLKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKNIEILRSTMLE 1893

Query: 1903 XXXXNIPKKEKQVP-ALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSLTNTNNGML 1961
                 +   + + P + +I   L+ ++ Y G+L+   +T +V E + L  S +       
Sbjct: 1894 TKSSTV---QNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSN 1950

Query: 1962 PEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDTEQSFQVESSHFRV 2021
            P     +  +S E+I FLIK+R +   LSKVLDFS+++  ++ ++   QS Q+ESS+   
Sbjct: 1951 PVVPTFSSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHA 2010

Query: 2022 CLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGKSDKPKEI-PLNFRSIHILS 2080
             LSP SL+RL+   ++   +   Y         +IK  +  S+    I P++ +S HILS
Sbjct: 2011 VLSPMSLVRLLSFVNEFSIMKSIYH--------DIKPRSTSSNSTLSILPISIKSAHILS 2062

Query: 2081 YKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSFFSVANGNTSSTFFSEGN 2140
            Y  CIGWLF  G  ++ GL+ GY RLF+ Y++ +GK T++D++FSVA+G +SST++ +GN
Sbjct: 2063 YNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGN 2122

Query: 2141 EKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIDSTLQSMRAFQ 2200
            EK   NRS+LP+MQI+YW +     KD F R +GE LDV+ +  +  ++D   QS+  F+
Sbjct: 2123 EKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFK 2182

Query: 2201 ELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSVNSNFKYDGGVFRVYTYE 2260
            +LK  ILD  + + S D  +   + ++N      P  +++RS+N    Y G   ++Y+ +
Sbjct: 2183 KLKETILDPLKVT-SNDPILGEWNYLDN------PLASSVRSINCIINYAGSSMKLYSRD 2235

Query: 2261 DIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVDPTHNTLYAGCAPLLMEFS 2320
            DI+  +  SFEI+SP  T+   YK+   K + H IRTL TV+ THNTL+  C PLL E  
Sbjct: 2236 DIQHGT-CSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMW 2294

Query: 2321 ESLQKMIKKHS---TDEKPNFTKPSPQNVDYKRLLDQFDVAVKLTSAKQQLSLSCEPKAK 2377
             +   M+K      ++  PN      + ++Y+ LL+ FD+AV +   KQ++SL+CEP AK
Sbjct: 2295 LTFNTMLKNSCSQFSNGAPNLASAKAE-INYRDLLEAFDIAVIINVGKQEISLTCEPTAK 2353

Query: 2378 VQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFSREVSTSFEVGFMDLTIL 2437
            +QA +GFE F   + TN    + PL  S+ L +  AS +H+FSRE+S+S  +  + +   
Sbjct: 2354 IQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREISSSLSLQQISMVFS 2413

Query: 2438 FTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSILHTRPAQRSVNKGI---- 2493
             TH + I  YG  L+S    +FNVKQ+++L LFL+IW           Q+SVN  I    
Sbjct: 2414 LTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEK-------QKSVNDIILAPV 2466

Query: 2494 ------DMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQRTWLATDH 2547
                   + S+     V +     W + LI + +  ++DLGPSLG++ +++   W  + H
Sbjct: 2467 TASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSH 2526

Query: 2548 YDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVSTSLNIDD 2607
              +  Q L      I ++S GRL G   + +  W S++ W      +  PLV  SL +  
Sbjct: 2527 NIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGA 2586

Query: 2608 MAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTALVAANIL 2667
               K +FDYHMF I TI N   +L N++D +G L DLL VS S D I +  T+L  AN+ 
Sbjct: 2587 FNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLF 2646

Query: 2668 DIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSISSLKVQI 2727
            DIY+TI RMR D+  + ++ L +SN  +         +L SL  LRT+LSV+   L + I
Sbjct: 2647 DIYSTIRRMRNDSGRTNLDLL-ESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHI 2705

Query: 2728 SPISLFDVEVLVVRIDKV------SIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDE 2781
               +L   EV+V+R  KV         S+T S  K++T+L  Q+ D+S +LS+ K +LDE
Sbjct: 2706 FSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDE 2765

