Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1458.259ON1418141868920.0
YLR086W (SMC4)8.259ON1418141858870.0
Skud_12.1548.259ON1417141757670.0
Suva_10.1708.259ON1416141756990.0
KAFR0B027108.259ON1416144138540.0
TDEL0F038608.259ON1399142438050.0
NCAS0B050008.259ON1409142537910.0
ZYRO0C01716g8.259ON1413142437870.0
SAKL0H17094g8.259ON1422144437330.0
Kpol_392.88.259ON1427143436240.0
KNAG0G020208.259ON1444144936020.0
NDAI0B019708.259ON1415141935880.0
KLTH0G13750g8.259ON1399138734750.0
Kwal_56.238258.259ON1396140834520.0
AGR089C8.259ON1370138434260.0
Ecym_43118.259ON1376138833990.0
TPHA0J007208.259ON1393137133330.0
TBLA0E044108.259ON1422144732930.0
CAGL0L12188g8.259ON1398139531290.0
KLLA0F19085g8.259ON1372138831160.0
KLTH0A02706g8.68ON12287464621e-45
YFL008W (SMC1)8.68ON12257544566e-45
TPHA0P003408.68ON12197494432e-43
Kwal_23.50438.68ON12257424306e-42
KNAG0G009108.68ON12267754227e-41
Suva_6.528.68ON12641613555e-33
Smik_6.718.68ON12282043547e-33
NDAI0G033208.68ON12311683548e-33
Skud_6.648.68ON12301613512e-32
NCAS0C040008.68ON12231683512e-32
KAFR0C032008.68ON12231613459e-32
Kpol_1011.58.68ON12211713432e-31
SAKL0B02288g8.68ON12281723403e-31
KLLA0D07502g8.68ON12431693351e-30
TBLA0G035308.68ON12321633314e-30
TDEL0C009608.68ON12221653261e-29
CAGL0F02079g8.68ON12231923243e-29
ZYRO0F03828g8.68ON12171683224e-29
Ecym_73038.68ON12221663225e-29
AGL023W8.68ON12221613208e-29
SAKL0F07282g7.186ON11703922813e-24
TDEL0H026107.186ON11703972786e-24
KNAG0L011607.186ON11703902714e-23
KAFR0G029307.186ON11703732706e-23
CAGL0D05258g7.186ON11701822609e-22
ZYRO0D15642g7.186ON11701822609e-22
AGR236W7.186ON11701812601e-21
NCAS0E019207.186ON11704032544e-21
Suva_6.1047.186ON11701822527e-21
KLTH0E04774g7.186ON11701822528e-21
Ecym_43907.186ON11701792528e-21
YFR031C (SMC2)7.186ON11701822528e-21
Smik_7.3467.186ON11701822511e-20
Kpol_1063.207.186ON11711822511e-20
Kwal_55.204217.186ON11701832492e-20
Skud_6.1197.186ON11701822464e-20
KLLA0D16005g7.186ON11701792421e-19
TPHA0C044407.186ON11702942412e-19
TBLA0D046107.186ON11741792402e-19
ZYRO0G21296g1.295ON12272372107e-16
Kwal_14.24351.295ON12471712043e-15
KAFR0A016101.295ON12271092035e-15
Kpol_1018.21.295ON12111932035e-15
NDAI0G020707.186ON1171792001e-14
KLTH0H09966g1.295ON1224971972e-14
SAKL0D06116g1.295ON1229941972e-14
TDEL0D016201.295ON12232331973e-14
KNAG0B052301.295ON1225981936e-14
NCAS0A093301.295ON12271061938e-14
NDAI0G056301.295ON12291171892e-13
Smik_10.1671.295ON12292191892e-13
TBLA0C027401.295ON11191551873e-13
Suva_6.1491.295ON12302201847e-13
YJL074C (SMC3)1.295ON12302201848e-13
TPHA0I010901.295ON1216951831e-12
Ecym_63221.295ON12321031822e-12
CAGL0H02805g1.295ON12191091812e-12
AAL182W1.295ON12311021776e-12
Skud_10.1701.295ON12302201767e-12
KLLA0A00286g1.295ON1224891678e-11
SAKL0B09526g7.101ON10993971283e-06
KNAG0L006307.101ON11081561274e-06
ZYRO0G01584g7.101ON10883921132e-04
KLTH0D02816g7.101ON10941641132e-04
TDEL0E013404.237ON11061771113e-04
Kwal_26.72047.101ON11174291095e-04
NCAS0I005707.101ON10954231095e-04
KLLA0F07997g7.101ON11191871050.002
AEL337C7.101ON10971981050.002
ZYRO0B12122g4.237ON1109781030.002
KAFR0D013307.101ON1080188980.010
Kpol_1044.137.101ON1103138980.011
CAGL0H05071g4.237ON111099980.012
KNAG0B060104.237ON1117101980.012
NDAI0A084507.101ON1119333970.012
NCAS0J013904.237ON109668970.015
KLLA0E05303g4.237ON1098102970.015
TPHA0B008404.237ON111968960.016
Skud_12.4684.237ON112068960.018
YLR383W (SMC6)4.237ON111468960.019
Smik_12.4704.237ON111468960.020
Suva_10.5004.237ON111568950.020
NDAI0J021804.237ON1108107950.021
Skud_15.1217.101ON109378950.025
Suva_15.1337.101ON109262940.028
Smik_15.1317.101ON109362940.030
YOL034W (SMC5)7.101ON109362940.033
TDEL0H034907.101ON110380940.033
TPHA0L006007.101ON111762930.037
Ecym_26257.101ON1097131930.042
TBLA0E021907.101ON108962930.044
TBLA0A053001.67ON70763910.067
CAGL0F01155g7.101ON1105422900.079
TBLA0I028904.237ON109871900.097
Ecym_53444.237ON110254870.19
Kpol_483.104.237ON111884870.22
SAKL0H03322g4.237ON111152860.28
Kwal_26.93804.237ON110285860.30
TDEL0G028102.351ON109471840.47
NCAS0B087001.67ON71572830.55
KLTH0D14080g4.237ON110278830.57
KAFR0A060404.237ON110268820.69
AER044W4.237ON110353820.80
YDL058W (USO1)4.238ON179090811.2
NDAI0A008301.162ON684107772.5
TPHA0O019302.16ON1081108763.5
NDAI0E024608.609ON486173763.7
TPHA0I029207.488ON1200142764.4
Suva_4.1914.238ON1782222764.7
AFR683C1.67ON67782746.1
SAKL0F04026g7.163ON113999747.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.145
         (1418 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  2659   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  2272   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  2226   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  2199   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1489   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1470   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1464   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1463   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1442   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1400   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1392   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1386   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1343   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1334   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1324   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1313   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1288   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1273   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1209   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1204   0.0  
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   182   1e-45
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   180   6e-45
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   175   2e-43
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   170   6e-42
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   167   7e-41
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   141   5e-33
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   140   7e-33
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             140   8e-33
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   139   2e-32
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   139   2e-32
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   137   9e-32
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   136   2e-31
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   135   3e-31
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   133   1e-30
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   132   4e-30
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   130   1e-29
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   129   3e-29
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   128   4e-29
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   128   5e-29
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   127   8e-29
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...   112   3e-24
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....   111   6e-24
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...   108   4e-23
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   108   6e-23
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...   104   9e-22
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   104   9e-22
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   104   1e-21
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....   102   4e-21
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...   101   7e-21
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...   101   8e-21
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...   101   8e-21
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...   101   8e-21
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...   101   1e-20
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...   101   1e-20
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...   100   2e-20
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    99   4e-20
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    98   1e-19
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    97   2e-19
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    97   2e-19
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    86   7e-16
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    83   3e-15
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    83   5e-15
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    83   5e-15
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    82   1e-14
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    80   2e-14
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    80   2e-14
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    80   3e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    79   6e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    79   8e-14
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    77   2e-13
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    77   2e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    77   3e-13
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    75   7e-13
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    75   8e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    75   1e-12
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    75   2e-12
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    74   2e-12
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    73   6e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    72   7e-12
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    69   8e-11
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    54   3e-06
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    54   4e-06
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    48   2e-04
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    48   2e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    47   3e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    47   5e-04
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    47   5e-04
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    45   0.002
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    45   0.002
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.002
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    42   0.010
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    42   0.011
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    42   0.012
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    42   0.012
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    42   0.012
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.015
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    42   0.015
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.016
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.018
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.019
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    42   0.020
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    41   0.020
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    41   0.021
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    41   0.025
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    41   0.028
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.030
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    41   0.033
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    41   0.033
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    40   0.037
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    40   0.042
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    40   0.044
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    40   0.067
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    39   0.079
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    39   0.097
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    38   0.19 
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    38   0.22 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.28 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    38   0.30 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    37   0.47 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    37   0.55 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    37   0.57 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    36   0.69 
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    36   0.80 
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...    36   1.2  
NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {O...    34   2.5  
TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2...    34   3.5  
NDAI0E02460 Chr5 (509417..510877) [1461 bp, 486 aa] {ON}               34   3.7  
TPHA0I02920 Chr9 (639184..642786) [3603 bp, 1200 aa] {ON} Anc_7....    34   4.4  
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    34   4.7  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    33   6.1  
SAKL0F04026g Chr6 complement(322105..325524) [3420 bp, 1139 aa] ...    33   7.6  

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 2659 bits (6892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1329/1418 (93%), Positives = 1329/1418 (93%)

Query: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT 60
            MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT
Sbjct: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAY              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180
             LELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240

Query: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300
            DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360

Query: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420
            FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD
Sbjct: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420

Query: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480
            FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL
Sbjct: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480

Query: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540
            ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL
Sbjct: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540

Query: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXXXXNVETMEEKI 600
            KDKTKDISTEIIQHEKELEPWDLQLQEK                       NVETMEEKI
Sbjct: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKNVETMEEKI 600

Query: 601  LARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660
            LARKAHKQELQDLILN        RDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR
Sbjct: 601  LARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660

Query: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720
            SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780
            VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY
Sbjct: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840
            SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS
Sbjct: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840

Query: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900
            NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA
Sbjct: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900

Query: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960
            DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK
Sbjct: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960

Query: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKFQKQLKNSE 1020
            VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVA           SEGDVLKFQKQLKNSE
Sbjct: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKFQKQLKNSE 1020

Query: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXXXXXXXXXXMVAETEENID 1080
            RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLR            MVAETEENID
Sbjct: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELKEESEQLKEMVAETEENID 1080

Query: 1081 EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDIVKTD 1140
            EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDIVKTD
Sbjct: 1081 EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDIVKTD 1140

Query: 1141 NKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFXXXXXXXXX 1200
            NKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRF         
Sbjct: 1141 NKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFSEEELKELD 1200

Query: 1201 XXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLK 1260
                       SYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLK
Sbjct: 1201 IELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLK 1260

Query: 1261 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320
            KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1261 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320

Query: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380
            TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380

Query: 1381 ISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNRT 1418
            ISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNRT
Sbjct: 1381 ISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNRT 1418

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 2272 bits (5887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1134/1418 (79%), Positives = 1239/1418 (87%)

Query: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT 60
            M DSPLSKRQKRK+ +EPELSLD  DA ++ Q E + + SE TP+P+ PALE SY+KS+T
Sbjct: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNS TTSLHVPNLQPP TSSRGRD+K+Y              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPPKTSSRGRDHKSYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180
             LELLQLSPVKNSRVELQK+Y+ HQSS+KQQ RLFINELVLENFKSYAG+QVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFP+LQSCSVAVHF+YVI
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVI 240

Query: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300
            DESSGTSRIDEEKPGL+ITRKAFKNNSSKYYIN KESSYTEVTKLLKNEGIDLDHKRFLI
Sbjct: 241  DESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEE+M QIE LNEVCLEKENR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKENR 360

Query: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420
            FEIVDREKNSLESGKETALEFL KEKQLTLL+SKLFQFK+LQSNSKLASTLEKISS NKD
Sbjct: 361  FEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSNKD 420

Query: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480
             E EK+KFQESLKKV+E+K QRKEIKDRISS  S+EK LVLERRELEGTRVSLEERTKNL
Sbjct: 421  LEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTKNL 480

Query: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540
             +K+EK+E+T K TK SISEAE+ L+EL  QQTEHE+EIKDL QLLE+ERS+LD+IKLSL
Sbjct: 481  VSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKLSL 540

Query: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXXXXNVETMEEKI 600
            KDKTK+IS EII+HEKELEPWDLQLQEK                       NVET+EEKI
Sbjct: 541  KDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEEKI 600

Query: 601  LARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660
            LA+K HKQELQDLIL+        +DERSQGE+NF+SAHLKL+EMQKVLN HRQRAMEAR
Sbjct: 601  LAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAMEAR 660

Query: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720
            SSLS+AQNKSKVLTALS+LQKSGRINGFHGRLGDLG+ID+SFDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780
            VECAQ CIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPK+PKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNAFY 780

Query: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840
            SVLRDTLVA++LKQANNVAYG+KRFRVVT+DGKLIDISGT+SGGGNHV+KGLM+LGTNQS
Sbjct: 781  SVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTNQS 840

Query: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900
            +K+DDYTPEEV+KIE ELSERENNFRVA+DTVHEME ELK LRD EP +ES+ISK EMEA
Sbjct: 841  DKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEMEA 900

Query: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960
            DS+ SELTLAEQQVKEA +AY  A+SDKAQ+N++MKNLERL+GE++DLQSETKTKKEKIK
Sbjct: 901  DSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEKIK 960

Query: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKFQKQLKNSE 1020
             LQ EIMKIGG KLQMQNSKV S+CQ+LDILVA           S GDV+KFQK L+NSE
Sbjct: 961  GLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQNSE 1020

Query: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXXXXXXXXXXMVAETEENID 1080
            RDVELSS+ELK IEE+LKHTKL L+END  M ET NL+             + + EE+I+
Sbjct: 1021 RDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEESIN 1080

Query: 1081 EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDIVKTD 1140
            EFKS+EIEMKNKLEKLNSLL +IK EI QQEKGL+ELSIRDVTHTL +LD+N MD VK D
Sbjct: 1081 EFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMDSVKED 1140

Query: 1141 NKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFXXXXXXXXX 1200
             K  Q + +E RS ETQDE  I++ E +CD++H M+IDETS+EV RGIPR          
Sbjct: 1141 VKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGIPRLSEDELRELD 1200

Query: 1201 XXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLK 1260
                       SYY++ETNVDIGVLEEYARRLAEFKRRKLDLN AVQKRDEVK Q+ +LK
Sbjct: 1201 VELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQKRDEVKEQLGILK 1260

Query: 1261 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320
            KKRFDEFM GFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1261 KKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320

Query: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380
            TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380

Query: 1381 ISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNRT 1418
            ISLRNNMFELAQQLVG+YKRDNRT+STT+KNIDILNRT
Sbjct: 1381 ISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNRT 1418

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 2226 bits (5767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1099/1417 (77%), Positives = 1218/1417 (85%), Gaps = 1/1417 (0%)

Query: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT 60
            MCDSPLSK+QKRKA EEPELSL+D+DA +E + E + +R+EKTPDPNSP+LE+SYA+SHT
Sbjct: 1    MCDSPLSKKQKRKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSLESSYARSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPP  SSRGRDYKAY              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPKVSSRGRDYKAYSQSPPRSPGRSPAR 120

Query: 121  XLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180
             LELLQLSPVKNSR+ELQKLY+SH+SS KQQGRLFIN+LVL+NFKSYAGRQVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAGRQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFP+LQ+CSVAVHFEY+I
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQACSVAVHFEYII 240

Query: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300
            DE SGTSRIDEEKPGLVITR+AFKNNSSKYYIN KESSYTEVTKLLK EGIDLDHKRFLI
Sbjct: 241  DEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEE+++QIE+LNE+CLEK NR
Sbjct: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIESLNEICLEKANR 360

Query: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420
            FEIVDREKNSLESGKETALEFL KEKQLTLLKSKL QFK+LQSNSKLASTLEKISSLN++
Sbjct: 361  FEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLASTLEKISSLNRE 420

Query: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480
            FE+EK KFQESL++V+EVK Q K+IKDRISS+ SREK L LE+RELEG+RVSLEERTKNL
Sbjct: 421  FESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGSRVSLEERTKNL 480

Query: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540
             NK+ K+E+  K TK SISE+EH  +EL  QQTEHE EIKDLNQ LEEER +LD+IKLSL
Sbjct: 481  VNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEERIILDDIKLSL 540

Query: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXXXXNVETMEEKI 600
            KDKTKDIS +II+HEKE EPWDLQLQEK                       N E +EEKI
Sbjct: 541  KDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKLKKNAEALEEKI 600

Query: 601  LARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660
            +++K  KQELQ L+L+         D RSQGE +F SAHLKL+EMQ++LN HRQRAMEAR
Sbjct: 601  ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQRILNAHRQRAMEAR 660

Query: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720
            SSLS+AQNK+ VLTALSKLQKSGRINGFHGRLGDLG+IDNSFDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780
            VECAQ CIDYLRKNKLGYARFILLDRLR+FNLQPISTPENVPRLFD+VKPKDPKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVVKPKDPKFSNAFY 780

Query: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840
            SVL+DTLVAR LKQAN VAYG++RFRVVT+DGKLIDISGT+SGGGNHV KGLMRLGTNQS
Sbjct: 781  SVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHVMKGLMRLGTNQS 840

Query: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900
            ++I+DYTPEEV KIEHEL+ERE NFRVANDTVHEME ELK +RDQEP +ES+IS+ EMEA
Sbjct: 841  DEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPDLESQISRAEMEA 900

Query: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960
            DS+TSEL LAEQQ KEA++AY  A+++K QVN +MKNLE L+GE++DLQSET+TKKE+IK
Sbjct: 901  DSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYEDLQSETRTKKEQIK 960

Query: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKFQKQLKNSE 1020
            +LQ +IMKIGGTKL  QNSKVGSLCQR+DILV            SEGDVLK+QKQLKN E
Sbjct: 961  ILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEGDVLKYQKQLKNFE 1020

Query: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXXXXXXXXXXMVAETEENID 1080
            +D ELSSNELK IEEKLK TKL L+END  MTE  NL+             + E EENID
Sbjct: 1021 QDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQLKERLTEMEENID 1080

Query: 1081 EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDIVKTD 1140
            EFKSLEIEMKNKLEKLNSLL+HIK EI QQ+K L++LSIRDVTHTL++LDNN MD+V+  
Sbjct: 1081 EFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQMLDNNQMDVVEDG 1140

Query: 1141 NKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFXXXXXXXXX 1200
             K EQ   ++K S    DEK IQE++   ++HHSM+IDE S+E+ RGIP+          
Sbjct: 1141 IKDEQDADQDKPSGIPDDEK-IQEKDDADNNHHSMNIDEMSSEISRGIPKLCEEELKDLD 1199

Query: 1201 XXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLK 1260
                       + YI+ET+VDIGVLEEY RRL EFKRRKLDLNQAVQKRDEVK Q+E+LK
Sbjct: 1200 IELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILK 1259

Query: 1261 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320
            K RFDEFM GFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1260 KNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1319

Query: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380
            TNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1320 TNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1379

Query: 1381 ISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNR 1417
            ISLRNNMFELAQQL+GIYKRDNRT+STTVKNIDIL R
Sbjct: 1380 ISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKR 1416

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 2199 bits (5699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1097/1417 (77%), Positives = 1204/1417 (84%), Gaps = 2/1417 (0%)

Query: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT 60
            M DSPLSKRQKRK  EEPELS++  +  QE +AEKQ DR+EKTPDP+S +LE+SYAKSHT
Sbjct: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60

Query: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYXXXXXXXXXXXXXX 120
            PRKLVLSSGENRYAFSQPTNSAT+SLHVPNLQPP   SRGRDYKAY              
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPPEAPSRGRDYKAYSQSPPRSPGRSPTR 120

Query: 121  XLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180
             LELLQLSPVKNSR+ELQKLY+SHQ S +QQGRLFI++LVLENFKSYAG+QVVGPFHTSF
Sbjct: 121  RLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHTSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FPNLQSCSVAVHFEYV+
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEYVV 240

Query: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300
            DE SGTSRIDEEKPGLVITRKAF+NNSSKYYINGKES+YT+VTKLLKNEGIDLDHKRFLI
Sbjct: 241  DEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRFLI 300

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360
            LQGEVENIAQMK KAEKESDDGLLEYLEDIIGTANYKPLIE++++QIE LNE+CLEKENR
Sbjct: 301  LQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKENR 360

Query: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420
            FEIV+REKNSLESGKETALEFL KEKQLTLLKSKLFQFK+LQSNSKLASTLEK SSLNKD
Sbjct: 361  FEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSLNKD 420

Query: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480
            FE+EK KFQESLK+V+EV++QRKEIKDR+SS  S+EK L LE+RELE TRVSLEERTKNL
Sbjct: 421  FESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTKNL 480

Query: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540
             NK+ K+E+  K T  SISEAEH L+ELH +QTEHE+E+KDLNQ LEEER +LD+IKLSL
Sbjct: 481  VNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIKLSL 540

Query: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXXXXNVETMEEKI 600
            KDKTKDIS EIIQHEK+LEPWDLQLQEK                       N E +EE I
Sbjct: 541  KDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALEENI 600

Query: 601  LARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660
             A+KA KQELQ  IL+         D RSQGE++FS+AHLKL+EMQ +LN HRQRAMEAR
Sbjct: 601  AAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAMEAR 660

Query: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720
            SSLS+A+NKSKVLTALS+LQKSGRINGFHGRLGDLG+ID++FDVAISTACPRLDDVVVDT
Sbjct: 661  SSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVVDT 720

Query: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780
            VECAQ CIDYLRKNKLGYARFILLDRLRQFNLQP+ TPENVPRLFDLVKPKDPKFSNAFY
Sbjct: 721  VECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNAFY 780

Query: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840
            SVLRDTLVAR LKQANNVAYG++RFRVVTIDGKLIDISGT+SGGGNHV KGLMR+G NQS
Sbjct: 781  SVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKNQS 840

Query: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900
            +++DDYTPEEVNKIE+ELSERE NFRVANDTVHEME ELK +RDQEP +ES+I + EMEA
Sbjct: 841  DRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRAEMEA 900

Query: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960
            DS+ SEL LAE+QVKEA++AY  +++D AQ+N IMK LE L+GE+DDLQ+ETKTKKE+IK
Sbjct: 901  DSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKERIK 960

Query: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKFQKQLKNSE 1020
             LQ +IMKIGGT LQ+QNSKV SL QR+DILVA           S GDV KFQKQLKN E
Sbjct: 961  ALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQLKNVE 1020

Query: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXXXXXXXXXXMVAETEENID 1080
            RD+ELSSNELK IEEK +  KLDL +ND  +T   NL+             VAE E  ID
Sbjct: 1021 RDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEMEGKID 1080

Query: 1081 EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDIVKTD 1140
            EFKSLE+EMKNKLEKLNSLL +IK +I QQEK L+ELSIRDVTHTL ILDNN MDI+  +
Sbjct: 1081 EFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMDILDKE 1140

Query: 1141 NKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFXXXXXXXXX 1200
             +  Q   +E  S E + E   Q EE   DD H M+IDETS+EV RGIPR          
Sbjct: 1141 GEDRQETNQEDISGEAKGE--TQGEEGDNDDRHCMNIDETSDEVSRGIPRLSEDELKELN 1198

Query: 1201 XXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLK 1260
                       + YID TNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVK Q+E+LK
Sbjct: 1199 IELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKEQLEILK 1258

Query: 1261 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1320
            KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI
Sbjct: 1259 KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1318

Query: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380
            TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV
Sbjct: 1319 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1378

Query: 1381 ISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNR 1417
            ISLRNNMFELAQQLVG+YKRDNRT+STTVKNIDILNR
Sbjct: 1379 ISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNR 1415

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1489 bits (3854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 789/1441 (54%), Positives = 1020/1441 (70%), Gaps = 51/1441 (3%)

Query: 1    MCDSPLSKRQKRKAVEE---PELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAK 57
            M  +PLSK+QK  + EE   P  +  D+D T                 P   A  +S+ K
Sbjct: 1    MSHTPLSKKQKVVSDEERITPNQNEQDNDKTH----------------PEVTA--SSFLK 42

Query: 58   SHTPRKLVLSSGENRYAFSQPT----NSATTSLHVPNLQPP-GTSSRGRDYKAYXXXXXX 112
            SHTPRKL+L S +N+Y  SQP     +  ++SL VPNLQPP    SRGRD KAY      
Sbjct: 43   SHTPRKLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPPR 102

Query: 113  XXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQV 172
                     LEL+QLSP+KN+R+ELQKLYNS     + + RL+I++LVL++FKSYAG Q+
Sbjct: 103  SPGRSPVRKLELIQLSPIKNNRIELQKLYNS---KNQNKVRLYIDKLVLQDFKSYAGTQI 159

Query: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSV 232
            VGPF+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRL DLIHKSEAFPN+QSCSV
Sbjct: 160  VGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSV 219

Query: 233  AVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGID 292
             VHF+YVIDE+ GTS+I E++  LV+ RKAFKNNSSKYYINGKES+YTEVT+LLK EGID
Sbjct: 220  EVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGID 279

Query: 293  LDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNE 352
            LDHKRFLILQGEVENIAQMK KAEKE DDGLLEYLEDIIGT+ YK LIE++M +IEALNE
Sbjct: 280  LDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNE 339

Query: 353  VCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLE 412
            +C+EKE RFEIV+ EKNSLES K+ ALEF+AKEKQLTLL+SKL Q+K+ Q+N+KLA+TL+
Sbjct: 340  ICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLD 399

Query: 413  KISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVS 472
            KIS+     + E+ K+++   ++++   + +E  ++I+++ ++E++LV ++RE +G  VS
Sbjct: 400  KISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVS 459

Query: 473  LEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSV 532
            +EER KNL  K  K+E+T    +  I + E  LK+L   Q  ++SE  +L + L++ERS 
Sbjct: 460  MEERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSK 519

Query: 533  LDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXXXXN 592
            LD+IKLSLKDKTKDIS++I  +EK++EPW  ++QEK                        
Sbjct: 520  LDDIKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEG 579

Query: 593  VETMEEKILARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVLNTH 652
            + +++ +I   +        +I N        + E S GE   S A  K +EM+ +LN+H
Sbjct: 580  LGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSH 639

Query: 653  RQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPR 712
            RQRA++ARS+L  A+NKS VL+AL++LQKSGRINGFHGRLGDLG+I + +D+AISTAC R
Sbjct: 640  RQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSR 699

Query: 713  LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKD 772
            LDD+VVD+VEC QQCI+YLRKNKLGYARFILLD+LR F L  + TPENV RLFDLV+P D
Sbjct: 700  LDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPID 759

Query: 773  PKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGL 832
             KFSNAFYSVLRDTLVA  ++QAN VAYG++R+RVVT+DGKLIDISGT++GGG+HVSKGL
Sbjct: 760  LKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGL 819

Query: 833  MRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESK 892
            M+L  +    ++ Y   +V KIE +L+ERENNF++A+DT+ EM  ELK L+D+EP IE +
Sbjct: 820  MKLKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELE 879

Query: 893  ISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSET 952
            I+K  M+ DS+  +L L EQQ+KE    Y + ++ K  ++     L+ L+ EH  L+ ++
Sbjct: 880  IAKLLMDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQS 939

Query: 953  KTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKF 1012
            ++KKEKI  L+ EIMKIGG +LQ+QNSKV SL +R+ I+ A           +E ++ K 
Sbjct: 940  QSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKV 999

Query: 1013 QKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXXXXXXXXXXMV 1072
            Q+  K +E D     N+L+ ++  +   +  L E + +     N +             +
Sbjct: 1000 QRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKI 1059

Query: 1073 AETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILD-- 1130
             + EE+++E+KS EIE+KNKLEKLNSLL + KK+I    + L    +RDVT +LE +   
Sbjct: 1060 KDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNE 1119

Query: 1131 --NNTMDIVKTDNKIEQA-------------VVKEKRSSETQDEKNIQEEERTCDDHHSM 1175
              NN++ + ++ N ++ +             +  E   +++Q+E  I+E+E+  D    M
Sbjct: 1120 NANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNE--IEEKEQDAD---IM 1174

Query: 1176 DIDETSNEVIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEF 1235
            D+D  + EV +GIP+                       Y++ +N DI +LEEY RRL EF
Sbjct: 1175 DLDNVTEEVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEF 1234

Query: 1236 KRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELEL 1295
            K+RKLDLN  V +RDEV+ ++E LKK R DEFM GF+IIS+TLKEMYQMITMGGNAELEL
Sbjct: 1235 KKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELEL 1294

Query: 1296 VDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1355
            VDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA
Sbjct: 1295 VDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1354

Query: 1356 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDIL 1415
            ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKR N T+S T+KN DIL
Sbjct: 1355 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDIL 1414

Query: 1416 N 1416
            N
Sbjct: 1415 N 1415

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1470 bits (3805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 776/1424 (54%), Positives = 1004/1424 (70%), Gaps = 31/1424 (2%)

Query: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHT 60
            M D+PL+KRQ+          ++D++ ++E +A   + +S  T + NS         SHT
Sbjct: 1    MPDTPLTKRQR----------VNDNE-SREFEAVNGSTKSPLTSNSNSTI-------SHT 42

Query: 61   PRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYXXXXXXXXXXXXXX 120
            P+KLV+ + ++  + SQP  S ++SL  P+LQ P +SSRGR+ + Y              
Sbjct: 43   PKKLVIGTNDDTTSQSQPIVS-SSSLQAPSLQHPNSSSRGREQRTYSQSPPRSPGRSPTR 101

Query: 121  XLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180
             LEL+++SPVK +R+ELQ+LY++ QS  +   RL IN+LVL++FKSYAGRQVVGPFH+SF
Sbjct: 102  KLELIKISPVKKNRLELQRLYDAEQSQ-RNAARLCINKLVLQDFKSYAGRQVVGPFHSSF 160

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH SE  PNL+SCSV VHF+YV+
Sbjct: 161  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVV 220

Query: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300
            DE  GT+RIDEEKP LV+TRKAFKNNSSKYY+N KES+YTEVT+LLK EGIDLDHKRFLI
Sbjct: 221  DEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLI 280

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360
            LQGEVENIAQM+PKAEKE +DGLLEYLEDI GTA YKP IE  + +IE LNE C+EKENR
Sbjct: 281  LQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENR 340

Query: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420
            F IVD+EK+SLE+GK+ ALEFL KEK LTLL+SK+ Q+K+ Q++ KL STL+K S L   
Sbjct: 341  FHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQ 400

Query: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480
             + E  K+ E+LK+V+ +K + K++  RI +    EK L+ ++R L+  RV++EE+ K++
Sbjct: 401  LDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSV 460

Query: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540
              K  K+E+  K  + S++  E  L+EL   Q ++E E++DLNQ L  ER+ L+++K+SL
Sbjct: 461  NQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISL 520

Query: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXXXXNVETMEEKI 600
            K+KT +IS  I Q+EK+LEPWD QLQ+K                       ++E ++ +I
Sbjct: 521  KEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEI 580

Query: 601  LARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660
                  K   + +I            E        SSA  +L++M ++L   RQR ++AR
Sbjct: 581  ARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDAR 640

Query: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720
            ++ S AQNKS VLTAL+KLQKSGRI+GFHGRLGDLG+ID  +DVAISTACPRL+D+VV++
Sbjct: 641  AAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVES 700

Query: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780
            VEC QQCI+YLRKNKLGYARFILLD+LR+F+   I TPENVPRLFDLVKPKD KF  AFY
Sbjct: 701  VECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFY 760

Query: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840
            SVLRDTL A+SL QAN VAYG+KRFRVV++DGKLIDISGT+SGGG+HV +GLMRL  N S
Sbjct: 761  SVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNS 820

Query: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900
               D ++PEEV ++E+EL+E+E +F++A+DT  EME +LK L+D+ P I+ K+SK  ME 
Sbjct: 821  YSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMET 880

Query: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960
            +S  SEL L E+ + E   A   A     +  +    ++ LK E   L  +T T ++KI 
Sbjct: 881  ESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQKIA 940

Query: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKFQKQLKNSE 1020
            VL+ +IM+IGG++LQ+QNSKV S  QR++IL +           +E ++ K  K + N++
Sbjct: 941  VLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQ 1000

Query: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXXXXXXXXXXMVAETEENID 1080
            +D++L S E+ +++E   + +  L   +  + E  +L              +A+ E    
Sbjct: 1001 KDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFT 1060

Query: 1081 EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNNTMDIVKTD 1140
            EFKSL+IE+ +KLEKLN+LL HI KE+ Q E  L+ L IRDVT TL++LD        T+
Sbjct: 1061 EFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGE----STN 1116

Query: 1141 NKIEQAVVKEKRSS------ETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFXXX 1194
            N      ++EKR+       +  +E ++  EE   +D   M++DE  +E+  G+PR    
Sbjct: 1117 NSKMPNELQEKRTEGADATRQEGEESDVSMEEEKSND-EVMEVDEKPHELENGLPRVSEA 1175

Query: 1195 XXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKG 1254
                               Y+D  NVD+ +LEEYA+RLAE KRRK+DLN+AV +RD ++ 
Sbjct: 1176 ELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMRE 1235

Query: 1255 QVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPK 1314
            ++  LKK+RFDEFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPK
Sbjct: 1236 KLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPK 1295

Query: 1315 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1374
            KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK
Sbjct: 1296 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1355

Query: 1375 NAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNRT 1418
            NAQFIVISLRNNMFELAQQLVGIYK  N T+S ++KN DILNRT
Sbjct: 1356 NAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNRT 1399

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1464 bits (3791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 799/1425 (56%), Positives = 996/1425 (69%), Gaps = 38/1425 (2%)

Query: 5    PLSKRQKRKAVEE--PELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHTPR 62
            P +KRQK    E   PE   +D  A   L++  Q    +++  P       + +KSHTPR
Sbjct: 4    PNTKRQKVTEPESKTPEQGTEDQQANASLRSPLQRPEHQQSISP------INNSKSHTPR 57

Query: 63   KLVLSSGENRYAFSQPTNSATTSLHVPNLQPP-GTSSRGR-DYKAYXXXXXXXXXXXXXX 120
            KL+L   +NRYAFSQP+ S+++      LQPP  +SSRGR D K+Y              
Sbjct: 58   KLILGQNDNRYAFSQPSVSSSSFQVP-TLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPKR 116

Query: 121  XLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSF 180
             LEL+QLSPVKN+R++L++LY++H S +K++ RLFIN+L L NFKSYAG+QVVGPFHTSF
Sbjct: 117  RLELIQLSPVKNNRIKLRELYDAHNSQSKKE-RLFINKLTLNNFKSYAGQQVVGPFHTSF 175

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE FP+L SCSV V F Y I
Sbjct: 176  SAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAI 235

Query: 241  DESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLI 300
            DE  G ++I E KP LVI+RKAFKNNSSKYYINGKES+YT+VTKLLK EGIDLDHKRFLI
Sbjct: 236  DEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLI 295

Query: 301  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENR 360
            LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT+ YK LIE+ + +IE+LNE+C+EKENR
Sbjct: 296  LQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENR 355

Query: 361  FEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKD 420
            FEIVDREKNSLESGK  ALEFL KEKQLTL KSKL Q+ + Q+NSKL +TL+KIS+LN++
Sbjct: 356  FEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNEE 415

Query: 421  FETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNL 480
            +  EK K Q    ++   K    E + +I   +  EK  +  +R LEG  VSL+E+ KNL
Sbjct: 416  YNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKNL 475

Query: 481  ANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540
              K  K+E+    T+++IS     ++EL   Q E+  E++ LNQ L+ ER  L+ +KL L
Sbjct: 476  TQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKL 535

Query: 541  KDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXXXXNVETMEEKI 600
            K+KT  IS EI+ HE +LEPW++++QEK                       +++ + +++
Sbjct: 536  KEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQEV 595

Query: 601  LARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEAR 660
              + A K + ++ ++N          E S GE   +    KL+EM+ VLN  RQRA EAR
Sbjct: 596  SNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEAR 655

Query: 661  SSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDT 720
             +L+  QN+ KVLTAL KLQKSGRI GFHGRLGDLG IDN++DVA+STACPRLDD+VV+T
Sbjct: 656  LALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVET 715

Query: 721  VECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFY 780
            VEC QQCI+YLRKNKLGYARFILLD+LR FN   I TP+NVPRLFDL+KPKD KF  AFY
Sbjct: 716  VECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAFY 775

Query: 781  SVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQS 840
            SVLRDTLVA+ LKQAN VAYG++R+RVVT+DGKLID+SGT+SGGGNHVSKGLM L     
Sbjct: 776  SVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKGQ 835

Query: 841  NKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEA 900
            N  DDY PE+V +IE +LS++E NF +AN+  +EME EL+ L +++P IE +ISK  ME 
Sbjct: 836  NYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIMEI 895

Query: 901  DSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIK 960
            D+ ++E+   E+Q++E     ++ L D  ++ + ++NL++LK EH  LQ +TK KK+KI 
Sbjct: 896  DTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKIA 955

Query: 961  VLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKFQKQLKNSE 1020
             L+ +IMKIGG +LQ+QNSKV S+ QR+DIL A           S+ ++ K +K L  S+
Sbjct: 956  SLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTSK 1015

Query: 1021 RDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXXXXXXXXXXMVAETEENID 1080
             D+ L ++++K I E++      L+  D  + E    +             V + EENI+
Sbjct: 1016 NDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENIN 1075

Query: 1081 EFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILD---------N 1131
            EFKS EIE+ NKLEKLN LL HIK +I   E  LS+L++R +   L  LD         N
Sbjct: 1076 EFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPNN 1135

Query: 1132 NTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRF 1191
             T+    +D +I      E  ++  QD           DD  SMDID  +  +  G+P  
Sbjct: 1136 GTL----SDEQIHDQTGHELTNTAVQD-----------DD--SMDIDNGAEVISNGLPIL 1178

Query: 1192 XXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDE 1251
                                  YI+ T+ +I VLEEY +RL EFK RKLDLN AV KR+ 
Sbjct: 1179 SDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRET 1238

Query: 1252 VKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM 1311
            V+ Q+E LKK R++EFM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM
Sbjct: 1239 VRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM 1298

Query: 1312 PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1371
            PPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE
Sbjct: 1299 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1358

Query: 1372 RTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILN 1416
            RTKNAQFIVISLRNNMFELAQQLVGIYK +NRT S T+KN +ILN
Sbjct: 1359 RTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1463 bits (3787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 777/1424 (54%), Positives = 1024/1424 (71%), Gaps = 26/1424 (1%)

Query: 3    DSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNSPALETSYAKSHTPR 62
            D  LSKRQK   + +    +D    T +L      D+ E    P + + + ++A + TPR
Sbjct: 4    DDSLSKRQKVDGLNQ----IDGKHPTVDL------DQGENLSLPTTSSSQNTFAHAKTPR 53

Query: 63   KLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYXXXXXXXXXXXXXXXL 122
            KLV+ +G+NRYA S   + +++SL VP LQPP TSSRGR  K Y               L
Sbjct: 54   KLVVGNGDNRYAHSS-QSISSSSLQVPPLQPPATSSRGRGSKTYSQSPPRSPGRSPTRKL 112

Query: 123  ELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSFSA 182
            EL+Q+SP+KNSR+ELQK+Y++ Q+  +   RL I++L+L++FKSYAGRQVVGPF+TSFSA
Sbjct: 113  ELIQISPLKNSRLELQKIYDAQQNQARHT-RLCIDQLILQDFKSYAGRQVVGPFNTSFSA 171

Query: 183  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFEYVIDE 242
            VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE +P+L SCSV VHF+YVIDE
Sbjct: 172  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYVIDE 231

Query: 243  SSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQ 302
             SG +RIDEEKP LV+TRKAF+NN+SKYY+N +E++Y EVTKLLK EG+DLDHKRFLILQ
Sbjct: 232  PSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFLILQ 291

Query: 303  GEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENRFE 362
            GEVENIAQMK KAE+E +DGLLEYLEDIIGTA YKPLIE+ +  +E+LN++C+EKENRF+
Sbjct: 292  GEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEKENRFQ 351

Query: 363  IVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFE 422
            IVDREKNSLE+GKE AL FL  E++LT+ KSKL+Q+ +L SN KL +TL+KI++LN+  E
Sbjct: 352  IVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQKLE 411

Query: 423  TEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNLAN 482
             E  K     K++++++    E++ ++ + ++ EK L+ ++REL+G  V  EE+ KN   
Sbjct: 412  KESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKNFEK 471

Query: 483  KIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSLKD 542
            K +K+E+T     RSIS +E  L EL   Q ++E+ +K+LN+  E E+  L++IK SLKD
Sbjct: 472  KRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFSLKD 531

Query: 543  KTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXXXXNVETMEEKILA 602
            KT  IS EI Q EKELEPW+ QLQEK                        ++  +++I  
Sbjct: 532  KTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQEIET 591

Query: 603  RKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAMEARSS 662
            RK    +    + +        ++E S GE+   +A ++L+EMQ +LNT RQ+A++ARS+
Sbjct: 592  RKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDARSA 651

Query: 663  LSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVVVDTVE 722
            LS A+NKSKVLTALS+LQKSGRI+GFHGRLGDLG+ID  +DVAISTACPRL+D+VV+TVE
Sbjct: 652  LSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVETVE 711

Query: 723  CAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSV 782
            C QQCI+YLRKNKLGYARFILLD+LR+FNL  I+TPE+VPRLFDL+ PKDPKFS+AF+SV
Sbjct: 712  CGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAFFSV 771

Query: 783  LRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQSNK 842
            L +TLVA  LKQAN VAYG+KRFRVVT+DG LIDISGT+SGGG+ VS+GLM++  N++  
Sbjct: 772  LGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNKTED 831

Query: 843  IDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEADS 902
            I+ Y+ EEV ++E  L ERE NF+VA+DT+++ME +LK+L+++EPAIE+ IS+  ME +S
Sbjct: 832  IEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTMEIES 891

Query: 903  ITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIKVL 962
              SE+ + E Q+ E+  AY     +  ++   +++++ LK E   +Q++TK+KK +I+ L
Sbjct: 892  WNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRIETL 951

Query: 963  QGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKFQKQLKNSERD 1022
            + EIM+IGG +L++Q+SKV S+ QR+DI+V+           +E ++ K  K    + RD
Sbjct: 952  KNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLETSRD 1011

Query: 1023 VELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXXXXXXXXXXMVAETEENIDEF 1082
            +E  + E++ ++  ++  +  L++    +T   + +             + +  E+I  F
Sbjct: 1012 LENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDIAIF 1071

Query: 1083 KSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVT---HTLEILDNNTMDIVKT 1139
            KS E+EMKN+LEKLNSL  H+KKEI   E+ L +L IRDVT   H L+   NN  D   +
Sbjct: 1072 KSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASD--PS 1129

Query: 1140 DNKIEQAVVKEKRSSETQDEK-------NIQEEERTCDDHHSMDIDETSNEVIRGIPRFX 1192
            +N +      E    E +DE         +Q+ E+  D+   MD+++      RG+ +F 
Sbjct: 1130 ENPVSDVEESESSVGEGKDENKDLDAQDQVQDAEKQGDNQ--MDVEDGGEYSDRGLTQFS 1187

Query: 1193 XXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEV 1252
                                 ++D +N DI VLEEYARRL EFK R+LDLNQAV++R++V
Sbjct: 1188 EDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNKV 1247

Query: 1253 KGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1312
            K +++ LKKKRFDEFM GF IISMTLKEMYQMITMGGNAELELVD+LDPFSEGVTFSVMP
Sbjct: 1248 KEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVMP 1307