Query: 2782 EVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRW 2841
                 I + DY+  AS I GG I++ P + V M T Q + +N +E L++ SF + +S+ W
Sbjct: 2766 NQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITW 2825

Query: 2842 NLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTXXXXXXXXXXXXT--ASKFNYIALEE 2899
            NL P+NFIK+MW+ H+ A+ +R  Q  N S                    +K+ Y  LEE
Sbjct: 2826 NLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIYKPLEE 2885

Query: 2900 PQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954
            P IE+P+I+DLGDATPP+EWFG+NR RFP  THQ  V+P+QKL  +AEK+YV+IL
Sbjct: 2886 PNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/1508 (31%), Positives = 776/1508 (51%), Gaps = 90/1508 (5%)

Query: 37   VFYMGRIYAYLVSFILEWLLWKRAKVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILE 96
            +FY+GR+  Y+VS     +LWK+ +V +++++L  S L G++HFK++SV  +D  IS+L+
Sbjct: 6    IFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLK 65

Query: 97   GSITWKYWLLN-CRKAELIDNNKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINL 155
            G+ITW+YWL+   R++   D  +          C+F L+ EG E F+YNR   YD +   
Sbjct: 66   GTITWRYWLIGRYRRSGTADGARR---------CRFALKFEGFEYFVYNRNGVYDRIARE 116

Query: 156  LSKDERDKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIG 215
            L             E +  EP     S +++  +L +                       
Sbjct: 117  LD-----------GEDTSAEPTVSVPSVEEVIAELQDD---------------------- 143

Query: 216  KHPQFLKFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQM 275
              P   +FLP+E   ++G+++LGNK T SV I++YE   G V +  P +       +T+ 
Sbjct: 144  --PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEA 201

Query: 276  EFKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSS 335
            +  N  ++IK NI Y+    +K  ++  + ++LWK +  +L  V +  +  + KK    +
Sbjct: 202  KISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQT 261

Query: 336  NDSFYQKWKGLSLYKATSGEAKANDLDD-IEFDLTNHEYAKFTSILKCPKVTISYDVDVP 394
               +Y  W+GLS+Y     E    +LD+ ++FD+ +HEYAK T++LK  ++ ++Y   +P
Sbjct: 262  -PKWYDNWRGLSMYDVNLDE----ELDEEVKFDIEHHEYAKCTTVLKADQMDVTYSYGMP 316

Query: 395  GVVPHGAHPTISDIDGPDVGNNGAPP-DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPV 453
            G         ++D D  +      P  D ++D+ ++  +  YGPWA RQV    RV SP 
Sbjct: 317  GTA------RVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLRVFSPT 370

Query: 454  VSRTAKPIKKLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRP 513
            V R  K         +     F+++++I ED+  R+P +E+SKDA FL+ YK+T +E RP
Sbjct: 371  VCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRP 430

Query: 514  FGWMDLRFCKDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGD 573
            FGW+D+R  K++     ++  PT  GF+N  H + V+T I +SVNHD LLK+K  +I  D
Sbjct: 431  FGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVD 490

Query: 574  IGYPLGWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVN 633
              YP GW  KA W  N+ S Q E F+LR+H+ L++D ++DFS G+   YE FRPF Y+  
Sbjct: 491  FSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFR 550

Query: 634  WEMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEIS 693
            W++ GYS YLNVND NI+NNP+DF ENCYLS+HGD   I  ++P  SI+  Y  + + I 
Sbjct: 551  WDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIF 610

Query: 694  TPMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNST 753
            TP F + LN PPW+T +E + +KE+GR+ +F IKG+Y  YSE+D+DNVD L I C ++  
Sbjct: 611  TPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYI 670

Query: 754  VLHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSG 813
            V+ CYG +++ + NVK+NYFGE  +F T+EEY   L  R+  + +T        +  DS 
Sbjct: 671  VVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSD 730

Query: 814  Y----QNSSVKNNSEA-KGP--MKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPC 866
                  N  +  + +A  GP  +K+S LKR+ NE D+WFTF    G    PE IY FD C
Sbjct: 731  VVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDAC 790

Query: 867  IALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLS 926
            +  +F  L    R  NYY+D    LD    KRH       +F  I       +     LS
Sbjct: 791  LGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLS 850

Query: 927  DLTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENIL 986
              +   H+M G+ P+E +Y C++D+ +  L +  D+  +K F ++   + FG+ D+EN L
Sbjct: 851  QFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSL 910

Query: 987  LYDTETIDDMTSLTVHAERIRISLEDPVMKSQSV---ISAESILFTLIDFENENYSQRID 1043
             Y+ E + D+  ++   E + + L++ V K + +   ++      T  D  NE YS+R D
Sbjct: 911  QYEREQVFDLNKISCVIENVTVKLQN-VDKDEDIWLSLNLPVTTLTSFDLANERYSRRSD 969

Query: 1044 VKVPKLKISLNCVMGDGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHR 1103
            + +P+L   +    GD        F T +  T FE+++   + R  QRK+I  +D+P+HR
Sbjct: 970  LSIPELLFGI--YRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHR 1027

Query: 1104 CSFLLPLFYQDSDTYQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLEAANP 1163
            CSF+LP  Y+    Y+ LYG                      I E ++GE          
Sbjct: 1028 CSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEKLLGEI--------- 1078

Query: 1164 FKDSFAETPSTVEPSKASFTEDD--NDEEASSSGFKPGAFTEDGDDEK--DNYVVDVSYI 1219
            +++  +++   +     S TE D  N    ++ G     F    + ++   +++V+   I
Sbjct: 1079 YQEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPI 1138

Query: 1220 LLDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLN 1279
               +D     F   + + L   ++ + +D +EIGI+ +          IS + +    ++
Sbjct: 1139 DGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNIS 1198

Query: 1280 LIWQETGEEGFELY-----LDRIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKK 1334
            L      +  F ++     +  +D   R KS + N      +     ++  +R  + Q  
Sbjct: 1199 LS-ATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANIVQDG 1257

Query: 1335 NPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANL 1394
                 +      S  +E  E + S +   +   N+ S  +T+     + LF++ +   + 
Sbjct: 1258 IVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPFIST 1317

Query: 1395 LQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENR 1454
               +     S +DT  +SK E +  +      Y+I HDP VITKPA I R S  H+R   
Sbjct: 1318 FDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAE 1377

Query: 1455 SWKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARS 1514
            SW+II RLRHIL YLP +W  +  + L  + +TS  +A   F+S+FS WR+WE +DV  S
Sbjct: 1378 SWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDVQGS 1437

Query: 1515 YIYGKLFS 1522
            +++ K+F+
Sbjct: 1438 FVHEKVFT 1445

 Score =  599 bits (1545), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 393/1214 (32%), Positives = 629/1214 (51%), Gaps = 59/1214 (4%)

Query: 1772 GQKINTVL-TCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTS 1830
            G KI+ VL     +N++ ++  LSPF I + A+  ++      ++ ++  +   + +M  
Sbjct: 1698 GNKIHAVLFQGQVANITLKLQILSPFIILYCAENFEL--QAESTDSVIFDLNSGESYMEI 1755

Query: 1831 HQTKEQYLRFSFGDIEIK-GGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLA 1889
               K++   F +    +K  G S       ++   I ++KL+  + +  +   LQD K A
Sbjct: 1756 SSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAA 1815

Query: 1890 SQGINXXXXXXXXXXXXNIPKKEKQVPAL-----MINWTLDTSISYFGILIPVASTYFVF 1944
                             NI +      A      ++   L    +Y G+L+    T ++ 
Sbjct: 1816 ------LFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYIL 1869

Query: 1945 ELHMLLLSLTNTNNGMLPEETKVTGQF----SIENILFLIKERSLPIGLSKVLDFSIKVS 2000
            E +       +T +G LP+       F    SIE+  FLIK+R +   L+KV+DF++  +
Sbjct: 1870 EFNNF--EAKHTRDG-LPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFN 1926

Query: 2001 TLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKH--HAPNIWNIKM 2058
             +  T    QS Q+ES+H ++ L+P +++RL+   ++   +   +T+   + P+  +   
Sbjct: 1927 MVHDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNS 1986