Query: 1313 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1372
            PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER
Sbjct: 1308 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1367

Query: 1373 TKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILN 1416
            TKNAQFIVISLRNNMFELAQQLVGIYKRDN+T+S T+KNID ++
Sbjct: 1368 TKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVS 1411

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1442 bits (3733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 784/1444 (54%), Positives = 1002/1444 (69%), Gaps = 52/1444 (3%)

Query: 1    MCDSPLSKRQKRKAVEE------PELSLDDSDATQELQAEKQAD-RSEKTPDPNSPALET 53
            M DSPL+K+QK +  +       P +S     +   L A K +  R ++ P P       
Sbjct: 1    MSDSPLAKKQKTRTDDRGQIQSNPTVSPIPPVSGSSLMAVKSSPTRQDRLPSP------- 53

Query: 54   SYAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGT-SSRGRDY--KAYXXXX 110
                  TPRKLVL S E +YA+S    S ++SL VPNLQPP    SRGR +  ++     
Sbjct: 54   ------TPRKLVLGSPEKKYAYS--QPSTSSSLSVPNLQPPNVDGSRGRRFYSQSPPRSP 105

Query: 111  XXXXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQ-GRLFINELVLENFKSYAG 169
                       LEL+QLSPVKN+R ELQK+Y+       Q   RL I++L L NFKSYAG
Sbjct: 106  HRSPNRSPTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHNFKSYAG 165

Query: 170  RQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQS 229
             Q++GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LSDLIHKSEA+PNL+S
Sbjct: 166  TQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEAYPNLES 225

Query: 230  CSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNE 289
            CSV +HF YV+DES GT+R D+EKP +VITRKAF+NNSSKYYI+GKES+YTEVT+LL+++
Sbjct: 226  CSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVTQLLRDQ 285

Query: 290  GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEA 349
            GIDLDHKRFLILQGEVE+I+QMKPKAE+ESDDGLLEYLEDIIGTA YK  IE  + +I+ 
Sbjct: 286  GIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAGLVEIDT 345

Query: 350  LNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLAS 409
            LN+VC+EKENRFE+V++EKNSLESGK+ ALEFL KEK LTLLKSKL Q+ + Q   KL+ 
Sbjct: 346  LNDVCVEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQDQRKLSE 405

Query: 410  TLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGT 469
            TL KIS LN+    EK K+ +  ++V +++ +  + K ++   D   KDL  +RR ++  
Sbjct: 406  TLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKRRLMDRE 465

Query: 470  RVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEE 529
            + S+EE+ +NL  K  K+E+  K T+ S+++++H L+EL+  Q +++ ++  LN+ L EE
Sbjct: 466  KTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLNESLLEE 525

Query: 530  RSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXX 589
            RS LDEIKLSL+DKT +IS EI  HE++LEPW+ QLQEK                     
Sbjct: 526  RSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILKESKEKK 585

Query: 590  XXNVETMEEKILARKAHKQELQDLILNXXXXXXXXRDERSQ-GEENFSSAHLKLEEMQKV 648
              N+  ++ +I A  A K  +Q++ ++          +R   GE+   SA  KL EM+ V
Sbjct: 586  VQNIIQLKTEIEAF-AEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLGEMKNV 644

Query: 649  LNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAIST 708
            L +HRQRAMEARS+LS  +NK+KVL+AL +LQ+SGRI GFHGRLGDLG ID+ +DVAIST
Sbjct: 645  LISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYDVAIST 704

Query: 709  ACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLV 768
            ACPRLDD+VVD VEC QQCI++LRKNKLGYARFI+LD+LR+FNL PI TPE VPRLFDLV
Sbjct: 705  ACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPRLFDLV 764

Query: 769  KPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHV 828
            + K+ KF  AFYSVLRDTLV   LKQAN VAYG++RFRVVT+DGKLID SGT+SGGG HV
Sbjct: 765  RSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSGGGTHV 824

Query: 829  SKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPA 888
             KGLM+   ++      YTPEEV  IE EL+ERE NF +A +T H+ME  LK  +D+EP 
Sbjct: 825  MKGLMK---SKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDREPE 881

Query: 889  IESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDL 948
            IE +I+K  ++ +S ++EL L ++Q+KE          +  ++      L+ L  E+D++
Sbjct: 882  IEVEIAKRRLDIESSSTELKLKQEQLKELETDRDGGSVEDRELADAESKLQVLSEEYDEI 941

Query: 949  QSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGD 1008
            ++ETK K++ I  L+ +IMKIGGTKLQ+QNSKV S+ ++++I+ +           +E D
Sbjct: 942  ENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKAEND 1001

Query: 1009 VLKFQKQLKNSERDVELSSNELKAI-----EEKLKHTKLDLSENDIKMTETFNLRXXXXX 1063
            + + + Q + +  D+E  + E+  I     E + K  KLD S     + ET +L+     
Sbjct: 1002 LKRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTS-----LNETESLKEEVEE 1056

Query: 1064 XXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVT 1123
                    + E   N  +FKS+EIE+ N+LEKLN L  HIKKEI   +  L+ L IRD+T
Sbjct: 1057 EFERVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDIT 1116

Query: 1124 HTLEILDNNTMDIVKTDN---KIEQAVVKEKRSSETQDEKNIQEE--------ERTCDDH 1172
             TL+ L+   +     D+   + E+   +++  S   +  +I EE        ++T  + 
Sbjct: 1117 QTLQALNEGKLPEENEDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEI 1176

Query: 1173 HSMDIDETSNEVIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYARRL 1232
             SMDIDE  NE   G+P+F                    ++Y+D  +VDI VLEEYARRL
Sbjct: 1177 DSMDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARRL 1236

Query: 1233 AEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAE 1292
            AE+K+RKLDLNQAV KRDEV+   E LKKKR D+FM GF+IISMTLKEMYQMITMGGNAE
Sbjct: 1237 AEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNAE 1296

Query: 1293 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1352
            LELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDE
Sbjct: 1297 LELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMDE 1356

Query: 1353 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNI 1412
            IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK +N TRSTT++NI
Sbjct: 1357 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQNI 1416

Query: 1413 DILN 1416
            DILN
Sbjct: 1417 DILN 1420

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1400 bits (3624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 764/1434 (53%), Positives = 991/1434 (69%), Gaps = 25/1434 (1%)

Query: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDP---NSPALETSYAK 57
            M  +PLSKR K   + E  L+ ++ D   +   +++ +R E    P   ++ A+     K
Sbjct: 1    MPKTPLSKRPK---LVEANLNANELDHNDD---DQRYNRQEIKVSPTTQDAAAVSHLNFK 54

Query: 58   SHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPG-TSSRGRDYKAYXXXX----XX 112
            S TP+KL+L   ++           ++SL  P+L PP  +SSRGR  + Y          
Sbjct: 55   SQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYSQSPPRSPAR 114

Query: 113  XXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQV 172
                     LEL+QLSPVKNSR+ LQK+Y S   + KQ  RL I++LVL +FKSYAG QV
Sbjct: 115  SPARSPTRKLELIQLSPVKNSRIALQKIYESK--NEKQIERLCIDKLVLHDFKSYAGTQV 172

Query: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSV 232
            VGPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FP+L+SCSV
Sbjct: 173  VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSV 232

Query: 233  AVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGID 292
             VHFEYVID+  GT+ I+  K  LVITRKAFKNN+SKYYINGKES+YT VTKLLK+EGID
Sbjct: 233  EVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGID 292

Query: 293  LDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNE 352
            LDH RFLILQGEVENIAQMKPKAE + DDGLLEYLEDIIGTA YKPLIE++  +IEALNE
Sbjct: 293  LDHNRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNE 352

Query: 353  VCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLE 412
            +C+EKENRFEIVDREK SLESGK+ ALEFL KEK+LTL+KSKL+Q+K+ Q N KL++TLE
Sbjct: 353  ICIEKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLE 412

Query: 413  KISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVS 472
            K+S++ ++FE  K K   +  ++ E+     E+   I ++  +EK L +++R  +  RVS
Sbjct: 413  KLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVS 472

Query: 473  LEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSV 532
            LEE+ KN+  K +K E+  +   ++IS  +  +++L   ++E+ES++ +LN  L+ ER +
Sbjct: 473  LEEQRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGL 532

Query: 533  LDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXXXXN 592
            L+EIK+SLKDKT + S EI QHEKELEPW+LQLQ K                       +
Sbjct: 533  LEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLEND 592

Query: 593  VETMEEKILARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVLNTH 652
            +E +   I  +   K   +  I +          E S G+  +++A  KL EM+ VLN H
Sbjct: 593  IENLNSLISVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQH 652

Query: 653  RQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPR 712
            RQ+A++AR+SLS  +NK++VL +L +LQKSGRI+GF+GRLGDLG ID+ +D+AISTACPR
Sbjct: 653  RQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPR 712

Query: 713  LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKD 772
            L+D+VV+TVEC QQCI+YLRKNKLGYARFILL++LR F++  ISTP NVPRLFDLV   D
Sbjct: 713  LNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSD 772

Query: 773  PKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGL 832
            PKF  AFYSVLRDTLV  +LK AN VAYG KRFRVVT+ G+LID+SGT+SGGG   S+GL
Sbjct: 773  PKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGL 832

Query: 833  MRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESK 892
            M+L  + ++    YT E+V KIE EL+ RE NF +AN+T  EME EL+ L+D++P +E +
Sbjct: 833  MKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELE 892

Query: 893  ISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSET 952
            ISK E+E  S  +E  L +QQ+ E + +    +S+  +++ +   L  L+ ++  LQ ET
Sbjct: 893  ISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLET 952

Query: 953  KTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKF 1012
            K+KK++IK L+ EIMK+GG KLQ+Q+SKV S+ Q+ DIL             +E ++ + 
Sbjct: 953  KSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETELKRL 1012

Query: 1013 QKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXXXXXXXXXXMV 1072
             K+      D+  S+++L+  + +L      LSE +  + E    R             +
Sbjct: 1013 SKKQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSREESLQNSENLKDQL 1072

Query: 1073 AETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNN 1132
             E EEN++ FK  ++E +NK EKLN+LL  IKK+I   +  L  L IRD+THTL+ LDN 
Sbjct: 1073 KEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNG 1132

Query: 1133 TM-----DIVKTDNKIEQAVVKEKRSSETQDEKNIQEEER----TCDDHHSMDIDETSNE 1183
             +     D+   DN +  +      +SE  +   I+  E       ++   M+IDE +NE
Sbjct: 1133 NIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNE 1192

Query: 1184 VIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEFKRRKLDLN 1243
            + +GIPR                       YID  NV+I VLEEYARR+AE+KRRKLDLN
Sbjct: 1193 ISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLN 1252

Query: 1244 QAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFS 1303
             AV +R++V+  ++ LKK RF+EFM GF +IS+TLKEMYQMITMGGNAELELVDSLDPFS
Sbjct: 1253 NAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFS 1312

Query: 1304 EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1363
            EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS
Sbjct: 1313 EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1372

Query: 1364 IVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNR 1417
            IVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK +N+T+S T++N DI+NR
Sbjct: 1373 IVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINR 1426

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1392 bits (3602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 755/1449 (52%), Positives = 995/1449 (68%), Gaps = 49/1449 (3%)

Query: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNS---------PAL 51
            M D+P SK  KR+ V E     D     Q+L  E+   R+++    N+         P L
Sbjct: 1    MLDTPSSK--KRRTVGE-----DAVTPCQDLALEEDTTRNDERNKNNATKSSLHDSLPKL 53

Query: 52   ETS-----YAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQ----PPGTSSRGRD 102
            ++S     + K+ TPRKL++   EN+YA SQPT SA++SL VP LQ    P    SRGR 
Sbjct: 54   QSSVSPLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRR 113

Query: 103  YKAYXXXX----XXXXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINE 158
             K Y                   LEL+QLSP+KNSR+ELQKLY++H +   +  RL+I++
Sbjct: 114  IKMYSQSPPRSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHK 173

Query: 159  LVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
            LVL NFKSYAG Q +GPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI
Sbjct: 174  LVLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 233

Query: 219  HKSEAFPNLQSCSVAVHFEYVIDESSGTSRID--EEKPGLVITRKAFKNNSSKYYINGKE 276
            HKSE F NL  CSV VHF YV DE +  +  D  E +  LVITRKAFKNNSSKY+INGKE
Sbjct: 234  HKSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKE 293

Query: 277  SSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANY 336
            S++TEVTKLLK +GIDLDHKRFLILQGEVENIAQMK KAEK+++DGLLEYLEDIIGT +Y
Sbjct: 294  SNFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHY 353

Query: 337  KPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLF 396
            KPLIE++  +IEA+NE+C+EKENRF IVD EKNSLE  K+ ALEFL KEKQLTLLKSKL 
Sbjct: 354  KPLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLT 413

Query: 397  QFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSRE 456
            Q+ +  +N K+ +TL +I SL  DFE EK +  + +K+VE ++    E K+ ++S  + E
Sbjct: 414  QYHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEE 473

Query: 457  KDLVLERRELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHE 516
            K L+  +RE+    VSLEE TKNL  K++K++ T + +K  IS+ EH L+E    Q E+E
Sbjct: 474  KSLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYE 533

Query: 517  SEIKDLNQLLEEERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXX 576
            +E+ DL++  E E  +L +IKL LKDKT   S EI   EKELEP + ++QEK        
Sbjct: 534  AEVNDLSKQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVE 593

Query: 577  XXXXXXXXXXXXXXXNVETMEEKILARKAHKQELQDLILNXXXXXXXXRDERSQGEENFS 636
                            +E+++E++L  +   ++ +  + +          E+ +G++   
Sbjct: 594  MEIDLIRDSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECK 653

Query: 637  SAHLKLEEMQKVLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLG 696
             A +KL EM+ +LN+HRQ+ MEARS++S AQNK+KVLT+L ++Q+SGRINGFHGRLGDLG
Sbjct: 654  DAGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLG 713

Query: 697  IIDNSFDVAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPIS 756
            II + +DVAISTACPRLDD+VV++VEC Q CI++LRKNKLGYARF++LD+L++F++ PI 
Sbjct: 714  IIADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQ 773

Query: 757  TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLID 816
            TPENVPRLFDLVKPK+ +F+ A YSVLRDTLVA+ LKQAN VAYG++RFRVVT+DG+LID
Sbjct: 774  TPENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLID 833

Query: 817  ISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEME 876
            ISGT+SGGG+ V KGLM L T  S   + ++ E++ K+E EL+ RE  F VA++T H ME
Sbjct: 834  ISGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSME 893

Query: 877  AELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMK 936
             EL+ L D+EP +E +ISK  ++ D++T ++ L   Q+ E    Y  ++ D   +++++ 
Sbjct: 894  QELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLG 953

Query: 937  NLERLKGEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXX 996
            NLE L  E   LQ ++KT  E++  L+ EIM+IGG++LQ+QNSKV SL QR+DIL A   
Sbjct: 954  NLEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLK 1013

Query: 997  XXXXXXXXSEGDVLKFQKQLKNSERDVELSSNEL---KAIEEKLKHTKLDLSEN-DIKMT 1052
                       ++ K +K L  S  +   S+ E+   KA  E  K++ LD++++ +    
Sbjct: 1014 KSKTVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQD 1073

Query: 1053 ETFNLRXXXXXXXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEK 1112
            E  NL              + E+ EN++EFK++++E++NK+E+ NS+L ++KKE  Q  +
Sbjct: 1074 EKINLEQELENFSDK----LHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLE 1129

Query: 1113 GLSELSIRDVTHTLEIL------DNNTMDIVKTD----NKIEQAVVKEKRSSETQDEKNI 1162
             L+   +RDVTHTL++L      + N      TD    N   + +       E  +  ++
Sbjct: 1130 ELNNFRLRDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSL 1189

Query: 1163 QEEERTCDDHHSMDIDETSNEVIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDI 1222
                +   D  SMD+D+  + V +GIPR                       +I+  +++I
Sbjct: 1190 SNSVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINI 1249

Query: 1223 GVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMY 1282
             +LEEYA+RL EFK+RK+DLN +V +R+++   +E LKKKR++EFM GF+IISMTLKEMY
Sbjct: 1250 EILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMY 1309

Query: 1283 QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1342
            QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY
Sbjct: 1310 QMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY 1369

Query: 1343 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDN 1402
            KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK +N
Sbjct: 1370 KPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHEN 1429

Query: 1403 RTRSTTVKN 1411
             T++ T++N
Sbjct: 1430 MTKNATIRN 1438

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1386 bits (3588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 761/1419 (53%), Positives = 976/1419 (68%), Gaps = 25/1419 (1%)

Query: 5    PLSKRQKRKAVEEPELSLDD--SDATQELQAEKQADRSEKTPDPNSPALETSYAKSHTPR 62
            P  KRQK      PE   ++   D    L+ E Q      +P    PA+    +KSHTPR
Sbjct: 8    PSPKRQKVLESHTPEQQEENRREDDESPLRFEHQQSAVSLSP----PAI----SKSHTPR 59

Query: 63   KLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSS---RGR-DYKAYXXXXXXXXXXXX 118
            KL+L   +NRYAFSQPT SA+ SL VP+LQPP TSS   RGR D K Y            
Sbjct: 60   KLILHQSDNRYAFSQPTVSAS-SLQVPSLQPPETSSSSSRGRRDIKVYSQSPPRSPGRSP 118

Query: 119  XXXLELLQLSPVKNSRV-ELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFH 177
               LEL+QLSPVKN+R+ +LQ+LYNS      ++ RLFIN+LVL NFKSYAG QV+GPF+
Sbjct: 119  TRKLELIQLSPVKNNRIRKLQELYNSQI----KKERLFINKLVLNNFKSYAGEQVIGPFN 174

Query: 178  TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSVAVHFE 237
            T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE+FPNL SCSV V F+
Sbjct: 175  TNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEFQ 234

Query: 238  YVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKR 297
            YV+D+S+G+S+ID+ KP L+ITRKAFKNNSSKY+INGKESSYTEVTKLLK EGIDLDHKR
Sbjct: 235  YVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHKR 294

Query: 298  FLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEK 357
            FLILQGEVENIAQMKPKAE+E DDGLLEYLEDIIGTA+YK  IE+   +++ LNE+C+EK
Sbjct: 295  FLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIEK 354

Query: 358  ENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSL 417
            ENRFEIV+REKNSLES K  ALEF+ KE++LTL KSKL Q+ +L+ + KLASTL+K+S L
Sbjct: 355  ENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSVL 414

Query: 418  NKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERT 477
             ++++ E  KF+ + ++  +++   K++  +I S     K+   ++REL+  + SLEE+ 
Sbjct: 415  QEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEKI 474

Query: 478  KNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIK 537
            K+   K EK+ ++   +K+ +    + ++ L+  Q E ES ++ L   L++E++VL+EIK
Sbjct: 475  KSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEIK 534

Query: 538  LSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXXXXNVETME 597
            LSLKDKT DIS EI QHE+ELEPW  QLQEK                        +E ++
Sbjct: 535  LSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKLK 594

Query: 598  EKILARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVLNTHRQRAM 657
              +  +  +K+  ++ +++          E  +GE   ++A  K+++MQ VL T RQ+ M
Sbjct: 595  NDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKVM 654

Query: 658  EARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPRLDDVV 717
            +ARS L+  +NKSKVL+AL KLQKSGRI+GF+GRLGDLG+IDN +D+AISTA  RLDD+V
Sbjct: 655  DARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDIV 714

Query: 718  VDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKDPKFSN 777
            VD+VEC Q CI+YLRKNKLGYARFILL++LR   L+ I TPENV RLFDLVKP    F  
Sbjct: 715  VDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFIP 774

Query: 778  AFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGT 837
            AFYSVLR+TLVA+ LKQAN VAYG  RFRVVT+DGKLIDISGTI+GGG   ++GLM+L  
Sbjct: 775  AFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLRK 834

Query: 838  NQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTE 897
                 ID Y+ +++ KIE EL ERENNF+ ANDT  EME  L+ L+D++P +E +ISK  
Sbjct: 835  KGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKCL 894

Query: 898  MEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKE 957
            M+ D  + EL   + Q+K+    Y     +K +V  I   L  L+ E+  L   TK   E
Sbjct: 895  MDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLLDSTKNISE 954

Query: 958  KIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKFQKQLK 1017
            KI  L+  IM+IGG  LQMQNSKV S+ Q +DI+ +            E ++ + +K L 
Sbjct: 955  KIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRSEKALS 1014

Query: 1018 NSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXXXXXXXXXXMVAETEE 1077
             +E D +  S E+ +  ++++  +  L   D    +  N               + E E 
Sbjct: 1015 GAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLKEKINEAEI 1074

Query: 1078 NIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTL-EILDNNTMDI 1136
               +FKS EI++K++LEKLN+LL HIK+ I + ++ L  L +R+ T    +  DNN+++ 
Sbjct: 1075 EGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDEGDNNSING 1134

Query: 1137 VKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIRGIPRFXXXXX 1196
            V  D       V  +  ++   E N++ E+ + +    M+ID+ ++E   GIPR      
Sbjct: 1135 V--DRTSHGGGVPLQDQNKVVRENNMRNEKNSTE--AEMEIDDVADEFSPGIPRISKAKL 1190

Query: 1197 XXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQV 1256
                             Y+  TNV+I VLEEYARRLA++  RKLDLNQAV++R+ +K  +
Sbjct: 1191 LQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLNQAVERREALKKLL 1250

Query: 1257 EVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKS 1316
            + LKKKR+DEFM GF IISMTLKEMYQMITMGGNAELEL+DSLDPFSEGVTFSVMPPKKS
Sbjct: 1251 DELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFSEGVTFSVMPPKKS 1310

Query: 1317 WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1376
            WRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA
Sbjct: 1311 WRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1370

Query: 1377 QFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDIL 1415
            QFIVISLRNNMFELAQQL+GIYKRDN+T+S  ++N D L
Sbjct: 1371 QFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1343 bits (3475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/1387 (52%), Positives = 935/1387 (67%), Gaps = 37/1387 (2%)