Query: 2059 FTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFT 2118
               +  +P    L  +S HILS+ F I WLF     S  GL+ GY+RLFS YE+ +GK T
Sbjct: 1987 TATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLT 2046

Query: 2119 VVDSFFSVANGNTS-STFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEAL 2177
            +++++FS A    S + F+S    K + N S+L +MQ+ YWF    E  D F R HG  L
Sbjct: 2047 LLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKL 2106

Query: 2178 DVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFL 2237
             V+     + +++ T+QS++ F  LK+ ++D    +  +DS+I  +    N  + LA   
Sbjct: 2107 AVDISAEIVTLLEETIQSIQTFNNLKKALVD-PFRTKKQDSDI--SKEPYNWNNQLA--- 2160

Query: 2238 NNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRT 2297
              +RS+N    Y G   +++++ D    + P  E+ SP   +   YK+  +  + H+ RT
Sbjct: 2161 TGVRSLNCIINYAGVTLKLHSH-DGRGDASP-LELTSPSYKVAIDYKYFPNLEKTHRFRT 2218

Query: 2298 LITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSP----QNVDYKRLLD 2353
            LIT  PTHNT Y+  A L+ +      K++K  ST+ K +    S     +  D   LL 
Sbjct: 2219 LITATPTHNTFYSTSAFLIHDLCYRFSKLLKTSSTENKSSSASTSSSIKVEGSDNSTLLG 2278

Query: 2354 QFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKA 2413
              D+ + L   KQ+++ SCEPKAKVQA VGFE F   +  N  + E  L  ++ +E+   
Sbjct: 2279 SIDLVIILNVGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIENLMT 2338

Query: 2414 SIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDI 2473
            + +HI+SREV  S ++  + +        V  +YG  L+S    +FN+KQLQ+L LF+D 
Sbjct: 2339 NSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQ 2398

Query: 2474 WRFSSILHTRPAQRSVNKG-------IDMHSLTSTSHVDLGTE---IPWCFTLIFTNVSG 2523
            W         P +  +N G       +D  S +  S    G+      W +++I      
Sbjct: 2399 WF--------PQKTPMNTGSYPEGVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCA 2450

Query: 2524 DVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLS 2583
            +++LGPSLGV+++ ++  W  +    +  Q L      + +TS GRL G F V NA    
Sbjct: 2451 EIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSL 2510

Query: 2584 EVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPD 2643
            E+KW   K     PLV   L  D +  K +FDYH F I ++   +  L NE+D  G L D
Sbjct: 2511 ELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLAD 2570

Query: 2644 LLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYK 2703
            LL V+ S + + +  TAL AANI DI N+I R+++DN++SY+ +   S+   S +P    
Sbjct: 2571 LLSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQ-PSDEPEEDG 2629

Query: 2704 DILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQL 2763
             I  +L LLRT LS+++   ++QISP SLFD +VL++   K+   +   +  K+KTDL  
Sbjct: 2630 GIFDTLSLLRTQLSLNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHW 2689

Query: 2764 QVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTN 2823
            Q+ DVS AL      LDE   A++ +  Y+  +S I GG I   P + V+MTT QE ++N
Sbjct: 2690 QLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSN 2749

Query: 2824 NLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRS---QIANISFGQTXXXXX 2880
             +E L++ SF   + +RWNLGP++FIK+MW  H+ A+ +R      +A      T     
Sbjct: 2750 VIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSK 2809

Query: 2881 XXXXXXXTASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQ 2940
                     S + Y+ L+EP IE+P+I+DLGDATPP+EWFGVNR +FP FTHQ  ++P+Q
Sbjct: 2810 AVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQ 2869

Query: 2941 KLVYLAEKQYVKIL 2954
            KL   AEK+Y KIL
Sbjct: 2870 KLARTAEKEYEKIL 2883

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  809 bits (2089), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/1590 (31%), Positives = 814/1590 (51%), Gaps = 118/1590 (7%)

Query: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60
            M++ S  R + ++ +KD S  FLVDWIL ++ C+   FY+GRI A++++  L++ +W++ 
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAEL-IDNNKS 119
            K+KIN+++++VS LGGRI FK+L+V+  D+TIS LEGS TW+YWLL+ R   +  ++   
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120

Query: 120  PSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSD 179
             +  N KLPC+F L+C+GLE+F+YN+   Y++V+       RD F              D
Sbjct: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL-------RDHFTNVT---------KD 164

Query: 180  GSSADKLDEDLSESAYTTNSDASIINDR-----------DYQETDIGKHPQFLKFLPIEL 228
            G   +  D+       T N++ +  N +             + TD  K     K  PI+L
Sbjct: 165  GQETESNDD------ITINTEKAAANSKLSNSSRYSYSGRSKSTDAPKLSAKTKLFPIQL 218

Query: 229  NFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNI 288
              +R +++LGN+ T  V +  +E  +G+ D+      +D YR K  ++  +    ++ N+
Sbjct: 219  EANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNL 278

Query: 289  GYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSL 348
            GY +   +K  +    + K+W+   +    +SK ++  + K  T ++  ++   WKGL L
Sbjct: 279  GYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPNQGK--TINNQQAYIDSWKGLDL 336

Query: 349  YKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDI 408
            Y  T    + N    +   L   EYA+++ ++K  +V+++Y  D+PG+VP  +    S  
Sbjct: 337  YHHTKAVQEENVDTTV---LHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQS 393

Query: 409  DGPDVGN---NGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLP 465
            D  +  N   +   P F  D+ I+  ++ YGPWA + +  + R+ SP+VSR      K  
Sbjct: 394  DRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPE 453

Query: 466  PGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDT 525
            PGS R+Y  F++++   + +   IPTRE+SKD EF++ YK T + +R FGW+++   +  
Sbjct: 454  PGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGG 513

Query: 526  YANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAI 585
               FN+++C   +   N  +V  +  EI+SSVNH++L +     I  +IGYP GWN +A 
Sbjct: 514  EILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQAD 573

Query: 586  WIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNV 645
            W+  + S   E FLLR+HI+L++D  +DFSA D   YELFRPF Y++ W    Y ++LNV
Sbjct: 574  WLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFLNV 633

Query: 646  NDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPP 705
            ND NI+NN LD NENC+LSL GD L   + +P  SI+    + ++ + +P+ ++ ++ P 
Sbjct: 634  NDANIINNLLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPC 693

Query: 706  WNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYL 765
            WNTL+EF+     G   DF++ GTY+ +  +D+DN DT++I+  S+ST    +GFV+RYL
Sbjct: 694  WNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYL 753

Query: 766  TNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVD----------SGYQ 815
             N+K+NYFG+F +F T+EEY+  L   +  D  TK+       T D            YQ
Sbjct: 754  MNIKLNYFGDFNHFKTTEEYSNDLSMEE--DTKTKTKNFQEQPTNDVESLTSSSSDGSYQ 811

Query: 816  NSSVKNNSEAKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELV 875
             +   N    +  + +S L RT NETD+W TF V +G +I+PE +Y       L F  L 
Sbjct: 812  VADTIN----ENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLE 867

Query: 876  VDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEH----GSLSDLTIH 931
             D R  NY+MD+ A      +        N V         A E+ H    G L DL +H
Sbjct: 868  FDMRYTNYFMDLTAFFSRIYLNHSNEFSFNRVV--------AIEESHSENTGYLDDLNLH 919

Query: 932  GHRMYGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTE 991
            GHRM+G+PP E TY C+WDI++G LS DSD +F+  F  +  K+GF Y D ENIL+Y   
Sbjct: 920  GHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIH 979

Query: 992  TIDDMTSLTVHAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKI 1051
              +D+TSLT+   R+  S+        + +S   I     D  N  YS+R+D+ V  + +
Sbjct: 980  KPEDVTSLTISIGRVS-SIVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDLLVAAISV 1038

Query: 1052 SLNCVMGDGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLF 1111
               C + +   + F   +T +  T F    ++   R  Q+  +  +DSP+HRC FLL   
Sbjct: 1039 ---CAIDEKKTVLF-TCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFD 1094

Query: 1112 YQDSDT-YQKLYGXXXXXXXXXXXXXXXXXXXXXFIIEDIVGEYATLLEAANPFKDSFAE 1170
              +  T Y  L G                      I E ++G Y  L+       D+   
Sbjct: 1095 QLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDT--- 1151