Query: 53   TSYAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGT---SSRGRDYKAYXXX 109
            T  ++S TPRKLVL S + R+AFSQP  S+++  +VP LQP  +   SSRGR    Y   
Sbjct: 29   TRASRSRTPRKLVLGSPDKRFAFSQPVTSSSS--NVPYLQPLKSELSSSRGR---VYSQS 83

Query: 110  XXXXXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQG--RLFINELVLENFKSY 167
                        LEL+QLSP K +R+E QK   + Q     Q   RL IN L L NFKSY
Sbjct: 84   PPRSPTRSPTRKLELIQLSPTKKTRLESQK---TEQVRGLAQPIERLCINRLSLHNFKSY 140

Query: 168  AGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNL 227
            AG QVVGPFH+SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LSDLIHKSEA PNL
Sbjct: 141  AGTQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNL 200

Query: 228  QSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLK 287
             SC V V F+YV DE  G + + +++PGLV+TRKAFKNN+SKYY+NGKESSYT+VT+LL+
Sbjct: 201  DSCHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLR 260

Query: 288  NEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQI 347
             EGIDLDHKRFLILQGEVE+IAQMKPKAEKE DDGLLEYLEDIIGTA YKPLIE+ + QI
Sbjct: 261  KEGIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQI 320

Query: 348  EALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKL 407
            + LN+VC EKENR+EIV+REK+SLESGK+ ALEFL KEK+LT L+SKL Q K+ +++ K 
Sbjct: 321  DQLNDVCQEKENRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKS 380

Query: 408  ASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELE 467
             +T EKI +L +    E+ K+ E  +++++++++ K +   I      E  L  E+R  +
Sbjct: 381  TNTQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCD 440

Query: 468  GTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLE 527
              RVSLEE+ KN++ K  K+E+T   T  SI+  +  L+EL   Q ++E E+ +LN+ L 
Sbjct: 441  RDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLL 500

Query: 528  EERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXX 587
             E++ LDEIK+SLK KT  IS +I + E+ELEPW+++LQEK                   
Sbjct: 501  VEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLA 560

Query: 588  XXXXNVETMEEKILARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQK 647
                 +   E  I   +    E    I          + +   G+    +A  K++EM+ 
Sbjct: 561  KIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKA 620

Query: 648  VLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAIS 707
            VL THRQR+++A+SSLS  +NK+KVL+AL +LQ+SGRI+GFHGRLGDLG ID+ +DVAIS
Sbjct: 621  VLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAIS 680

Query: 708  TACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDL 767
            TACPRLDDVVV+TVEC QQCI++LRKNKLGYARFILLD+LR FN+  I TP NV RLFDL
Sbjct: 681  TACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDL 740

Query: 768  VKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNH 827
            V P D KF NAFYSVLRDTLVA+ LK+AN VAYG++RFRVVT+DGKLID+SGT+SGGGNH
Sbjct: 741  VHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNH 800

Query: 828  VSKGLM---RLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRD 884
             + G+M   RL T  S     +T EEV +I+ EL+ERE NF++A DT+HEME  L++L+D
Sbjct: 801  RASGMMKSERLNTGAS-----FTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKD 855

Query: 885  QEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKN--LERLK 942
            +EP IE+ ISK  ME DS+ SE+ L E +   A +     L++ +   +I  N  L+ LK
Sbjct: 856  REPEIETDISKRRMEIDSLLSEIKLCEDRA--ASLKKEQKLNESSDDTLIEANSRLDSLK 913

Query: 943  GEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXX 1002
             E   L+ E K+KK KIK LQ +IMKIGGTKLQ+Q S V S+ QR+ I +          
Sbjct: 914  AECKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAV 973

Query: 1003 XXSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXX 1062
              +E D+ +++KQ      D++  +NEL++I+E +  +   + E +  + +         
Sbjct: 974  KKAENDLKRYEKQAGQLSVDIDQCTNELESIKELISSSDNKILELEASIDKLQKEGEEIE 1033

Query: 1063 XXXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDV 1122
                    ++ E      +F   E+++ N+LEKLN LL HI K+ +   K L  L IRDV
Sbjct: 1034 EKVREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDV 1093

Query: 1123 THTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQD---------EKNIQEEERTCDDHH 1173
            T TL+ L+   +   ++ +++      E RS E  +         E  +  E        
Sbjct: 1094 TATLQTLNKLLLSESRSGDEL-HGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPED 1152

Query: 1174 SMDIDETS--NEVIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYARR 1231
             MD+DE          +P+                     + +++    DI VLEEY +R
Sbjct: 1153 QMDVDEPEEMETSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAYADIEVLEEYTKR 1212

Query: 1232 LAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNA 1291
            L +F+ RKL+LN+AV++RD V+   + L+KKR DEFM GFN ISMTLKEMYQMITMGGNA
Sbjct: 1213 LVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNA 1272

Query: 1292 ELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1351
            ELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMD
Sbjct: 1273 ELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1332

Query: 1352 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKN 1411
            EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYK  N T+S  ++N
Sbjct: 1333 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALEN 1392

Query: 1412 IDILNRT 1418
             D++NR+
Sbjct: 1393 KDLINRS 1399

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1334 bits (3452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 736/1408 (52%), Positives = 951/1408 (67%), Gaps = 82/1408 (5%)

Query: 53   TSYAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPG---TSSRGRDYKAYXXX 109
            T  ++S TPRKLVL S + R+AFSQP +S+++  +VP+LQP     +SSRGR    Y   
Sbjct: 29   TRASRSRTPRKLVLGSPDKRFAFSQPVSSSSS--NVPHLQPLKNELSSSRGR---VYSQS 83

Query: 110  XXXXXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAG 169
                        LEL+QLSP+K SR+E QK   S       Q RL I+ LVL NFKSYAG
Sbjct: 84   PPRSPNRSPTRKLELIQLSPMKKSRLESQKFQESRAMMGSIQ-RLCIDRLVLHNFKSYAG 142

Query: 170  RQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQS 229
             QVVGPFH SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQ +LS+LIHKSE  P+L S
Sbjct: 143  TQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDS 202

Query: 230  CSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNE 289
            C V + F+YV DE  GT+ I ++KP +VI RKAF+NN+SKYY+NGKESSYT +T+LL++E
Sbjct: 203  CHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDE 262

Query: 290  GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEA 349
            GIDLDHKRFLILQGEVE+IAQMKPKAEKESDDGLLEYLEDIIGTA YKPLIE  +++I  
Sbjct: 263  GIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAK 322

Query: 350  LNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLAS 409
            LN++C EKENRFEIV+REK+SLE GK  ALE+L KEK LT+L+SKL Q+ + ++  KL S
Sbjct: 323  LNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNS 382

Query: 410  TLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGT 469
            T EKI+   +    EK K  +  +++  +K   + +K  +      EK L LE+R  +  
Sbjct: 383  TKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRD 442

Query: 470  RVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEE 529
            RVSLEE+ KNL  K  KS R+ +    SIS  +  ++EL   Q +HE ++ +LN  ++EE
Sbjct: 443  RVSLEEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEE 502

Query: 530  RSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXX 589
            +  LDEIK SLKDK   IS +I + EKELEPW+++LQEK                     
Sbjct: 503  KEKLDEIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKI 562

Query: 590  XXNVETMEEKILARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVL 649
              ++  + + I   +    E +  + +          + + G+    +A  K++EM+ +L
Sbjct: 563  EQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGIL 622

Query: 650  NTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTA 709
              HRQR+++ARSSLS  +NK+KVL AL +LQ+SGRI+GFHGRLGDLG ID+ +DVAISTA
Sbjct: 623  TAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTA 682

Query: 710  CPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVK 769
            CPRLDD+VV+TVEC QQCI+YLRKNKLGYARFILLD+LR FNL PI TPENVPRL+DLV+
Sbjct: 683  CPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVR 742

Query: 770  PKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVS 829
            P +PKF NAFYSVLRDTLVA+ LK+AN VAYG++R+RVVT+DGKLID+SGT+SGGGN  +
Sbjct: 743  PNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKA 802

Query: 830  KGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAI 889
            +G+M+    QSN    +T EEV +I+ ELSERE+NF++A DT+HEME  L+ L+D+EP I
Sbjct: 803  RGMMK-SEQQSNSA--FTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEI 859

Query: 890  ESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQ-------VNMIMKNLERLK 942
            E  ISK +++ DS++SE+     +  E R+ Y   L +KAQ       ++     L+ LK
Sbjct: 860  ELDISKRKLDIDSLSSEM-----KASEGRLEY--LLQEKAQKESSNEELSTAEVKLKSLK 912

Query: 943  GEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXX 1002
             E+ +L++E ++KK+++KVLQ +IMK+GGTKLQMQ+S V S+ QR+ I++A         
Sbjct: 913  SEYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDL 972

Query: 1003 XXSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHT--KLD-LSENDIKMTETFNLRX 1059
              ++ D+ ++QKQ +    +++  S E   IE  L  +  K+D LSE+  K+ +   L  
Sbjct: 973  KKAQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELEL-- 1030

Query: 1060 XXXXXXXXXXXMVAETEENIDE-------FKSLEIEMKNKLEKLNSLLMHIKKEINQQEK 1112
                        V + EE+IDE       F++LEI+   +L+KL  L   + KE  +   
Sbjct: 1031 --------TEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLH 1082

Query: 1113 GLSELSIRDVTHTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCDDH 1172
             L+ L IRDVT TL+ LD +    ++ ++K E A       +ET  E   ++ E +   H
Sbjct: 1083 SLNSLKIRDVTATLQALDES----LENESKNEVA-------AETPGE---EDGEHSSSLH 1128

Query: 1173 HSMDIDETSNE----------------------VIRGIPRFXXXXXXXXXXXXXXXXXXX 1210
              MD+DE   E                      +  G+P+                    
Sbjct: 1129 DPMDVDENQGESTSTTEAQLQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQ 1188

Query: 1211 XSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTG 1270
               Y++    DI +LEEYARRL E+K RK+DLN AVQ+RD+V+   E LKKKR DEFM G
Sbjct: 1189 LQDYVENAYADIEILEEYARRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEG 1248

Query: 1271 FNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTL 1330
            FN I M LKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTL
Sbjct: 1249 FNAICMILKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTL 1308

Query: 1331 SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL 1390
            SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL
Sbjct: 1309 SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL 1368

Query: 1391 AQQLVGIYKRDNRTRSTTVKNIDILNRT 1418
            A+QLVG+YK  N T+S  ++N D+++R+
Sbjct: 1369 AKQLVGVYKNKNMTKSVALQNTDLIDRS 1396

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1324 bits (3426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 701/1384 (50%), Positives = 947/1384 (68%), Gaps = 30/1384 (2%)

Query: 44   PDPNSPALETSYAKSHTPRKLVLSSGENRYAFSQPTNSATT-SLHVPNLQPPGTSSRGRD 102
            P P  P +        TP KL+ +S + +   S+ ++ +TT  L  P+LQPP      R 
Sbjct: 4    PTPKKPRI------LDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISRG 57

Query: 103  YKAYXXXXXXXXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLE 162
               Y               +EL+QLSP+KNSR+ELQ+LY++ Q   K+  RL I  LVLE
Sbjct: 58   RSQYSQSPPRSPNRSPGRAVELIQLSPIKNSRLELQRLYDTKQ---KKVERLCIRTLVLE 114

Query: 163  NFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 222
            NFKSYAGRQVVGPFH+SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE
Sbjct: 115  NFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSE 174

Query: 223  AFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEV 282
             +P+L  CSV + F+YV+DE  GT+R+   KP L + RKAFKNN+SKYY+NGKES+YTEV
Sbjct: 175  KYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEV 234

Query: 283  TKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEE 342
            T+LL++EGIDLDHKRFLILQGEVE+IAQMKPKAE E DDGLLEYLEDIIGT  YK  IE+
Sbjct: 235  TRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQ 294

Query: 343  QMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQ 402
             + ++++LN++C+EKENRF++V++EK SLE GK+ AL FL KEK LTLL SK +Q+ +  
Sbjct: 295  ALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFH 354

Query: 403  SNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLE 462
            + SKLA TL  +S+     E EK K  E+ K++ E+    +++ +R+ S ++  K+ + +
Sbjct: 355  NGSKLAKTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAK 414

Query: 463  RRELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDL 522
             R+LE   VS EE+ K+L  K  K+E+T    ++SI + E+ ++E  +Q  E+E+ +  L
Sbjct: 415  MRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTL 474

Query: 523  NQLLEEERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXX 582
            N  + + ++ L+++KL+L DKT DI+ E+   EKELEPW  +++EK              
Sbjct: 475  NHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISII 534

Query: 583  XXXXXXXXXNVETMEEKILARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKL 642
                      +  + ++I   + +    ++ I          RD    GE   +SA  KL
Sbjct: 535  KEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKL 594

Query: 643  EEMQKVLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSF 702
            EEM+KVL THRQR  +ARS++S A+NK+KVLTALS+LQKSGRI+G+HGRLGDLG ID+ +
Sbjct: 595  EEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKY 654

Query: 703  DVAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVP 762
            D+AISTACPRLDD+VVDTVEC QQCI++LRKNKLGYARFILLD+LR+FNLQP  TPENVP
Sbjct: 655  DIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVP 714

Query: 763  RLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTIS 822
            RLFDLVKPK+PKF+ AFYSVLRDTLV   L QAN VAYG+KR+RVVT+DGKLIDISGT++
Sbjct: 715  RLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMT 774

Query: 823  GGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNL 882
            GGG+  + GLM+  T QS+    YTPEEV ++E EL+ERE NF+VA +T  EME+ L+N 
Sbjct: 775  GGGDRAASGLMK-STQQSSL---YTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNY 830

Query: 883  RDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLK 942
             D++P IE ++SK +M+ ++I++EL    ++  E   +   ++ D +++    + L  L 
Sbjct: 831  LDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALN 890

Query: 943  GEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXX 1002
             + +   S +++K ++IK L+ +IM+IGG +LQ  NSKV SL Q++ I+ A         
Sbjct: 891  ADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQ 950

Query: 1003 XXSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXX 1062
              +E ++ + +KQ   ++ D+E    E++ ++         + E   ++++         
Sbjct: 951  KKAELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLT 1010

Query: 1063 XXXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDV 1122
                     + +  E ID + S+EIE+  +L+KL +L  ++KKE+N+ +  LS L +RD+
Sbjct: 1011 DEHAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDL 1070

Query: 1123 THTLEILDNN----------TMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCDDH 1172
               +  L+ N          T D  K +N I+ ++++   +S + +E+ I       +++
Sbjct: 1071 GQVMLDLEENKSLQSFSHSPTPD-TKREN-IQSSMLETHLASPSPNERKIS----IAENN 1124

Query: 1173 HSMDIDETSNEVIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYARRL 1232
             SM++DE ++ +  G+P+                       YID + VDI +L+EYA+RL
Sbjct: 1125 LSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRL 1184

Query: 1233 AEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAE 1292
            AE++RR++DLN+A+ KRDE +   EVLKK+R DEFM GF IIS+TLKEMYQMITMGGNAE
Sbjct: 1185 AEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAE 1244

Query: 1293 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1352
            LELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDE
Sbjct: 1245 LELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1304

Query: 1353 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNI 1412
            IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+LVGIYK  N TRSTT++N 
Sbjct: 1305 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNR 1364

Query: 1413 DILN 1416
            DI+N
Sbjct: 1365 DIIN 1368

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1313 bits (3399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 714/1388 (51%), Positives = 941/1388 (67%), Gaps = 39/1388 (2%)

Query: 51   LETSYAKSH--TPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYXX 108
            L TS    H  TP KL+  S   ++  SQ ++++TT+L  P+LQPP  S   R    Y  
Sbjct: 4    LRTSKKPKHLDTPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYSQ 63

Query: 109  XXXXXXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYA 168
                         +EL+QLSP+KNSR+ELQK+Y+  Q++TK   RL I  L+L NFKSYA
Sbjct: 64   SPPRSPNRSPARRIELIQLSPIKNSRLELQKIYDGKQTTTK---RLSIKNLILNNFKSYA 120

Query: 169  GRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQ 228
            G QVVGPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE   NL 
Sbjct: 121  GVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLS 180

Query: 229  SCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKN 288
             CSV + F+YV+D++ G +++  +   L + RK FKNN+SKYYINGKESSYTEVT+ L+N
Sbjct: 181  FCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRN 240

Query: 289  EGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIE 348
            EGIDLDHKRFLILQGEVE+IAQMKPKA+ E DDGLLEYLEDIIGTA YK  I + + +++
Sbjct: 241  EGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMD 300

Query: 349  ALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLA 408
             LN++C+EKE RFE+V++EK SLE+GKE ALEF+AKEKQLTLLKSK  Q+ + +   KLA
Sbjct: 301  TLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLA 360

Query: 409  STLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEG 468
             TL+KIS+  +  E E+ K+ E  K++ +++     ++++I+  ++ +  LV ++ +L+ 
Sbjct: 361  VTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQR 420

Query: 469  TRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEE 528
              VS EE+ K+L  K  K+E+T +  +++I   E+ ++ L+  QTE E+ + +LN+ L  
Sbjct: 421  ELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHS 480

Query: 529  ERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXX 588
            ERS LD IK+SL+DKT  IS E+   EKELEPW  +L+ K                    
Sbjct: 481  ERSELDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLK 540

Query: 589  XXXNVETMEEKILARK----AHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEE 644
                +  + + I + K     HK+++    L             +QGE    SA  KL +
Sbjct: 541  LEQEISQLRKDIESYKDRIENHKKKINK--LEKESAAITSFISTAQGE--CDSAKKKLVD 596

Query: 645  MQKVLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDV 704
            M++VL  HRQR  +AR +LS  +NK+KVL AL +LQKSGRI+GFHGRLGDLG ID+ +D+
Sbjct: 597  MKQVLTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDI 656

Query: 705  AISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRL 764
            AIS ACPRLDD+VV+TVECAQQCI++LRKNKLGYARFILLD+L++FN+  ++TPENVPRL
Sbjct: 657  AISVACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRL 716

Query: 765  FDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGG 824
            FDL  PK+  F+ A YSVLRDTLVA+ L QAN VAYG +RFRVVT+DGKLIDISGT+SGG
Sbjct: 717  FDLTTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGG 776

Query: 825  GNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRD 884
            G+ V KGLM+    +SN  D YT EEV ++E EL++RE NF++A DT  EMEA L+  +D
Sbjct: 777  GDRVVKGLMK-SKQRSN--DMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKD 833

Query: 885  QEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGE 944
            ++P I+ +ISK +++ D+++SEL   +  + E      N   D   +  I   L  L  E
Sbjct: 834  RQPNIDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSE 893

Query: 945  HDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXX 1004
               L+ E+K K E+I  L+ +IMKIGG KLQ QNSKV SL Q+L I+VA           
Sbjct: 894  LVALKDESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKK 953

Query: 1005 SEGDVLKFQKQLKNSERD-----VELS--SNELKAIEEKLKHTKLDLSENDIKMTETFNL 1057
            +E ++ +  KQ   +E D     +ELS  +N  +A++E L+ T     E+ I++ E  + 
Sbjct: 954  NELEMNRASKQKLGAENDINHCEIELSKTNNSHEALQEGLRET-----EHLIEVIE--DK 1006

Query: 1058 RXXXXXXXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSEL 1117
            +             + +    +++FKS EIEM   LEKL +L  HIK EI++ ++ L+ L
Sbjct: 1007 KEQLNQEHETAKKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTL 1066

Query: 1118 SIRDVTHTLEILDNNTMDI-------VKTDNKIEQAVVKEKRSSETQD--EKNIQEEERT 1168
             +RDV   L+ LD + + +       V   N+    +  E   ++  D   K I E+  +
Sbjct: 1067 KLRDVEQLLQKLDEHNLPLESLTDRAVTPSNQCIPEMTVEDHDADMNDGEAKLISEDPNS 1126

Query: 1169 CDDHHSMDIDETSNEVIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEY 1228
             +D  SMD+D+ ++ +  G+P+                       Y+D    DI +LEEY
Sbjct: 1127 FNDQESMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEY 1186

Query: 1229 ARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMG 1288
            A RLAE+KRRKLDLN++V+KR+E++ + E+LKK R +EFM GF IISMT+KE+YQMITMG
Sbjct: 1187 ALRLAEYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMG 1246

Query: 1289 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLY 1348
            GNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1247 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1306

Query: 1349 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTT 1408
            VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL+GIYK  N T+STT
Sbjct: 1307 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTT 1366

Query: 1409 VKNIDILN 1416
            ++NIDILN
Sbjct: 1367 LQNIDILN 1374

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1288 bits (3333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 711/1371 (51%), Positives = 934/1371 (68%), Gaps = 33/1371 (2%)

Query: 57   KSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYXXXX----XX 112
            KS+TP K+++S+  +      P+   ++S   P+LQ P +SSRGR  KAY          
Sbjct: 45   KSYTPMKVIISNNHSNSISPLPSQLMSSSTQPPSLQHPSSSSRGRAVKAYSQSPPRSPDR 104

Query: 113  XXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQV 172
                     LEL+QLSP+KNSR ELQK+Y+S Q    +  R+ +N+LVL NFKSYAG Q 
Sbjct: 105  SPVRSPTRKLELIQLSPIKNSRSELQKIYSSKQEEKIE--RICLNKLVLHNFKSYAGTQT 162

Query: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSV 232
            +GPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L+DLIHKSE +P+L SC+V
Sbjct: 163  IGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAV 222

Query: 233  AVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGID 292
             VHFEY+ID    T++I+  K  L+ITR+AFKN++SKYY+NGKES+Y  +T LLK EGID
Sbjct: 223  DVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGID 282

Query: 293  LDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNE 352
            LDH RFLILQGEVENIAQMKPKAEKE DDGLLEYLEDIIGT  YK LI+++  +IEALN+
Sbjct: 283  LDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALND 342