Query: 1171 TPSTVEPSKASFTEDDNDEEA------SSSGFKPGAFTEDGDDEKDNYVVDVSYILLDID 1224
                      + T+D  D++       + S    G   E+   E +N  V++S + + + 
Sbjct: 1152 ---------KNLTDDRPDDKRLLPLSNTVSNDLSGQLAEEF--ESENTTVNISTLSVFVT 1200

Query: 1225 PLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLS--NLQEGITSISNIDIHIAYLNLIW 1282
            P  F F ++    + + +   ++D  E+ IV   S  ++  G    S++ +    +N I 
Sbjct: 1201 PKAFTFAENAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVN-IS 1259

Query: 1283 QETGEEGFEL-YLDRIDYQMREKSL------------EKNRTTKLLEVAALA-RVKTVRV 1328
             ET  +  +L  LDR++  +   S+            + N +T + + + ++    +++ 
Sbjct: 1260 DETALDKTQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQF 1319

Query: 1329 TVNQKKNPDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYC 1388
             + +     L++  P A    L    +  S  G+ V+ L   S    I ++ +EW  +Y 
Sbjct: 1320 NIFKSSKNRLTKVLPIAWFEILMFNTVLFSDVGK-VSKLIFGSIKSAILDADVEWTVEYL 1378

Query: 1389 SDQANLLQEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPAFIMRLSKG 1448
               A    +   S   +   R+    E I  +    +   I   PY+ITKPA+I RLSK 
Sbjct: 1379 LKLAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKF 1438

Query: 1449 HVRENRSWKIITRLRHILTYLP--DDWQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNW 1506
            HVR+  SWKIITRLRH+  +     +  +  D + +E +    +  K+ F+ +F  W+NW
Sbjct: 1439 HVRDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKD--KSQFLDIFVDWKNW 1496

Query: 1507 EFSDVARSYIYGKLFSTDNEKHKQNLIKKL 1536
            +  +V +S ++  LFS ++  H+++L  +L
Sbjct: 1497 DVYEVEQSSLFTLLFSGESTVHEEDLFNEL 1526

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/1205 (32%), Positives = 646/1205 (53%), Gaps = 74/1205 (6%)

Query: 1778 VLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQY 1837
            VL+    ++  +     PF IR     LD  F       I+++   T+  +  +  + + 
Sbjct: 1762 VLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNY--TELLLDFYFNQLKL 1819

Query: 1838 LRFSFGDIEIKGGVSKEGYS----LINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGI 1893
            LR       I   V+K  Y     L ++ +   ++KLT S+ R  +   L D    +  +
Sbjct: 1820 LR-------ISNSVTKVDYRSNTLLTDIGLDTDIVKLTLSDNRVYIEE-LTDS--LNGTV 1869

Query: 1894 NXXXXXXXXXXXXNIPKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHMLLLSL 1953
            +            N P   K  P      +   +  Y G+L  + +T +V E +    S 
Sbjct: 1870 SELIKIFKNKNADNEPAAPKFKPC-----SFKMNAIYIGLLTDLKTTNYVLEFNETAFSC 1924

Query: 1954 TNTNNGMLPEETKVTGQFS-----IENILFLIKERSLPIGLSKVLDFSIKVSTLQRTIDT 2008
             +    +  EET            I+N+  L+    +   LSK+ D    +  ++   D 
Sbjct: 1925 ASRAEAL--EETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED--DI 1980

Query: 2009 EQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGK---SDK 2065
            +++ Q+E+ H RV L+P +L+ ++           ++ +    ++  +K   GK   S  
Sbjct: 1981 KKTLQIETPHSRVMLAPSTLIAVI-----------FFIQEAKVSLQKVKQ-KGKFNSSSN 2028

Query: 2066 PKEIPLNFR--SIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDSF 2123
              EIP  F   S++ILS K C+GW+F+  T  + G+++GY  LF+AYE+ +GK T+VD +
Sbjct: 2029 AIEIPPYFETLSVNILSNKLCLGWIFEEDTDEN-GIVIGYESLFAAYEKPYGKLTIVDGY 2087

Query: 2124 FSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVP 2183
             + A G  S+ FF   N   + NRS L +MQI++WF      KD F R + + LDV  + 
Sbjct: 2088 VATAQGKESNNFFF-ANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILT 2146

Query: 2184 SFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNIRSV 2243
            + +++++    S+ +FQ+    I ++ ++S S  +    A ++ +  S L+     IRS+
Sbjct: 2147 TSVEIVNVMRSSIESFQKKLAKISNIKKSSISTHN---VAENLSDKVSILS-----IRSI 2198

Query: 2244 NSNFKYDGGVFRVYTYEDIEAKS-EPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLITVD 2302
            N   KY GG+  +YT +DI   S + S E+ SP + ++  Y H+    + H IR+L+ V+
Sbjct: 2199 NCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVE 2258

Query: 2303 PTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSPQNV-------DYKRLLDQF 2355
             THN L++ C P+L+  +  +QK +++ ++++K    K   Q         DYK L  + 
Sbjct: 2259 STHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKI 2318

Query: 2356 DVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASI 2415
            D A+ +    Q ++L+CEP+AK+QAD+GF +F  S+ T+  D   PL  SL     + S 
Sbjct: 2319 DTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEIST 2378

Query: 2416 KHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWR 2475
            +HIFSRE+S+S  +  + L  + TH + I  YG  L+SD+  + N+KQLQ + LFLDIW 
Sbjct: 2379 RHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWS 2438

Query: 2476 FSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGT-EIPWCFTLIFTNVSGDVDLGPSLGVI 2534
                  T+ AQ+  +           +  +  T +IPW + +IF N S  +D+ PSLG I
Sbjct: 2439 ----PKTKKAQKLGSGPHSGQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSI 2494

Query: 2535 SLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKN 2594
            + +    W+++ H  +    +  + D ++  S+GRL GLFE+ N  + S + W  +  K 
Sbjct: 2495 NFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKF 2554

Query: 2595 THPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEI 2654
              PL++ +  +  ++ K  FDYH FLI  ++++   + NE+D  G+L DLL VS S   +
Sbjct: 2555 EAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSV 2614

Query: 2655 ILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRT 2714
             +  TAL +AN+ DIY T  RMR +NK SY++TL++SNP  S +     + L +   LRT
Sbjct: 2615 NIFLTALASANLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRLRT 2674

Query: 2715 DLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALST 2774
            +L+  I S ++ + P +LFD EVLV++ +K+++ + T + +K KTDL  Q+ D++ +L+ 
Sbjct: 2675 NLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQ 2734

Query: 2775 SKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFS 2834
             K EL EE  A +++++Y   A+ + G  I+  P + V +TT Q+    ++E+L++ SF 
Sbjct: 2735 FKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFG 2794

Query: 2835 DKISVRWNLGPVNFIKEMWTTHVKALAVRRSQI---ANISFGQTXXXXXXXXXXXXTASK 2891
            DK+ ++WNL P+NFI+EMW THV+AL+VRR       +  F +               +K
Sbjct: 2795 DKVDIKWNLDPINFIREMWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNL-GTK 2853

Query: 2892 FNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQKLVYLAEKQYV 2951
            + YI LEEP IE+P +RDLG+ATPP+EWFGVNRKRFP   HQ  V+P+QKL+Y+AE QY 
Sbjct: 2854 YKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYN 2913

Query: 2952 KILDD 2956
            + L D
Sbjct: 2914 RTLGD 2918

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 65.5 bits (158), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (66%)

Query: 5  SQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRAKVKI 64
          S+ R VP++  +DFSWVFL DW+L +   L   FY GR+  Y ++ ILE+L WKR  VK+
Sbjct: 3  SEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVKV 62

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 318,714,935
Number of extensions: 14676324
Number of successful extensions: 46332
Number of sequences better than 10.0: 37
Number of HSP's gapped: 46957
Number of HSP's successfully gapped: 51
Length of query: 2958
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2830
Effective length of database: 38,804,151
Effective search space: 109815747330
Effective search space used: 109815747330
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)