Query: 353  VCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLE 412
            +C+E+ENRF+I+DREK SLES KE+ALE+L+KEK+  ++KSKL Q+K+ Q+N KL++TLE
Sbjct: 343  ICIERENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLE 402

Query: 413  KISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVS 472
            KI+ L  ++  EK K  E   K++E++    + +D + +    EK+LV  +R L+   VS
Sbjct: 403  KITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVS 462

Query: 473  LEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSV 532
              E+ KN+  K++K+ +  +   ++IS +   LK  H  +   E+++ +L+  L  E  +
Sbjct: 463  NTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQL 522

Query: 533  LDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXXXXXXXXN 592
            L+ IKL LKDKT  +S EI++ EK+LEPW+++L E                        N
Sbjct: 523  LENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKAN 582

Query: 593  VETMEEKILARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEMQKVLNTH 652
            +E +E+ +  +    ++ +  + N          E   G      A+ KL EMQK+L   
Sbjct: 583  IEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQD 642

Query: 653  RQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPR 712
            RQ+A +AR+SLS  +N+SKVL AL KLQKSGRINGFHGRLG+LG+ID  +DVAISTACPR
Sbjct: 643  RQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPR 702

Query: 713  LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKD 772
            L+D+VVD+VEC QQCI+YLRKN LG+ARFILLD+L +F+++ ISTP NVPRLFDL+K  D
Sbjct: 703  LNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVND 762

Query: 773  PKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGL 832
             KF  AFYSVLR+TLVA  LK+AN VAYG+ R+RVVT+ G LIDISGT+SGGGN  SKG 
Sbjct: 763  EKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGA 822

Query: 833  MRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESK 892
            M+L  + S +   Y+ EEV +IE ELS RE N++ A +TV EME EL+NL++ EP IE +
Sbjct: 823  MQLSNSTSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELE 882

Query: 893  ISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSET 952
            ISK   E DS+ +E +L  +Q+ E   ++    +  A +  +   L  L  +   ++S+ 
Sbjct: 883  ISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQM 942

Query: 953  KTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKF 1012
            K+KK++IK LQ +IMKIGG KLQMQNSKV SL ++  IL+             E DV K 
Sbjct: 943  KSKKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKL 1002

Query: 1013 QKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMT----ETFNLRXXXXXXXXXX 1068
             K+LK SE D    + +  A+E +LK+ +  L++N+  M     + F LR          
Sbjct: 1003 SKKLKESESDNTKLNEKKIALENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNE- 1061

Query: 1069 XXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEI 1128
               + E E  + EFK+LE+E K K EKL SLL  IKK +   E+  S LSIR+V + L++
Sbjct: 1062 ---LTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDL 1118

Query: 1129 LDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCDD--HHSMDIDETSNEVIR 1186
            L+                 +KE+ + + + E     E+   +D  +  M I++ +NE+ +
Sbjct: 1119 LN-----------------IKEQEAQKIKTELYADFEQNQSNDVINDEMIIEDNNNEIAK 1161

Query: 1187 GIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAV 1246
            GIP +                      Y +   VD+ +LEEY RR+ E+++RK DLNQ+V
Sbjct: 1162 GIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSV 1221

Query: 1247 QKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1306
            ++RD+V+ ++E LKK RF+EFM  FNIISMTLKEMYQ+ITMGGNAELELVDSLDPFSEGV
Sbjct: 1222 EQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGV 1281

Query: 1307 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1366
            TFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1282 TFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1341

Query: 1367 NYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNR 1417
            NYIKERTKNAQFIVISLRNNMFELA+QLVGIYK  N+T+S T+KN DIL R
Sbjct: 1342 NYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDILCR 1392

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1273 bits (3293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/1447 (48%), Positives = 953/1447 (65%), Gaps = 57/1447 (3%)

Query: 1    MCDSPLSKRQK---RKAVEEPELSLDDSDATQELQAEKQADRSEKTPDPNS-------PA 50
            M DSP+SK+QK    +  ++   +    +           D ++ T  P         P 
Sbjct: 1    MPDSPISKKQKITESRDEDKKINNNIIINHNNRDINRSHVDDADITIGPYQGQEKHIQPQ 60

Query: 51   LETSYAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGTSSRGRDYKAYXXXX 110
             +  + +S TPRKL++SS ++R+  SQP N  +     P+LQ P  S+ GR++K Y    
Sbjct: 61   SQDRHGRSRTPRKLIVSSADHRFTMSQP-NLLSADSQTPSLQHPSVST-GREHKFYSQSP 118

Query: 111  ----XXXXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKS 166
                           LEL+QLSP+KN+R ELQK+Y   Q+  K+  RL I  LVL NFKS
Sbjct: 119  PRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQ-KRTIRLVIERLVLTNFKS 177

Query: 167  YAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPN 226
            YAGRQVVGPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +L DLIHKSE +P 
Sbjct: 178  YAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPE 237

Query: 227  LQSCSVAVHFEYVIDE-SSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKL 285
            L SCSV +HF+YVID+ + G S+IDE K  LV+ RKAFKNNSSKYYIN KESS+T+VT L
Sbjct: 238  LSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTL 297

Query: 286  LKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMN 345
            LKNEGIDLDHKRFLILQGEVENIAQMKPK+EKE DDGLLEYLEDIIGT++YK  IE  ++
Sbjct: 298  LKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLS 357

Query: 346  QIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNS 405
            ++EALNE+C+EKENRF IV++EK+SL  GK  AL++LA EK L L KSK +Q ++   N 
Sbjct: 358  KVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNK 417

Query: 406  KLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRE 465
            KL STL KI+   ++++ E  K+    K+++ ++ +   +  R++     E+ L+  +R+
Sbjct: 418  KLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRK 477

Query: 466  LEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQL 525
                 +S +E  KN+  K + +E+    T++SI++  + L+ L+ QQ ++  +I++LN+ 
Sbjct: 478  NNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEK 537

Query: 526  LEEERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXXXX 585
            L+ E+S L+EIK+SLK KT+  S EI+++EKELEP+ +QLQEK                 
Sbjct: 538  LKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNEN 597

Query: 586  XXXXXXNVETMEEKILARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAHLKLEEM 645
                   + ++++ I  +K     + + I          R E   G+  F+    K++EM
Sbjct: 598  KDNLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEM 657

Query: 646  QKVLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVA 705
            +  L++HRQ+A ++R+SLS  QNK+ VLTAL KLQKSGRI+GF+GRLGDLG+ID  +DVA
Sbjct: 658  RDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVA 717

Query: 706  ISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLF 765
            ISTACPRL+D+VVD+V+C QQCIDYLRKN+LGYARFILLD+LR+FNL  I TP+N PRLF
Sbjct: 718  ISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLF 777

Query: 766  DLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGG 825
            DL++ ++ KF  AFYSVLRDTLVA +L  AN VAYG++RFRVVT+DGKLIDISGT+SGGG
Sbjct: 778  DLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGG 837

Query: 826  NHVSKGLMRLGTN-QSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRD 884
            N+V +GLM+LG +   N  +  +PEEV K+E EL   E NF+VA +++ EM  E+ ++++
Sbjct: 838  NYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKE 897

Query: 885  QEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGE 944
            Q PA E  ISKT +E +   +E+     Q+KE +  +    ++  ++ +    L+ LK E
Sbjct: 898  QIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKE 957

Query: 945  HDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXX- 1003
            +  L  +TK  K++I+ L+ +IM  GG +L+MQNSKV SL  +L I+ +           
Sbjct: 958  YYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKK 1017

Query: 1004 -------------XSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIK 1050
                          ++ + L+F+  L+NS++ V L S EL  +E  +  T+         
Sbjct: 1018 NNNILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQ--------- 1068

Query: 1051 MTETFNLRXXXXXXXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQ 1110
                 N +               E EE+   FKS E+E+KNKL+KL  L  H++K+I + 
Sbjct: 1069 -----NAKEEILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKL 1123

Query: 1111 EKGLSELSIRDVTHTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCD 1170
            +  L+ L+IR+++  LE            D ++E+  + +  ++E     +      +  
Sbjct: 1124 DTELNALTIREISQNLESF----------DERLEKYDISKNGATEDTQHTSSALNSVSNI 1173

Query: 1171 DHHSMDIDETSNEVIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYAR 1230
            +  +MDID T NE+  GI R                        ++ +  +I +LEEY R
Sbjct: 1174 NTDTMDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVR 1233

Query: 1231 RLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGN 1290
            RL+E+K+RK DL++++ +++  K + EVLKKKR +EF TGF+IIS+TLKEMYQMITMGGN
Sbjct: 1234 RLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGN 1293

Query: 1291 AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1350
            AELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVM
Sbjct: 1294 AELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVM 1353

Query: 1351 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVK 1410
            DEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYK +N T+S T+ 
Sbjct: 1354 DEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLV 1413

Query: 1411 NIDILNR 1417
            N D+LNR
Sbjct: 1414 NNDMLNR 1420

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1209 bits (3129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 679/1395 (48%), Positives = 925/1395 (66%), Gaps = 43/1395 (3%)

Query: 46   PNSPALETSYAKSHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPGT--SSRGRDY 103
            P +   E S  ++ TPR L+ S  ENR     PT   + +L +P+L PP +  S+RGRD+
Sbjct: 25   PKAVTFEQS-PRAITPRNLLGS--ENRNVL--PT-GGSQNLQIPSLLPPESLGSARGRDF 78

Query: 104  KAYXXXXXXXXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLEN 163
            K+Y               L+L++LSP+KNSR ELQKLY S +   K++ RLFI++LVL +
Sbjct: 79   KSYSQSPPRSPGRSPTRRLKLIELSPIKNSRAELQKLYESKKLDVKKE-RLFIHQLVLND 137

Query: 164  FKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEA 223
            FKSYAGRQV+GPFHTSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 
Sbjct: 138  FKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSET 197

Query: 224  FPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVT 283
            FP+L+SCSV VHF+YVID+  G++ IDE K  LV+TRKAFKNN+SKY++NGKES+YTEVT
Sbjct: 198  FPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVT 257

Query: 284  KLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQ 343
             LLK EGIDLDHKRFLILQGEVENIAQMK KAEKE+DDGLLEYLEDIIGT+ YK  IE+ 
Sbjct: 258  TLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKL 317

Query: 344  MNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQS 403
              +IE+LNE+C+EKENRF IV+REKNSLESGKE AL+FL KEK+L L KSKL+Q+ ++Q 
Sbjct: 318  SMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNLMQD 377

Query: 404  NSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLER 463
            N KL   L K +++ ++   ++ +F+++   + ++      +K  +    + E +L   +
Sbjct: 378  NKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTK 437

Query: 464  RELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLN 523
            R LE  +V  E+   NL +K ++ E  SK  +  I+  +  ++ +  +Q+        L+
Sbjct: 438  RTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLS 497

Query: 524  QLLEEERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXXXXXX 583
              L+ E+  L+ IKL L++KT+ ++ +I ++EKEL PW+ Q Q+                
Sbjct: 498  TNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIE 557

Query: 584  XXXXXXXXNVETMEEKILARK----AHKQELQDLILNXXXXXXXXRDERSQGEENFSSAH 639
                    ++  +E  IL++K      +QE++ L+            ER  GE    +A 
Sbjct: 558  ENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLL----EQKTKVIQERELGERECKNAQ 613

Query: 640  LKLEEMQKVLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIID 699
              L  +++ +   RQ+A+E RS+ S  +N +KVL+AL +LQKSGR+NGFHGRLGDL +ID
Sbjct: 614  ATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVID 673

Query: 700  NSFDVAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPE 759
              +DVAISTACPRL+D+VVDTVE  QQCI+YLRKNKLGYARFILLD+L  FN   I TP+
Sbjct: 674  PKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPD 733

Query: 760  NVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISG 819
               RLFDL+  K+ +F+NAFYSVLRDTLV ++++QAN VAYG+KR+RVVT+DG LID+SG
Sbjct: 734  QSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSG 793

Query: 820  TISGGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAEL 879
            T++GGG +VSKGLM+L  + S     ++PEEV  IE+EL+++EN ++ A D  HEME EL
Sbjct: 794  TMTGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEEL 853

Query: 880  KNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLE 939
            + LRD+ P I++ +SK EM+ ++  +++      ++E R    +  +       ++  L+
Sbjct: 854  RRLRDRAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSITLLAKLK 913

Query: 940  RLKGEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQN-------SKVGSLCQRLDILV 992
             LK + DD+  +TK+ K+KIK ++ +I+++GG +L+ Q+       +K+    +RL  + 
Sbjct: 914  ELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGDELKNQSLLVTDITNKISENSRRLKKIK 973

Query: 993  AXXXXXXXXXXXSEGDVLKFQKQLKNSERDVELSSNELKAIEEKL---KHTKLDLSENDI 1049
            +              ++ +  ++L N  ++ E +  E K IE KL   K +  +L EN++
Sbjct: 974  SNKLKKESLLKKFNKELTEANEELTNFSKNAENADIESKEIESKLLDIKESIENLKENEV 1033

Query: 1050 KMTETFNLRXXXXXXXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQ 1109
            K+     ++             +   ++ + ++KS+ +E  NKLEKL +    +KK I +
Sbjct: 1034 KLEHEIEMKHNE----------LESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKR 1083

Query: 1110 QEKGLSELSIRDVTHTLE-ILDNNTMDIVKTDNKIEQ--AVVK---EKRSSETQDEKNIQ 1163
                LSEL+IRDVT  L  I+      + K+D K+E   AV+    +  S+ ++++    
Sbjct: 1084 YNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVINADDDGISAVSENQSFNH 1143

Query: 1164 EEERTCDDHHSMDIDETSNEVIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIG 1223
             +E    D + M+ID     +  GIP                        +I  +  ++ 
Sbjct: 1144 NDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVD 1203

Query: 1224 VLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQ 1283
            VLEEYA R  EF +RK DLN AVQ RD VK ++E +K+KR+DEFM GF IISMTLKEMYQ
Sbjct: 1204 VLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQ 1263

Query: 1284 MITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYK 1343
            MIT+GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYK
Sbjct: 1264 MITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYK 1323

Query: 1344 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNR 1403
            PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QLVGIYK +N 
Sbjct: 1324 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENM 1383

Query: 1404 TRSTTVKNIDILNRT 1418
            T+S  + N D++ R 
Sbjct: 1384 TKSAALVNEDLVGRA 1398

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1204 bits (3116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/1388 (49%), Positives = 924/1388 (66%), Gaps = 47/1388 (3%)

Query: 47   NSPALE---TSYAKSHTPRKLVLSSGENRYAFS--QPTNSATTSLHVPNLQPPGTSS-RG 100
            +SP ++    S + + TPRKLVL S E +YA S  Q T +A+ ++  P+LQPP   + RG
Sbjct: 12   DSPEIKRQRVSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRG 71

Query: 101  RDY-KAYXXXXXXXXXXXXXXXLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINEL 159
            R+Y ++                LEL++LSP K++R+ELQK+   H+++T+   RL I++L
Sbjct: 72   REYSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRLELQKM---HEANTQTSQRLCIDKL 128

Query: 160  VLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH 219
            VL NFKSYAG Q +GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIH
Sbjct: 129  VLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIH 188

Query: 220  KSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSY 279
            KSE FP+L SCSV +HF YV D  +G ++I      +V+ R+AFKNNSSKYY+NGKES+Y
Sbjct: 189  KSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNY 248

Query: 280  TEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPL 339
            TEVT+LLK EGIDLDHKRFLILQGEVE+IAQMK KAEK++DDGLLEYLEDIIGTA +KP 
Sbjct: 249  TEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQ 308

Query: 340  IEEQMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFK 399
            IE+ + +IE LNEVC+EKENRFE+VD+EK +LESGKE ALEFL KE++ T+LK++L Q +
Sbjct: 309  IEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQ 368

Query: 400  VLQSNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDL 459
            +  SN KLA++ +KIS+LN +F+ EK +++   K+ E +  +    K   ++ ++  K++
Sbjct: 369  IYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNV 428

Query: 460  VLERRELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEI 519
              ++R LE   ++ +E+ K++A K++ +E+    ++ +   A + ++ L     + E E+
Sbjct: 429  NSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIEL 488

Query: 520  KDLNQLLEEERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKXXXXXXXXXXX 579
             +LN  +  E+  L+EIK+ L +KTKD+S E+   E++LEP+  Q+QEK           
Sbjct: 489  HNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKI 548

Query: 580  XXXXXXXXXXXXNVETMEEKILARKAHKQELQDLILNXXXXXXXXRDERSQGEENFSSAH 639
                           T+E KI       ++LQ   L         R+E+S+ E   S+A 
Sbjct: 549  TMLKSSHSNLLKEKATIESKI-------EDLQLEELKQKETETSLRNEKSKVEARISTAQ 601

Query: 640  LKLEEMQK-------VLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRL 692
             + EE QK       VL   RQ   EA+++L+  QNK++VL AL+KLQ SGRI GFHGRL
Sbjct: 602  KECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRL 661

Query: 693  GDLGIIDNSFDVAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNL 752
            GDLG ID+ +D+AISTACPRLDD+VV+TVEC QQCID+LRKNKLGY RFILLD+LR+ NL
Sbjct: 662  GDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNL 721

Query: 753  QPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDG 812
              I+TPENVPRLFDL+ P    F  AFYSVLRDTLVAR L+QAN VAYG++RFRVVT+DG
Sbjct: 722  DRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDG 781

Query: 813  KLIDISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTV 872
            KLIDISGT+SGGG+    GLMR   +++     Y+ +EV K+E +LS +E N+R A   V
Sbjct: 782  KLIDISGTMSGGGSSPQSGLMR---SKATTASQYSRDEVEKMEVQLSTKETNYRSALSMV 838

Query: 873  HEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVN 932
            HEME+ L+ L D+ P I+ +ISK ++E  S  +E+    Q++  +++A   ++++K Q  
Sbjct: 839  HEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRL--SQLARELSMNEKNQQP 896

Query: 933  MI--MKNLERLKGEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDI 990
            ++   K L+ L+         +K  ++KI  L+  IM+ GG +L+MQ +KV SL Q ++I
Sbjct: 897  LLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEI 956

Query: 991  LVAXXXXXXXXXXXSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIK 1050
            L              + D+ +  ++      +V + + ++  + E+L+  +L+    + +
Sbjct: 957  LHEKQKKEKTRSKKLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQ 1016

Query: 1051 MTETFNLRXXXXXXXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQ 1110
            + E    +             +   E + +EFK+ E+E  ++LEKL+ L  ++KK++   
Sbjct: 1017 VIENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSY 1076

Query: 1111 EKGLSELSIRDVTHTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCD 1170
            E  L  L IRDV+  L  L++    I+++   +  A V      +TQ          +  
Sbjct: 1077 ETSLQSLKIRDVSKLLSQLNDG---IIESCTDV-TAKVMNGDIVQTQ----------SIT 1122

Query: 1171 DHHSMDIDETSNEVI--RGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEY 1228
            D  + D  E S E     G+P                        Y+D  N DI VLEEY
Sbjct: 1123 DVGNNDAMEDSGEAATHSGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEY 1182

Query: 1229 ARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMG 1288
            ARRLAE++RRKLDLNQAV KR+EV+ + E  K +R ++FM GF IISMTLKEMYQMITMG
Sbjct: 1183 ARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMG 1242

Query: 1289 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLY 1348
            GNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1243 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1302

Query: 1349 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTT 1408
            VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYK +N T+STT
Sbjct: 1303 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTT 1362

Query: 1409 VKNIDILN 1416
            ++NIDIL+
Sbjct: 1363 LQNIDILH 1370

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  182 bits (462), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 189/746 (25%), Positives = 337/746 (45%), Gaps = 110/746 (14%)

Query: 702  FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRL--RQFNLQPISTP 758
            + VA+ST   +  D V+VD    AQQC+ +L+K + G   FI LD +   + ++  + T 
Sbjct: 548  YTVAVSTILGKSFDAVIVDHFSVAQQCVSFLKKQRSGILSFIPLDTIDVNKVSMMALDTK 607

Query: 759  ENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTIDGKLIDI 817
                 +  +   +D     A   V  D+++  SL  A ++ + R  R ++V++DG ++  
Sbjct: 608  GCTLAIDAIDYERD--LERAMQYVCSDSIICDSLAIAKDLKWRRNVRAKLVSLDGSIVHK 665

Query: 818  SGTISGG-----GNHVSK----GLMRLGTNQSNKIDDYTPEEVNKIEHE-LSERENNFRV 867
            +G ++GG     GN   K    GLM L      +I + +    N I+ E +   EN    
Sbjct: 666  AGLMTGGTTKSSGNRWDKEEYQGLMSLKDTLLGEISELSS--ANTIDSERIRSTENELSF 723

Query: 868  ANDTVHEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSD 927
             N  V  +  +L  ++    ++  K ++ + + + I  E     Q +KEA  A+      
Sbjct: 724  LNSDVMSLRTQLNQVK---RSLNEKETEIQYQQELIKGEFEPKIQSLKEAMTAH------ 774

Query: 928  KAQVNMIMKNLERLKGEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQR 987
                    K   R + E D L              +G+I    G K+       G + +R
Sbjct: 775  -------AKTTARFEEEKDRLLDSVYAD------FEGDI----GFKVSQYEKHSGEMMRR 817

Query: 988  LDILVAXXXXXXXXXXXSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSEN 1047
                                D+ K Q Q+   E+ +E  +  L++ +E+ +  ++D+ + 
Sbjct: 818  -----------------QLEDLRKLQMQIAGIEKKLEFETERLQSTQERQQRVQVDIEKA 860

Query: 1048 DIKMTETFNLRXXXXXXXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEI 1107
             IK+ E  N                ++ +   DE + +E+ +  +  +L++L   I K++
Sbjct: 861  KIKL-EALN----------------SDEQRITDEIQGVELTINEEQTRLDNLQNEINKDL 903

Query: 1108 NQQEKGLSELSIRDVTHTLE----ILDNNTMDIVKTDNKIEQA-VVKEKRSSETQDEKNI 1162
               E   SE +I++ T  L+    + +    DI K  N +E+A V+K  +    +     
Sbjct: 904  --VELNSSEETIQEATEHLQSAKRMHEALAEDIDK--NSLEKANVLKNCKMLNIKLPDGS 959

Query: 1163 QEEERTCDDHHSMDIDETSNEVIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDI 1222
               ER   D  S    E +N V     R                        IDE N  +
Sbjct: 960  SSLERVPLDGVSDATIEAANAVFVNFTRLNRRLKQSGEAETGNELQRS----IDELNELL 1015

Query: 1223 GVLEEYARRLAEFKRRKLDLNQAVQKRDE-------VKGQVEVLKKKRFDEFMTGFNIIS 1275
             VL+  ++    ++  K+      ++ ++       V  Q   +++ R D F + F+ +S
Sbjct: 1016 TVLQPNSKAAGRYEEAKVKYESIFKETEKCKTKEKKVNEQFAKIRRLRKDAFESAFDHVS 1075

Query: 1276 MTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGG 1326
              + ++Y+ +T          GGNA L L D  +P+  G+ +   PP K ++++  LSGG
Sbjct: 1076 NAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPYLAGIRYHATPPTKRFKDMEFLSGG 1135

Query: 1327 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNAQFIVISLRN 1385
            EKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  +A YI++R   N QFIVISL+N
Sbjct: 1136 EKTIAALALLFAINSFQPSPFFVLDEVDAALDILNVERIATYIRQRALSNLQFIVISLKN 1195

Query: 1386 NMFELAQQLVGIYK--RDNRTRSTTV 1409
             MFE +Q LVG+++  RDN +R+ T+
Sbjct: 1196 TMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 100/390 (25%), Positives = 182/390 (46%), Gaps = 41/390 (10%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL   EL   NFKSY G+  +G   ++F++V+GPNGSGKSN++D++ FV G ++  +R 
Sbjct: 2   GRLLGIELY--NFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRS 59

Query: 212 DRLSDLIHK------------SEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVIT 259
             L+DLI++            SE   N  + S A    YV    +  S   +E     +T
Sbjct: 60  HTLADLIYRGTLQDGDADSGYSETHDNENNPSSA----YV---KAFYSPSGQENDVAELT 112

Query: 260 RKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKES 319
           R    +  S Y +NG+  S+ +    L++E I +  + FL+ QG+VE +A  KP+     
Sbjct: 113 RTITLSQESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE---- 168

Query: 320 DDGLLEYLEDIIGTANYKP---LIEEQMNQIEALNEVCLEKENRFEIVDREKNSLESGKE 376
              L    E + G+  YK     + E++ +  +     ++   R  I  +   S + G  
Sbjct: 169 ---LTTLFEQVSGSIQYKQEYDRLREELEKARSATSELIQSRKRANIGLK---SFKEGVN 222

Query: 377 TALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFET--EKVKFQESL-- 432
              E+    ++   L+ +L  +++    +K  S  E + S  ++ ++   ++  +E +  
Sbjct: 223 KDEEYRKHLEERNKLQQQLIVWQLFHLQAKRDSLTESLKSSQRELQSLDSELNSEEQIVA 282

Query: 433 -KKVEEVKTQRKEIKDRISSNDSREK--DLVLERRELEGTRVSLEERTKNLANKIEKSER 489
            KK+   K Q    K R   +D  +K   L      ++ ++ S+++R      KIE  +R
Sbjct: 283 KKKLSYAKKQTLAAKQRTRLSDKTKKVDHLTSSLLPIKSSKESIDKRLSAAVTKIESLQR 342

Query: 490 TSKCTKRSISEAEHTLKELHTQQTEHESEI 519
                +  + + EH LK ++  +T  ++EI
Sbjct: 343 DIDRQESLVKQYEHQLKVVNKAKTNFQAEI 372

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  180 bits (456), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 189/754 (25%), Positives = 331/754 (43%), Gaps = 114/754 (15%)

Query: 702  FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPEN 760
            + +A+ST   +  D V+V+ +  AQ+CI +L+K + G A FI LD + +  L  +S P++
Sbjct: 544  YGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTI-ETELPTLSLPDS 602

Query: 761  VPRLFDL-VKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTIDGKLIDIS 818
               +  +     +P++  A   V  D+++  +L  A ++ + +  R ++VTI+G LI  +
Sbjct: 603  QDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGIRGKLVTIEGALIHKA 662

Query: 819  GTISGG-----GNHVSK----GLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRV-- 867
            G ++GG      N   K     LM L      +ID+ +            +R N+ R   
Sbjct: 663  GLMTGGISGDANNRWDKEEYQSLMSLKDKLLIQIDELSN----------GQRSNSIRARE 712

Query: 868  ANDTVHEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSD 927
              ++V  + +++ NLR Q    +  + +  +E                   I YHN L +
Sbjct: 713  VENSVSLLNSDIANLRTQVTQQKRSLDENRLE-------------------IKYHNDLIE 753

Query: 928  KAQVNMIMKNLERLKGEHDDLQSETKTKKEKIKVLQGEIMK-----IGGTKLQMQNSKVG 982
            K     I   +  LK + DDL++      ++ + LQ  I K     IG T  + +N   G
Sbjct: 754  KE----IQPKITELKKKLDDLENTKDNLVKEKEALQNNIFKEFTSKIGFTIKEYENHS-G 808

Query: 983  SLCQRLDILVAXXXXXXXXXXXSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKL 1042
             L ++                    ++ + QKQ+   E  ++  ++ L   + + +  + 
Sbjct: 809  ELMRQ-----------------QSKELQQLQKQILTVENKLQFETDRLSTTQRRYEKAQK 851

Query: 1043 DLSENDIKMTETFNLRXXXXXXXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMH 1102
            DL    ++M                        E  I   +S   E KN L++L    + 
Sbjct: 852  DLENAQVEM--------------KSLEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFVT 897

Query: 1103 IKKEINQQEKGLSELSIRDVTHTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNI 1162
             + E+N      SE  + D+   L++L      I +   K +   V   ++ +  +    
Sbjct: 898  KQSELNS-----SEDILEDMNSNLQVLKRERDGIKEDIEKFDLERVTALKNCKISNINIP 952

Query: 1163 QEEERTCDDHHSMDIDETSNEVI----------RGIPRFXXXXXXXXXXXXXXXXXXXXS 1212
               E T DD   + I  T NE I          +G+P+                      
Sbjct: 953  ISSETTIDD---LPISSTDNEAITISNSIDINYKGLPKKYKENNTDSARKELEQKIHEVE 1009

Query: 1213 YYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFN 1272
              ++E   +   LE Y      F+    +  Q   +  ++  Q   +KKKR + F   F+
Sbjct: 1010 EILNELQPNARALERYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFD 1069

Query: 1273 IISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL 1323
             +S  L  +Y+ +T          GGNA L + D  +PF+ G+ +   PP K ++++  L
Sbjct: 1070 YVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYL 1129

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVIS 1382
            SGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + QFIVIS
Sbjct: 1130 SGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVIS 1189

Query: 1383 LRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILN 1416
            L+N MFE +  LVG+Y R  +  S+ +  +D+ N
Sbjct: 1190 LKNTMFEKSDALVGVY-RQQQENSSKIITLDLSN 1222

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 93/169 (55%), Gaps = 15/169 (8%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R 
Sbjct: 2   GRLV--GLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRS 59

Query: 212 DRLSDLIHK-------SEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFK 264
           + L DLI++       S+ + N  + S      YV       +++ E      + R   +
Sbjct: 60  NILKDLIYRGVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVE------LMRIISR 113

Query: 265 NNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP 313
           N  + Y I+GK  SY + +  L+NE I +  K FL+ QG+VE IA   P
Sbjct: 114 NGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSP 162

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  175 bits (443), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 189/749 (25%), Positives = 349/749 (46%), Gaps = 115/749 (15%)

Query: 702  FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQF-NLQPISTPE 759
            + +A+ST   +  D VVVDT+  AQ+CI YL+K + G   FI LD +  F    P +  +
Sbjct: 538  YALAVSTILGKNFDSVVVDTLSVAQECITYLKKQRAGIISFIPLDTIDAFVPTLPTTNIQ 597

Query: 760  NVPRLFDLVKPKDPKFSNAFY-----SVLRDTL-VARSLKQANNVAYGRKRFRVVTIDGK 813
             +  + + +   D ++  A       S++ DTL +A+SLK  +NV       ++VT++G 
Sbjct: 598  GITLVLNAI-DYDQEYDKAMQYVCSDSIMCDTLSIAKSLKWKHNVTS-----KLVTLEGT 651

Query: 814  LIDISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEV----NKIEHELSERENNFRVAN 869
            LI  +G ++GG   VSK        Q N+ D    + +    +K+  ++ +  NN +   
Sbjct: 652  LIHRAGLMTGG---VSK-------EQGNRWDKEEYQGLVTLKDKLLIQIEQLSNNSK--- 698

Query: 870  DTVHEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKE--ARIAYHNALSD 927
                 +EA     RD    +ES IS+       + ++++   + ++E  A + YH  +  
Sbjct: 699  --TFAIEA-----RD----LESNISQLNSSISDLRTQISQINRSIEENKAEVQYHEDM-- 745

Query: 928  KAQVNMIMKNLERLKGEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQR 987
                         LK E++  Q++  TK E I+  + EI+   G K  +QN+       +
Sbjct: 746  -------------LKKEYEPKQNQLNTKLESIEKSKSEII---GQKELLQNTVFKEFHNK 789

Query: 988  LDILVAXXXXXX-XXXXXSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSE 1046
            L   +             S  ++ + +KQ+ N E  ++      ++ E++ K  ++DL  
Sbjct: 790  LGFTIQEYEHHSGEALRQSNKELQQLEKQVLNIESKLQFEVERYESTEKRHKKAQIDLEN 849

Query: 1047 NDIKMTETFNLRXXXXXXXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKE 1106
            N+                       +   +EN  E  +   +++N + ++  +L    KE
Sbjct: 850  NN---------------------STIESLQENEAEVVAKIKDIENGMLEIKKVLEDFSKE 888

Query: 1107 INQQEKGLSELSIRDVTHTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEE 1166
            I++++K L+ ++   ++   E+L  +T + +    +IE+  +++          NIQ   
Sbjct: 889  IDRKKKKLA-IAEDSLSEKSELLTTSTNEKISIKEEIEKKDLEKLGILTNCKISNIQVPV 947

Query: 1167 RTCDDHHSMDIDETSNEVIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLE 1226
             +  D +++ I +  N+ I                          S    E    I V+E
Sbjct: 948  ASKIDLNNLPIGKIDNDAILISNEISLDYKTLPAKYKESSSSKIRSALEHE----IEVVE 1003

Query: 1227 EYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKK--------------KRFDEFMTGFN 1272
            +  + L    R     ++A ++ D    + E LKK              KR + F   F+
Sbjct: 1004 DLLQDLQPNARAVDRFDEAKERFDSASDETETLKKQERKLLTQFLAIKKKRREVFEKAFD 1063

Query: 1273 IISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL 1323
             +S  ++ +Y+ +T          GGNA L L D  +PF  G+ +   PP K ++++  L
Sbjct: 1064 YVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKYHATPPLKRFKDMEYL 1123

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNAQFIVIS 1382
            SGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANYI++ +  + QFIVIS
Sbjct: 1124 SGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERIANYIRKHSNSDIQFIVIS 1183

Query: 1383 LRNNMFELAQQLVGIYK--RDNRTRSTTV 1409
            L+N+MFE +  LVGI++  ++N +R  T+
Sbjct: 1184 LKNSMFEKSDALVGIHRQQQENSSRVVTL 1212

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 89/166 (53%), Gaps = 13/166 (7%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL   EL   NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV GF+++ +R 
Sbjct: 2   GRLVGLELF--NFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRS 59

Query: 212 DRLSDLIHKSEAFPNLQSCSVAVHFEYVID-ESSGTSRIDEEKPGLVI--TRKAFKNNSS 268
             L DL+++          + A   E+  D E S   +   EK G V+   R       S
Sbjct: 60  STLKDLVYR--------DIASADENEFGEDGERSAYVKAFYEKDGTVVELMRAITAGRDS 111

Query: 269 KYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPK 314
            Y I+ K ++Y   +  L  E I +  + FL+ QG+VE IA   P+
Sbjct: 112 VYKIDNKTTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPR 157

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  170 bits (430), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 179/742 (24%), Positives = 335/742 (45%), Gaps = 102/742 (13%)

Query: 702  FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPEN 760
            F VA+ST   +  D V+VD    AQQC+ +L+K + G   FI LD +    +  I++   
Sbjct: 545  FAVAVSTVLGKNFDAVIVDNFLVAQQCVSFLKKQRSGVVSFIPLDTVDVSKVPMIASEFK 604

Query: 761  VPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTIDGKLIDISG 819
               L       +P    A   V  D+++  +L+ A ++ +    R ++V+I+G ++  +G
Sbjct: 605  GCILAIDAIDYEPDLERAMQYVCSDSIICDTLQIAKDLKWKHNIRSKLVSINGSIVHRAG 664

Query: 820  TISGGGNHVSKGLMRLGTNQSNK--------IDDYTPEEVNKIEHELSERENNFRVANDT 871
             ++GG    SKG    G N+ +K        + D   +E++++           R+  + 
Sbjct: 665  LMTGGA---SKG----GNNRWDKEEYQSLMSLKDVFLKELSELSAASISDAERIRILEND 717

Query: 872  VHEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQV 931
            +  +  +L +L+ Q    +  + + E E   I  ++ LAE ++ E RI            
Sbjct: 718  LSILNTDLMSLKTQLAQSKRMLKEKETE---IQYQIDLAEGEI-EPRI------------ 761

Query: 932  NMIMKNLERLKGEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDIL 991
                                 KT K+ +     EI  +   K ++QNS    + + +   
Sbjct: 762  ---------------------KTLKDDLHRYNQEIADLEKQKAKLQNSVYADVFRDVGFT 800

Query: 992  VAXXXXXXXXXXXSEG-DVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIK 1050
                          +  D+ K Q Q+ + ++ +E     L A +E+ +  ++DL +  IK
Sbjct: 801  AVEYEMHSGIILKKQAEDLRKLQMQMVSIDKKLEFEVERLHATQERQQKAQVDLEKAKIK 860

Query: 1051 MTETFNLRXXXXXXXXXXXXMVAETEENIDEFKSLEIEMKNKLEKLNSL---LMHIKKEI 1107
            +    N              ++ E ++ +D   SL+ E    L  LN+L   +  I  ++
Sbjct: 861  LEALNNDEESINLKIEMEERIIDEEQKQLD---SLQDEASQNLAGLNALDEQIQEINDDL 917

Query: 1108 NQQEKGLSELSIRDVTHTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQE-EE 1166
            +  ++    LS    T+TLE L  N +   K  N      +K    S + DE  + + +E
Sbjct: 918  SASKRKNEALSEDLETNTLERL--NVLKNCKMQN------IKLPEGSSSLDELPLDKVDE 969

Query: 1167 RTCDDHHSMDIDETSNEVIRGIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLE 1226
             T +  + + I+        G+ +                        IDE N  + +L+
Sbjct: 970  FTLNAANDVSINYA------GLSKKLRQSGEEETGAGLKKS-------IDELNELLTILQ 1016

Query: 1227 EYARRLAEFKRRKLDLNQAVQKRDEVKGQ-------VEVLKKKRFDEFMTGFNIISMTLK 1279
              ++    ++  KL      ++ ++ K +          +K+ R + F   F+ +S ++ 
Sbjct: 1017 PNSKAAGRYEDAKLRYESIYKETEKCKAKEKKVNEDFTRIKRLRKEAFEKAFDHVSSSID 1076

Query: 1280 EMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTL 1330
            E+Y+ +T          GGNA L L D  +P+  G+ +   PP K ++++  LSGGEKT+
Sbjct: 1077 EIYRELTRDPHSRAELAGGNASLTLEDEDEPYLAGIRYHATPPAKRFKDMEYLSGGEKTI 1136

Query: 1331 SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNAQFIVISLRNNMFE 1389
            ++LAL+FA++ ++P+P +V+DE+DAALD  NV  VA+YI+ +   + QFIVISL+N MFE
Sbjct: 1137 AALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYIRRKAGADLQFIVISLKNTMFE 1196

Query: 1390 LAQQLVGIYK--RDNRTRSTTV 1409
             +Q LVG+++  ++N +++ T+
Sbjct: 1197 KSQALVGVFRQQQNNTSKALTL 1218

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 114/229 (49%), Gaps = 38/229 (16%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G+  +G   ++F++++GPNGSGKSN++D++ FV G ++  +R 
Sbjct: 2   GRLI--GLELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRS 59

Query: 212 DRLSDLIHK--------------SEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLV 257
             L+DLI++              SE  PN  S  V   +          S  + E   + 
Sbjct: 60  HLLADLIYRGTLSEEEASSADFESENHPN--SAYVKAFY----------SPSNNEDDVVE 107

Query: 258 ITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEK 317
           ++R   ++  S Y I+GK   Y + ++ L++E I +  + FL+ QG+VE +A  KP+   
Sbjct: 108 LSRTVTRSQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-- 165

Query: 318 ESDDGLLEYLEDIIGTANYKP---LIEEQMNQIEALNEVCLEKENRFEI 363
                L +  E + G+  YK     I E++ +  +    C++   R  I
Sbjct: 166 -----LTDLFEQVSGSLQYKQDYDRIREELERARSETSDCIQSRKRAHI 209

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  167 bits (422), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 198/775 (25%), Positives = 347/775 (44%), Gaps = 135/775 (17%)

Query: 687  GFHGRLGDLG-IIDNSFDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILL 744
            G  G + DL     + + V+++T   +  D V+VD++  AQ+CI YL+K + G   FI L
Sbjct: 528  GVKGIVSDLCHPKKDKYSVSVATVLGKNFDSVIVDSLSVAQECIAYLKKQRAGVISFIPL 587

Query: 745  D-------RLRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANN 797
            D        L   N+Q     +N           + ++  A   V  D ++  +L  A  
Sbjct: 588  DTVDSAVATLPSVNIQGYLLAKNAMEY-------ESQYERAINYVCGDAIICDTLDLAKK 640

Query: 798  VAYGRK-RFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEV--NKI 854
            + +    + +++ +DG LI  +G ++GG   +SK     G N+ +K ++Y       +KI
Sbjct: 641  LKWDHGFKNKLIALDGSLIHRAGLMTGG---ISKD----GNNRWDK-EEYQSLMTLKDKI 692

Query: 855  EHELSERENNFRVANDTVHEME-------AELKNLRDQEPAIESKISKTEME-------A 900
              ++ +     R A+    E+E       AE+ ++R Q   I   I + ++E        
Sbjct: 693  LQQIEDTAAYGRSASIQARELESNISLLNAEIASIRTQLTQINRSIEENKVEINHQIHLV 752

Query: 901  DSITSELTLAEQQVKEARIAYHNALS---DKAQVNMIMKNLERLKGEHDDLQSET----K 953
            D   S + L+ ++ KE+ +   N L+   D+ QV +     +++     D +S +    +
Sbjct: 753  DKEYSPMILSLKKKKESILKQSNELTEEKDRVQVVIFKAFTDKVGFSVRDYESHSGEVMR 812

Query: 954  TKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAXXXXXXXXXXXSEGDVLKFQ 1013
               ++++ LQ EI+ +   KLQ +  ++ S   RL                 E    K+ 
Sbjct: 813  QNAKELQQLQKEILTV-ENKLQFERERLESTRGRLLKAEEDIKKAQLELSLLEEQEKKYH 871

Query: 1014 KQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRXXXXXXXXXXXXMVA 1073
             Q+K  E D+     +++  E +++  KL+++  +    E+ N                 
Sbjct: 872  TQIKPLEEDICSFEKQIEEKETEIEGKKLEINNKE----ESLN----------------- 910

Query: 1074 ETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEI---NQQEKGLSELSIRDVTHTLEILD 1130
            E + +++  K    E+   +E L+   + I +     N+    LSE ++ DV     I  
Sbjct: 911  EVQSSVEAVKRQHDEISTDIENLDLERIGILRNCKISNRDLPILSETNLADVP----ITS 966

Query: 1131 NNTMDIVKTDNKI----EQAVVKEKRSSETQDEKNIQEEERTCDDHHSMDIDETSNEVIR 1186
            N   D +K  N+I    E+   K K SS  Q EK +    R+ ++ + M   E      R
Sbjct: 967  NEQGDAIKMSNEIDIDYEELPTKYKESSSKQLEKELT---RSIEEVNEM--LEILQPNAR 1021

Query: 1187 GIPRFXXXXXXXXXXXXXXXXXXXXSYYIDETNVDIGVLEEYARRLAEFKRRKLDLNQAV 1246
             + RF                        DE       ++    RL   +R+        
Sbjct: 1022 AVGRF------------------------DEAQERFNAIDNETERLKSEERK-------- 1049

Query: 1247 QKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVD 1297
                 +  Q    KKKR + F   F+ +S  +  +Y+ +T          GG+A L L D
Sbjct: 1050 -----IYAQFLKTKKKRKELFDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLED 1104

Query: 1298 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1357
              +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAAL
Sbjct: 1105 EDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAAL 1164

Query: 1358 DFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYKR--DNRTRSTTV 1409
            D +NV  +A YI K    + QFIVISL+N+MFE +  LVG+Y+R  +N +R  T+
Sbjct: 1165 DIKNVERIAAYIRKHGNPSLQFIVISLKNSMFEKSDALVGVYRRQQENSSRLVTL 1219

 Score =  100 bits (250), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 111/204 (54%), Gaps = 22/204 (10%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLL--GLELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRS 59

Query: 212 DRLSDLIHKSEAFP-----NLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNN 266
             ++DLI++    P              H  YV   S+  S+  +E   + + R   KN 
Sbjct: 60  SAVADLIYRG-VVPEEEDDGEGEGDGDAHRAYV---SAFYSKGPQEST-VELKRTISKNG 114

Query: 267 SSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 326
            S Y I+ ++ +Y + ++ L+++ I +  K FL+ QG+VE +A   P         L + 
Sbjct: 115 DSTYQIDRRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------LTKL 167

Query: 327 LEDIIGTANYKP---LIEEQMNQI 347
            E++ G+A YK    L+++Q+ Q+
Sbjct: 168 FEEVSGSAQYKKEYDLLKDQLEQL 191

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  141 bits (355), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 69/161 (42%), Positives = 104/161 (64%), Gaps = 10/161 (6%)

Query: 1259 LKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1309
            +KKKR + F   F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1095 IKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSTVELAGGNASLTIEDEDEPFNAGIKYH 1154

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1155 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1214

Query: 1370 -KERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTV 1409
             + R  + QFIVISL+N MFE +  LVG+Y++     S TV
Sbjct: 1215 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTV 1255

 Score =  103 bits (256), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 111/215 (51%), Gaps = 25/215 (11%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R 
Sbjct: 38  GRLV--GLELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRS 95

Query: 212 DRLSDLIHKS----------EAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRK 261
           + L DLI++           ++  +  + +   +  YV       +++ E      +TR 
Sbjct: 96  NILKDLIYRGVLDDGNDENIDSGADDNAITSNPNSAYVKAFYQKGNKLVE------LTRL 149

Query: 262 AFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDD 321
             +N  + Y I+GK  +Y + +  L+NE I +  K FL+ QG+VE IA   P        
Sbjct: 150 ISRNGDTTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPT------- 202

Query: 322 GLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLE 356
            L    E++ G+  YK   +E   +IE L++   E
Sbjct: 203 DLSRMFEEVSGSIQYKKEYDELKEKIEKLSKSATE 237

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  140 bits (354), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 120/204 (58%), Gaps = 32/204 (15%)

Query: 1244 QAVQKRDEVKGQVEVL---------------------KKKRFDEFMTGFNIISMTLKEMY 1282
            +AV++ DE +G+ EV+                     K+KR + F   F+ +S  L  +Y
Sbjct: 1023 RAVERYDEAEGRFEVINNETEQLKTEEKKILNQFLKIKRKRKELFEKTFDYVSDHLDAIY 1082

Query: 1283 QMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSL 1333
            + +T          GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++L
Sbjct: 1083 RELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAAL 1142

Query: 1334 ALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQ 1392
            AL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE + 
Sbjct: 1143 ALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSD 1202

Query: 1393 QLVGIYKRDNRTRSTTVKNIDILN 1416
             LVG+Y R  +  S+ +  +D+ N
Sbjct: 1203 ALVGVY-RQQQENSSKIITLDLSN 1225

 Score = 99.4 bits (246), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 107/222 (48%), Gaps = 39/222 (17%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R 
Sbjct: 2   GRLV--GLELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRS 59

Query: 212 DRLSDLIHKS-----------------EAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKP 254
           + L DLI++                   A  N +S  V   ++       G   ++    
Sbjct: 60  NILKDLIYRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQ------KGNKMVE---- 109

Query: 255 GLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPK 314
              + R   +N  + Y I+ K  SY + +  L+NE I +  K FL+ QG+VE IA   P 
Sbjct: 110 ---LMRIISRNGDTSYKIDEKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPI 166

Query: 315 AEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLE 356
                   L    E++ G+  YK   +E   +IE L++   E
Sbjct: 167 E-------LSRMFEEVSGSIQYKKEYDELKEKIEKLSKSATE 201

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  140 bits (354), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 107/168 (63%), Gaps = 11/168 (6%)

Query: 1259 LKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1309
            +KKKR + F   F+ +S  L  +Y+ +T          GGNA L L D  +PF+ GV + 
Sbjct: 1062 IKKKRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYH 1121

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1122 ATPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1181

Query: 1370 KER-TKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILN 1416
            +     N QFIVISL+N MFE +  LVG++ R  +  S+ +  +D+ N
Sbjct: 1182 RRHGNPNLQFIVISLKNTMFEKSDALVGVF-RQQQENSSKIVTLDLRN 1228

 Score = 73.2 bits (178), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 138/294 (46%), Gaps = 43/294 (14%)

Query: 687 GFHGRLGDLG-IIDNSFDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILL 744
           G  G + DL     + + +A+ST   +  D ++VD +  AQ+CI + +K + G A FI L
Sbjct: 534 GVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPL 593

Query: 745 DRLRQFNLQPISTPENVPRLFDLVKP-----KDPKFSNAFYSVLRDTLVARSLKQANNVA 799
           D +   + QP     N+P   D +        DP++  A   V  D+++  SL  A ++ 
Sbjct: 594 DTIS--SEQPTL---NLPSSQDYILTINAIEYDPEYERAMQYVCSDSIICNSLDIARDLK 648

Query: 800 YGRK-RFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEV----NKI 854
           + +  R ++VTI+G LI  +G ++GG          +  + +N+ D    + +    +K+
Sbjct: 649 WNKGVRSKLVTIEGALIHKAGLMTGG----------ISKDSNNRWDKEEYQSLMTLKDKL 698

Query: 855 EHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQV 914
             ++ E     R+++    ++E EL  L  +  ++  ++S+ +   D   +E        
Sbjct: 699 LLQVEEISTKSRLSSTRARDVEIELSTLNAEISSLRMQLSQVQRSLDENKTE-------- 750

Query: 915 KEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIKVLQGEIMK 968
               I + N L D+ Q N  +K+L+    E D   +E K+ KEK   LQ EI K
Sbjct: 751 ----INHQNTLLDQ-QYNPKLKSLKEKVDEFDKSWNELKSNKEK---LQNEIFK 796

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  139 bits (351), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/161 (41%), Positives = 104/161 (64%), Gaps = 10/161 (6%)

Query: 1259 LKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1309
            +K+KR + F   F+ +S  L  +Y+ +T          GGNA L + D  +PF+ G+ + 
Sbjct: 1061 IKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDEPFNAGIKYH 1120

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1121 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDITNVQRIAAYI 1180

Query: 1370 -KERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTV 1409
             + R  + QFIVISL+N MFE +  LVG+Y++     S T+
Sbjct: 1181 RRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTI 1221

 Score =  102 bits (253), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 107/224 (47%), Gaps = 41/224 (18%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+N +R 
Sbjct: 2   GRLV--GLELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRS 59

Query: 212 DRLSDLIHKS-------------------EAFPNLQSCSVAVHFEYVIDESSGTSRIDEE 252
           + L DLI++                        N +S  V   ++       G   ++  
Sbjct: 60  NVLKDLIYRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQ------KGNKLVE-- 111

Query: 253 KPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
                + R   +N  + Y I+GK  SY + +  L+NE I +  K FL+ QG+VE IA   
Sbjct: 112 -----LMRIISRNGDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQS 166

Query: 313 PKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLE 356
           P         L +  E++ G+  YK   +E   +IE L +   E
Sbjct: 167 PIE-------LSKMFEEVSGSIQYKKEYDELKEKIEKLGKSATE 203

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  139 bits (351), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 108/168 (64%), Gaps = 11/168 (6%)

Query: 1259 LKKKRFDEFMTGFNIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1309
            +KK+R + F   F+ ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYH 1113

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
             MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1114 AMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYI 1173

Query: 1370 KER-TKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILN 1416
            +     + QFIVISL+N MFE +  LVG+Y R  +  S+ +  +D+ N
Sbjct: 1174 RRHGNPDLQFIVISLKNTMFEKSDALVGVY-RQQQENSSKIVTLDLRN 1220

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 105/217 (48%), Gaps = 34/217 (15%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRL--TGLELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRS 59

Query: 212 DRLSDLIHK------SEAFP----NLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVI--T 259
           + L DLI++      SE  P         S  V   Y +D             G V+   
Sbjct: 60  NILKDLIYRGVIRDFSEEDPEDGEEQHPTSAYVKAFYEMD-------------GKVVELM 106

Query: 260 RKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKES 319
           R    N  + Y I+ K  SY +    L+ E I +  K FL+ QG+VE IA        +S
Sbjct: 107 RTININGDTTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIAS-------QS 159

Query: 320 DDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLE 356
              L +  E+I G+  YK   +   +++E L +   E
Sbjct: 160 ALDLSKLFEEISGSIQYKKEYDSLKDELEKLGKSTTE 196

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 72/133 (54%), Gaps = 6/133 (4%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQP-ISTPE 759
           + +A+S    +  D ++V+ +  A++CI +L+K + G A FI LD +   + QP +S P 
Sbjct: 542 YGLAVSVMLGKNFDSIIVENLSVARECISFLKKQRAGTASFIPLDTID--SEQPTLSAPP 599

Query: 760 NVPRLFDL-VKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTIDGKLIDI 817
           +   +  +     D  +  A   V  D+++  +L  A ++ + R  R ++V++DG LI  
Sbjct: 600 SQEYILTINAIEYDLAYERAMQYVCGDSIICDTLDIARDLKWNRGVRSKLVSLDGSLIHK 659

Query: 818 SGTISGGGNHVSK 830
           +G ++GG +  SK
Sbjct: 660 AGLMTGGISKDSK 672

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  137 bits (345), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 67/161 (41%), Positives = 102/161 (63%), Gaps = 10/161 (6%)

Query: 1259 LKKKRFDEFMTGFNIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1309
            +KK+R + F   F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1370 KER-TKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTV 1409
            +     N QFIVISL+N MFE +  LVG+Y++     S  V
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1214

 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 110/214 (51%), Gaps = 28/214 (13%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   +G   ++F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLL--GLELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRS 59

Query: 212 DRLSDLIHK---------SEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKA 262
             L DLI++         S+   ++ + S A    YV       +  ++E   + + R  
Sbjct: 60  SILRDLIYRGVITGEDSESDEDGSVNNPSTA----YV------KAFYEKENKTIELMRTI 109

Query: 263 FKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDG 322
            +N  + Y I GK  SY + +  L++E I +  K FL+ QG+VE IA   P         
Sbjct: 110 SRNGDTNYKIGGKVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSPM-------D 162

Query: 323 LLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLE 356
           L    E++ G+  YK   ++   ++E L++   E
Sbjct: 163 LSRLFEEVSGSIQYKKEYDQLKEKMEQLSKAATE 196

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 68/127 (53%), Gaps = 6/127 (4%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRL-RQFNLQPISTPE 759
           + +A+ST   R  D V+VD    AQ+CI YL+K + G A FI L+ +  +     +S  +
Sbjct: 542 YSLAVSTCLGRNFDSVIVDNASVAQECIAYLKKQRAGSASFIPLETIDSEIPTLSVSNSQ 601

Query: 760 NVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAY--GRKRFRVVTIDGKLIDI 817
                 + ++  DP++  A   V  DT++  +L  A  + +  G K  ++VT++G LI  
Sbjct: 602 GCILAINAIEY-DPRYERAMQYVCSDTIICDTLVIAKRLKWVEGVKA-KLVTLEGALIHK 659

Query: 818 SGTISGG 824
           +G ++GG
Sbjct: 660 AGLMTGG 666

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  136 bits (343), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 111/171 (64%), Gaps = 14/171 (8%)

Query: 1259 LKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1309
            +KKKR + F   F  ++  +  +Y+ +T          GGNA L L D  +P++ GV + 
Sbjct: 1052 IKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGGVKYH 1111

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +A YI
Sbjct: 1112 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERIATYI 1171

Query: 1370 KERTKNA--QFIVISLRNNMFELAQQLVGIYK--RDNRTRSTTVKNIDILN 1416
             +R  N   QFIVISL+N+MFE ++ LVGIY+  ++N +R  T+   + +N
Sbjct: 1172 -QRHGNPELQFIVISLKNSMFEKSEALVGIYRHQKENSSRIITLNLTNYVN 1221

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 84/170 (49%), Gaps = 29/170 (17%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G +++ +R 
Sbjct: 2   GRLL--GLELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRS 59

Query: 212 DRLSDLIHKS------------EAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVIT 259
           + L DLI++             +  PN          E V  E               + 
Sbjct: 60  NVLKDLIYRGFLSGDDEDNNNEDVNPNSAYVKAFYQKEDVTHE---------------LM 104

Query: 260 RKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIA 309
           R    +  S Y IN K  SY + T  L++E I +  K FL+ QG+VE IA
Sbjct: 105 RSISNSGDSTYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

 Score = 62.4 bits (150), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 76/144 (52%), Gaps = 11/144 (7%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLR-QFNLQPISTPE 759
           + +A+ST   +  D ++ D +  AQ+CI YL+K + G A FI L+ +  +    P S  +
Sbjct: 540 YALAVSTILGKNFDSIITDNISVAQECIAYLKKQRAGVASFIPLESIESEVPTLPFSDGQ 599

Query: 760 NVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTIDGKLIDIS 818
                 + ++  +P++  A   V  D+++  +L  A ++ +    + ++VT++G LI  +
Sbjct: 600 GCILTINAIE-YEPEYERAMQYVCSDSIICDTLTIAKDLKWKHNVKSKLVTLEGALIHKA 658

Query: 819 GTISGGGNHVSKGLMRLGTNQSNK 842
           G ++G       G++R  TN+ +K
Sbjct: 659 GLMTG-------GILRDATNRWDK 675

 Score = 33.9 bits (76), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 51/83 (61%), Gaps = 7/83 (8%)

Query: 473 LEERTKNLANKIE-KSERTSKCTKR------SISEAEHTLKELHTQQTEHESEIKDLNQL 525
           L+ +  N+ NK++ + ER +   KR       + + + +L  L T+++E +++I++++  
Sbjct: 817 LQRQILNIENKLQFEQERLASTEKRFEKGQSELQKTKISLDSLETEESELQTQIEEIDNE 876

Query: 526 LEEERSVLDEIKLSLKDKTKDIS 548
           LE +R+ +DE++ +L  K KDIS
Sbjct: 877 LETQRTEIDEMQKALDSKLKDIS 899

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  135 bits (340), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 110/172 (63%), Gaps = 10/172 (5%)

Query: 1248 KRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDS 1298
            K  +++ Q   +K+ R + F   +N +S  + ++Y+ +T          GG+A L L D 
Sbjct: 1048 KEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDE 1107

Query: 1299 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358
             +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD
Sbjct: 1108 DEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALD 1167

Query: 1359 FRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTV 1409
              NV  +A YIK   + N QFIVISL+N+MFE +Q LVG++++     S  +
Sbjct: 1168 NTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVI 1219

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 96/195 (49%), Gaps = 22/195 (11%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG    +F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLL--GLELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRS 59

Query: 212 DRLSDLIHKSEAFPNLQSCSVAVHFE---------YVIDESSGTSRIDEEKPGLVITRKA 262
             L DL+++     + +                  YV    +   +  EE P +   R  
Sbjct: 60  HLLMDLVYRGRRTGDEEESMEEEPSSSKISSTRSAYV---KAFYLKEGEESP-IEFMRTI 115

Query: 263 FKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDG 322
            ++  S Y +NGK   Y + T +L+ E I +  + FL+ QG+VE IA        +S   
Sbjct: 116 SRSGESAYKVNGKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIAS-------QSAGE 168

Query: 323 LLEYLEDIIGTANYK 337
           L +  E I G+  YK
Sbjct: 169 LTKLFEQISGSVQYK 183

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  133 bits (335), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 107/169 (63%), Gaps = 14/169 (8%)

Query: 1259 LKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1309
            +K KR + F   F  +   + ++Y+ +T          GGNA L + +  +P+  G+ + 
Sbjct: 1073 VKAKRKELFEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYF 1132

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YI
Sbjct: 1133 ATPPLKRFKDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYI 1192

Query: 1370 KERTK-NAQFIVISLRNNMFELAQQLVGIYK--RDNRTR--STTVKNID 1413
            K     NAQFIVISL+N MFE +Q LVGI++   DN +R  S  ++N D
Sbjct: 1193 KRNANPNAQFIVISLKNAMFEKSQSLVGIFREQEDNSSRMVSLNLENYD 1241

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/209 (33%), Positives = 101/209 (48%), Gaps = 36/209 (17%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY     VG   + F++++GPNGSGKSN++D++ FV G R+N++R 
Sbjct: 2   GRLI--GLELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRS 59

Query: 212 DRLSDLIHK----------------------SEAFP-NLQSCSVAVHFEYVIDESSGTSR 248
             L DLI++                      SEA P N           YV   S    +
Sbjct: 60  SALVDLIYRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYV---SCVYQK 116

Query: 249 IDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENI 308
            D ++P    TR    +  S Y IN +  SY +  + L++E I +  K FL+ QG+VE I
Sbjct: 117 DDLDEPT-KFTRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERI 175

Query: 309 AQMKPKAEKESDDGLLEYLEDIIGTANYK 337
           A   P++       L   LE + G+ NYK
Sbjct: 176 ASQGPES-------LTLLLEQVSGSINYK 197

 Score = 69.7 bits (169), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 103/203 (50%), Gaps = 18/203 (8%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTP-E 759
           + +A+ST   +  D ++VD++  A +CI YL+K + G A FI LD +   ++ P S P  
Sbjct: 562 YAIAVSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLDTI---DVNPPSLPVS 618

Query: 760 NVPRLFDLVKP--KDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTIDGKLID 816
           NV      +     +     A   V  D+++  +L  A  + + R  + ++VT++G LI 
Sbjct: 619 NVQGCLLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIH 678

Query: 817 ISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEV--NKIEHELSERENNFRVANDTVHE 874
            +G ++GG    ++       N+ NK D+Y    V  ++I  EL+   + FR  N    E
Sbjct: 679 KAGQMTGGTAQKNQ-------NRWNK-DEYQGLMVLKDQITEELTALSDKFRADNMKSRE 730

Query: 875 MEAELKNLRDQEPAIESKISKTE 897
           +E E+  L ++  ++ ++I++ E
Sbjct: 731 LENEISLLNNEISSLRTQITQLE 753

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  132 bits (331), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 109/163 (66%), Gaps = 12/163 (7%)

Query: 1259 LKKKRFDEFMTGFNIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFS 1309
            +KKKR + F + F+ ++  ++ +Y+ +T          GG A L L D  +PF+ GV + 
Sbjct: 1063 IKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLEDEDEPFNGGVKYH 1122

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI
Sbjct: 1123 ATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDHTNVERIAAYI 1182

Query: 1370 -KERTKNAQFIVISLRNNMFELAQQLVGIYKR--DNRTRSTTV 1409
             K   K+ QFI+ISL+N MFE +  LVG++++  +N +++ T+
Sbjct: 1183 RKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKALTL 1225

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 68/138 (49%), Gaps = 17/138 (12%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTP-- 758
           + +AI T   +  + V+VD++  AQ+CI YL+K + G   FI LD +     Q  S P  
Sbjct: 538 YALAILTILGKNFNSVIVDSLSVAQECISYLKKQRAGIISFIPLDTIEA---QIPSLPTI 594

Query: 759 -ENVPR--------LFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGR--KRFRV 807
            +N P+        L       +P+F  A   +  ++++  +L  A ++ + +  K  + 
Sbjct: 595 IQNNPKYNNDSNCILTINAIEYEPEFERAMQYICSNSIICDNLDIAKDLKWNQNVKNVKF 654

Query: 808 VTIDGKLIDISGTISGGG 825
           VT+DG +I  S  ++GG 
Sbjct: 655 VTLDGSIIHKSNLMTGGA 672

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  130 bits (326), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 103/165 (62%), Gaps = 12/165 (7%)

Query: 1248 KRDE--VKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELV 1296
            K+DE  V  Q   +K+KR   F   F  ++  +  +Y+ +T          GG+A L L 
Sbjct: 1040 KKDEKKVLAQFIKIKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLE 1099

Query: 1297 DSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1356
            D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAA
Sbjct: 1100 DEDEPFNAGIRYHATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAA 1159

Query: 1357 LDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGIYKR 1400
            LD  NV  VA YI+     + QFIVISL+N MFE +  LVG+Y++
Sbjct: 1160 LDTTNVERVATYIRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQ 1204

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 97/197 (49%), Gaps = 33/197 (16%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ FV G R+  +R 
Sbjct: 2   GRLL--GLELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRS 59

Query: 212 DRLSDLIHK-----------SEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITR 260
           + L DLI++           S+   N  +  V   +      S G S I+       ++R
Sbjct: 60  NVLKDLIYRGVASEEEGDGESDVVNNPTTAYVKAFY------SKGDSTIE-------LSR 106

Query: 261 KAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESD 320
              K   + Y +NGK   Y      L++E I +  K FL+ QG+V  IA        +S 
Sbjct: 107 SISKGGDTTYRMNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIAS-------QSA 159

Query: 321 DGLLEYLEDIIGTANYK 337
             L ++ E+  G+  YK
Sbjct: 160 MELTQFFEEFSGSIQYK 176

 Score = 72.4 bits (176), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 133/274 (48%), Gaps = 21/274 (7%)

Query: 687 GFHGRLGDLGIIDNS-FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILL 744
           G  G + DL       + +A+ST   R  D ++VD +  AQ+CI YL+K + G A FI L
Sbjct: 525 GIRGLVSDLCQPKKERYALAVSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPL 584

Query: 745 DRLR-QFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK 803
           D +  + +  P S         + ++  DP++  A   V  D+++  +L+ A ++ + R 
Sbjct: 585 DTIEVETSTLPASESSGCILAINAIEY-DPEYERAMRYVCSDSIICNTLEIARDMKWKRN 643

Query: 804 -RFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEV----NKIEHEL 858
            R ++VT++G LI  +G ++GG          +  + SN+ D    + +    +KI  ++
Sbjct: 644 VRSKLVTLEGTLIHRAGLMTGG----------ISKDSSNRWDKEEYQSLMTLKDKILVQI 693

Query: 859 SERENNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEAR 918
            E  ++ R  +    E+E  +  +  +  +I ++IS+ +   +   +++   +  +K+  
Sbjct: 694 EEVGSHSRACSIRARELEGNISLIYSEASSIRTQISQLKRALEDTNTDIEYHQNLIKQEY 753

Query: 919 IAYHNALSDKAQVNMIMKNLERLKGEHDDLQSET 952
                 L  K  + +I  + ++L+ E D LQ++T
Sbjct: 754 DPKIQELEQK--LAIINDSRKQLEEEKDSLQTQT 785

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  129 bits (324), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 109/192 (56%), Gaps = 24/192 (12%)

Query: 1242 LNQAVQKRDEVKGQVEVLK---KKRFDEFM-----------TGFNIISMTLKEMYQMITM 1287
             + A  + DEV  + E LK   +K FDEF+             F  I+  L  +Y  +T 
Sbjct: 1023 FDDAKSRFDEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAFEKINEHLDAIYSELTR 1082

Query: 1288 ---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFA 1338
                     GG+A + + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA
Sbjct: 1083 NVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTVAALALLFA 1142

Query: 1339 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQQLVGI 1397
            ++ Y P+P +++DE+DAALD  NV  +A YI+     + QFIVISL+N MFE +  LVG+
Sbjct: 1143 INSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGV 1202

Query: 1398 YKRDNRTRSTTV 1409
            +++     S  V
Sbjct: 1203 FRQQQENSSKIV 1214

 Score = 85.1 bits (209), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 109/220 (49%), Gaps = 40/220 (18%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   V    ++F++++GPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLV--GLELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRS 59

Query: 212 DRLSDLIHKS----EAFPNL--------QSCSVAVHFEY---VIDESSGTSRIDEEKPGL 256
             L DLI++     E  P          ++  V   +EY   V++     SR+ +     
Sbjct: 60  SALKDLIYRDIISRENTPTGADNDENGNRTAYVKAFYEYDGKVVELMRLISRLGD----- 114

Query: 257 VITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAE 316
                      + Y ++G   +Y E ++ L+++ I +  K FL+ QG+VE IA   P   
Sbjct: 115 -----------TSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-- 161

Query: 317 KESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLE 356
                GL + +E++ G+  YK   EE  +Q + + +   E
Sbjct: 162 -----GLTKLIEEVSGSMQYKKEYEELKDQYDKICQASTE 196

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 83/352 (23%), Positives = 164/352 (46%), Gaps = 53/352 (15%)

Query: 700  NSFDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQ-PIST 757
            + + +A+ST   +  D V+VD++  AQ+CI +L+K + G   FI LD +     + P+  
Sbjct: 540  DKYKLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLDTIDAATPRMPVPE 599

Query: 758  PENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTIDGKLID 816
             E      + V+ KD     A Y V  DT++  +L  A ++ + +    ++VT+DG LI+
Sbjct: 600  SETYTLAINTVEYKDD-LVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALIN 658

Query: 817  ISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEV----NKIEHELSERENNFRVANDTV 872
             +G ++GG          + ++ +N+ D    + +    +K+  ++ E  N  R +    
Sbjct: 659  KTGLMTGG----------ITSDSANRWDKDEYQSLLDLKDKLIVDVEEAANKSRQSTLIA 708

Query: 873  HEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVN 932
             E+E  L +L  +   I ++I++T+   +   +E            I +HN L D+  + 
Sbjct: 709  RELEISLSSLTSEISYIRTQITQTKRAVEETETE------------INHHNNLIDREFIP 756

Query: 933  MIMKNLE-RLKGEHDDLQSETKTKKEKI--KVLQGEIMKIGGTKLQMQNSKVGSLCQRLD 989
             + K+LE ++ G  D+++ +  TK+E +  K       K+G T ++   S  G + ++  
Sbjct: 757  QV-KDLENKISGLEDEIR-DWNTKREALQEKCFARLTEKVGFT-MKDYESHTGEMIRK-- 811

Query: 990  ILVAXXXXXXXXXXXSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTK 1041
                            E  +L  QKQ+ N E  VE  +    A +++L++ +
Sbjct: 812  -------------QTKELQIL--QKQILNLENKVEFETGRCNATKDRLQNVQ 848

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  128 bits (322), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 101/168 (60%), Gaps = 10/168 (5%)

Query: 1252 VKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPF 1302
            V  Q   +KKKR   F   F   S  +  +Y+ +T          GG+A L L D  +PF
Sbjct: 1041 VIAQFLKIKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPF 1100

Query: 1303 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362
            + G+ +   PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV
Sbjct: 1101 NAGIRYHATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNV 1160

Query: 1363 SIVANYI-KERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTV 1409
              +A YI +   ++ QFIVISL+N MFE +  LVG+Y++     S  V
Sbjct: 1161 DRIAAYISRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIV 1208

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 108/209 (51%), Gaps = 24/209 (11%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L L NFKSY G   VG   ++F +++GPNGSGKSN++D++ FV G +++ +R 
Sbjct: 2   GRLV--GLELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRS 59

Query: 212 DRLSDLIHKS----EAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNS 267
             L DLI++     E   + +  +  V   Y+  +S+           + ++R   +N  
Sbjct: 60  QILKDLIYRGVEGEEDEEDGEGRTAYVKAFYLKSDST-----------VELSRSISRNGD 108

Query: 268 SKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 327
           ++Y +NGK   Y +  + L+ E I +  + FL+ QG+V  IA        +S   L +  
Sbjct: 109 TQYKMNGKNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIAS-------QSATDLTKLF 161

Query: 328 EDIIGTANYKPLIEEQMNQIEALNEVCLE 356
           E+I G+  YK   +    ++++LN+   E
Sbjct: 162 EEISGSIQYKKEYDSLKGKVDSLNQSAAE 190

 Score = 66.2 bits (160), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 133/287 (46%), Gaps = 31/287 (10%)

Query: 687 GFHGRLGDLGIID-NSFDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILL 744
           G  G + DL     + + +AIST   +  D V+VD V  AQ+CI YL+K + G A FI L
Sbjct: 520 GVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVDNVMVAQECIAYLKKQRAGIASFIPL 579

Query: 745 DRLR-QFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK 803
           D +  +     +S  +      + +   + ++  A   V  D+++   +  A ++ + + 
Sbjct: 580 DTIDVEIPTLTLSDSQGCTLAINAI-DYEQEYERALQYVCSDSIICDDMNIAKDLKWNKG 638

Query: 804 -RFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERE 862
            R ++VT++G LI  +G ++GG          +  N SN+ D    + +  ++ +L ++ 
Sbjct: 639 VRSKLVTLEGALIHKAGLMTGG----------ISKNTSNRWDKEEYQSLMTLKDKLLQQ- 687

Query: 863 NNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIA-- 920
                    V E   E KN       +ES +S    E   + ++LTL ++ +KE  +   
Sbjct: 688 ---------VEEAALEGKNASLMARELESTLSLLNTEISELRTQLTLTQRTLKENTVERD 738

Query: 921 YHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIKVLQGEIM 967
           YH  L  +     ++   ER++  +  LQ E  ++KEK   LQ EI 
Sbjct: 739 YHEKLIKEEYEPELLNLEERIQNFNFALQ-ELDSQKEK---LQNEIF 781

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  128 bits (322), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 61/166 (36%), Positives = 105/166 (63%), Gaps = 11/166 (6%)

Query: 1259 LKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1309
            +K+KR   F++ F  ++  +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYH 1110

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1370 KER-TKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDI 1414
            K   +   QFIVISL++N+F  +Q + G++ R+ +  S+ V   D+
Sbjct: 1171 KRHASPKFQFIVISLKSNLFGKSQSMAGVF-RNQQANSSMVITTDL 1215

 Score = 91.7 bits (226), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 92/188 (48%), Gaps = 26/188 (13%)

Query: 159 LVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NFKSY G   VG  +  F ++VGPNGSGKSN++D++ FV G R+N +R + L DLI
Sbjct: 7   LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 219 HKSE---------AFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSK 269
           ++           A P     S  V   Y+ D++       E+   +   R       S 
Sbjct: 67  YRGRMDDRSDEHVASPK----SAYVKAFYLKDDNG------EQGTKIEFMRIIQNTGDSV 116

Query: 270 YYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y I+GK  S+    + L+ E I +  + FL+ QG+VE IA        +S   L +  E 
Sbjct: 117 YRIDGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQ 169

Query: 330 IIGTANYK 337
           + G+  Y+
Sbjct: 170 VSGSVQYQ 177

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 76/151 (50%), Gaps = 24/151 (15%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTP-- 758
           + +A+S+   +  D +VVD+V  AQQCI YL+K++ G A FI LD +       I+TP  
Sbjct: 540 YALAVSSMLGKNFDSIVVDSVSVAQQCISYLKKHRSGAASFIPLDTI------DINTPTL 593

Query: 759 --ENVPRLFDLVKP--KDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTIDGK 813
              N+      V     D +   A   V  D+++  +L  A N+ + R  + ++VTI G 
Sbjct: 594 PVRNLKGCILTVNAIEYDSELEKAMQYVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGA 653

Query: 814 LIDISGTISGGGNHVSKGLMRLGTNQSNKID 844
           LI  +G ++GG          +G N +N+ D
Sbjct: 654 LIHRAGLMTGG----------VGRNNTNRWD 674

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  127 bits (320), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 101/161 (62%), Gaps = 10/161 (6%)

Query: 1259 LKKKRFDEFMTGFNIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFS 1309
            +K+KR + F+  FN +   +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYH 1110

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1370 KER-TKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTV 1409
            +   +   QFIVISL++N+F  ++ + G+++  +   S  +
Sbjct: 1171 RRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVI 1211

 Score = 98.2 bits (243), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 96/192 (50%), Gaps = 22/192 (11%)

Query: 152 GRLFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 211
           GRL    L ++NFKSY G   VG    +F ++VGPNGSGKSN++D++ FV G R++ +R 
Sbjct: 2   GRLI--GLEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRS 59

Query: 212 DRLSDLIHK------SEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKN 265
             L DLI++        A  N    +    F YV  ++SG  R  E       TR     
Sbjct: 60  SALVDLIYRGRMEEGGSAHENNPKSAYVTAF-YVKQDASGAERRME------FTRVIHNT 112

Query: 266 NSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLE 325
             S Y ++GK   Y E   +L+ E I +  + FL+ QG+VE IA        +S   L +
Sbjct: 113 GDSTYKLDGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS-------QSGVDLTK 165

Query: 326 YLEDIIGTANYK 337
             E + G+  Y+
Sbjct: 166 LFEQVSGSVQYQ 177

 Score = 72.0 bits (175), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 119/259 (45%), Gaps = 37/259 (14%)

Query: 702 FDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPEN 760
           + V +ST   +  D V+VD++  AQQCI YL+K++ G A FI LD +   +   +   +N
Sbjct: 540 YAVGVSTILGKNFDSVIVDSLSVAQQCISYLKKHRSGVASFIPLDTI-DTSSPTLPAGDN 598

Query: 761 VPRLFDL-VKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTIDGKLIDIS 818
              +  L     +     A   V  D+++  SL  A N+ + R  + ++VT++G LI  +
Sbjct: 599 TGCILTLDAIEYESSLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGALIHRA 658

Query: 819 GTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEV----NKIEHELSERENNFRVANDTVHE 874
           G ++GG          +  N +N+ D    + +    +KI  ELSE     R  +    +
Sbjct: 659 GLMTGG----------ITKNNTNRWDKEEYQSLLLLKDKISTELSELTTGIRTGSIKSRD 708

Query: 875 MEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEA--RIAYHNALSDK---A 929
            E E              +S    E  S+ S+L    + +KEA   + YH+ L +K    
Sbjct: 709 YENE--------------VSLLSTEISSLRSQLNQLNRSMKEALTELNYHDDLIEKEYSP 754

Query: 930 QVNMIMKNLERLKGEHDDL 948
           +V+ + K +E + G+  D+
Sbjct: 755 KVDSLHKMVEEVDGQMADI 773

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  112 bits (281), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 109/392 (27%), Positives = 193/392 (49%), Gaps = 51/392 (13%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F+   D+SS      E  P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNT-DKSSSPIGF-ESYPKISVTRQIILGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTR 172

Query: 335 NYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSK 394
            ++       ++ E   +   +KE + + +   +  LE   E  LE L  +K+  L    
Sbjct: 173 MFE-------DRREKAEKTMAKKETKLQEI---RTLLEEEIEPKLEKLRNQKRAFL---- 218

Query: 395 LFQFKVLQSNSKLASTLEKISSLN-KDFETEKVKFQESLK----KVEEVKTQRKEIKDRI 449
             +F+  Q++  L  TL  +++    D  T+    +E+L+    +VEE+    ++ K+ I
Sbjct: 219 --EFQETQTD--LEKTLRILNAYEYYDMATKNSTIKETLQNSTARVEELNNFIQKTKNEI 274

Query: 450 SSNDSREKDLVLERREL---EGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLK 506
           S+ D   K + ++++E    +G    LE++  +LAN+I + +     +  +I+E  + LK
Sbjct: 275 SNLDEDLKTIKIQKQEQVQKDGKLSQLEKQENDLANEISRLKTALGISVENINEESYKLK 334

Query: 507 ELHTQ--------------QTEHESEIKDLNQ 524
           +LH                 T  ESE  DLN+
Sbjct: 335 KLHENVQKFERDLSEKSVIYTSTESEFNDLNE 366

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 99/232 (42%), Gaps = 50/232 (21%)

Query: 701 SFDVAIS---TACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRL--RQFN---- 751
           +FD A +    A  RL +VVVD    A Q ++  R  K      I L+++  R  N    
Sbjct: 537 NFDSATALQVCAGGRLFNVVVDNEVTASQLLERGRLRK--RVTIIPLNKIASRTLNENAL 594

Query: 752 -LQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVT 809
            L     P NV    +L+  +D + S A   +   +L+ +  + A  V +  + R R +T
Sbjct: 595 KLAKSVAPGNVELALNLIGYED-EVSRAMEFIFGTSLICKDAETAKRVTFHPQIRARSIT 653

Query: 810 IDGKLIDISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVAN 869
           +DG + D  GT+SGG  +    L+         ID  T                 F  A+
Sbjct: 654 LDGDIYDPEGTLSGGSRNTKNSLL---------IDIQT-----------------FNAAS 687

Query: 870 DTVHEMEAELKNLRDQEPAIESKIS---KTEMEADSITSELTLAEQQVKEAR 918
             ++EME ELK        I SKI+   +T  +  S+ +EL LA  ++  A+
Sbjct: 688 KRLNEMELELKQ-------INSKIAEYEQTSQKTKSLQNELNLATHKLSLAK 732

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score =  111 bits (278), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 115/397 (28%), Positives = 195/397 (49%), Gaps = 53/397 (13%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  A   +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV V F+     +S     +  K  + +TR+     SSKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTVVFDNSDKSNSPIGFTNSAK--ISVTRQVMLGGSSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKPK        +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAGT- 171

Query: 335 NYKPLIEEQMNQIE---ALNEVCLEKENR---FEIVDREKNSLESGKETALEFLAKEKQL 388
               + E++ ++ E   A  E  LE ENR    E ++ +   L S KE  ++F   + +L
Sbjct: 172 ---KMFEDRKDKAERTMAKKEAKLE-ENRALLVEEIEPKLGKLRSEKEIFIKFQETQSEL 227

Query: 389 TLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDR 448
              +  ++ F      +K +S  + ++S N              K+ E++K       D 
Sbjct: 228 EKTERVVYAFDYHNMINKSSSLKQHLNSSN--------------KRSEQLKELISRTSDE 273

Query: 449 ISS-NDSREKDLVLERREL--EGTRVSLEERTKNLANKIEK-------SERTSKCTKRSI 498
           ISS N+  E+    +++E+  +GT  +LEER   L N+I +        +  S  TK+ +
Sbjct: 274 ISSLNEDLEETKRNKQKEIDEQGTLANLEEREGQLLNEISRIQTQLGICKDNSDDTKQKL 333

Query: 499 SEAEHTLKE----LHTQQTEH---ESEIKDLNQLLEE 528
           S+A+  +K+    L T+   +   E E + LN  LE+
Sbjct: 334 SDAKEYIKKCSASLETKSVSYKKTEEEYQKLNDALEQ 370

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1303 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1363 SIVANYIKERTKNAQFIVISLRNNMF 1388
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 84/329 (25%), Positives = 146/329 (44%), Gaps = 63/329 (19%)

Query: 685 INGFHGRLGDLGIIDNSFDVAIS---TACPRLDDVVVDTVECAQQCIDYLRKNKLGYARF 741
           + G   +L  L   ++++D A +    A  RL +VVVD    A Q ++  R  K      
Sbjct: 523 VKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK--RVTI 578

Query: 742 ILLDRL--RQFNLQPI-----STPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQ 794
           I L+R+  R  N Q +     + P  V    +LV  ++ + S A   +  ++L+ +  + 
Sbjct: 579 IPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYEE-EVSRAMEFIFGNSLICKDAET 637

Query: 795 ANNVAYGRK-RFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEVNK 853
           A  + +  + R R +T+ G + D  GT+SGG  + +  L+         ID    ++ NK
Sbjct: 638 AKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRNNTSSLL---------ID---VQKYNK 685

Query: 854 IEHELSERENNFRVANDTVHEMEAELKNL-RDQEPAIESKISKTEMEADSITSELTLAEQ 912
                             + E+E +LK++ RD E   ESK+ KT     S+ ++L LA  
Sbjct: 686 TAKR--------------IEELELKLKSITRDLEEQ-ESKLQKTR----SVRNDLNLATH 726

Query: 913 QVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIKVLQGEIMKI--- 969
           ++  A+     +L      ++I KN E +K E D+ Q E  +K+  I   + EI +I   
Sbjct: 727 KLTLAQ----RSLESNQAAHIIRKNEELIK-EIDESQKEIASKRSSISDCEKEIQRIQTD 781

Query: 970 -------GGTKLQMQNSKVGSLCQRLDIL 991
                   G+KL+    +V  L + + IL
Sbjct: 782 IQEFSTDKGSKLKQLKDEVSKLFKEIGIL 810

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score =  108 bits (271), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 106/390 (27%), Positives = 190/390 (48%), Gaps = 29/390 (7%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   +
Sbjct: 3   VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F+     +S     D  K  + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNSDKSNSPIGFNDSLK--ISVTRQIVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  M+P         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEEAAGTK 172

Query: 335 NYKPLIEEQMNQIEALNEVCLEKENR---FEIVDREKNSLESGKETALEFLAKEKQLTLL 391
            ++    E+  +  +  E  LE ENR    E ++ + N L   K   LEF   +  L  +
Sbjct: 173 MFEDR-REKAERTMSKKETKLE-ENRTLLAEEIEPKLNKLRGEKRIFLEFQVTQTDLEKI 230

Query: 392 KSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQE------SLKK-VEEVKTQRKE 444
              +  F     +++  S  +K+SS  +  E  K    +      SLK+ +E++KTQ+K+
Sbjct: 231 SRVVTAFDYHNMSTRRDSARDKVSSNERRMEELKTLISKTTDEIISLKEDLEQIKTQKKD 290

Query: 445 IKDR---ISSNDSREKDLVLERRELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEA 501
             D+   +   + +E D + +   +  T+    +  +    KI+K + T +   R + E 
Sbjct: 291 ELDKNGVLPKLEKQEGDFLNQISRINATKQICSQNLEENKKKIQKLQNTLESLSRELQEK 350

Query: 502 EHTLKELHTQQTEHESEIKDLNQLLEEERS 531
               +E+ T   + ES    LNQL EE +S
Sbjct: 351 LDRYREIETAYKQDES---TLNQLKEEHKS 377

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 121/270 (44%), Gaps = 46/270 (17%)

Query: 708 TACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQ-------FNLQPISTPEN 760
            A  RL +VVVD    A Q ++  R  K   A  I L+++          N+     P  
Sbjct: 547 CAGGRLFNVVVDNENTAAQLLERGRLRK--RATIIPLNKIAARTLNDNIVNMAKSVAPGR 604

Query: 761 VPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTIDGKLIDISG 819
           V    +L+  ++ +   A   +   +LV +  + A  V +  K R R +T+DG + D  G
Sbjct: 605 VELALNLIGYEE-EVRRAMEFIFGSSLVCKDAEAAKMVTFNPKIRTRSITLDGDVYDPEG 663

Query: 820 TISGGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAEL 879
           T+SGG  + +  L+         ID               +R NN     + V E+E +L
Sbjct: 664 TLSGGSRNNTSSLL---------ID--------------IQRYNN---NCNLVKELETKL 697

Query: 880 KNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLE 939
            ++  ++ AI+ +IS    +  ++  EL LA+ ++K   ++  N  S+ A   +I KN E
Sbjct: 698 NDIA-KKIAIQFEISN---KTKNLQKELELAQHKLK---LSERNLQSNTA-AQLIRKN-E 748

Query: 940 RLKGEHDDLQSETKTKKEKIKVLQGEIMKI 969
            L+ E    + E K K  +IK L+ +I KI
Sbjct: 749 ELESEIAQCKEEIKDKTSQIKQLKKQIAKI 778

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 110/222 (49%), Gaps = 40/222 (18%)

Query: 350 LNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLAS 409
           LN++  +   +FEI ++ KN            L KE +L   K KL + + LQSN     
Sbjct: 697 LNDIAKKIAIQFEISNKTKN------------LQKELELAQHKLKLSE-RNLQSN----- 738

Query: 410 TLEKISSLNKDFETEKVKFQESLK-KVEEVKTQRKEIK------DRISSNDSREKDLVLE 462
           T  ++   N++ E+E  + +E +K K  ++K  +K+I       D  S +   + D +  
Sbjct: 739 TAAQLIRKNEELESEIAQCKEEIKDKTSQIKQLKKQIAKIEKDADEFSHDKGSKLDEL-- 796

Query: 463 RRELEGTRVSLEER----------TKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQ 512
           RRE+E   V + E            +N   +IE+       +K ++ +AE T+K+L T+ 
Sbjct: 797 RREVESMSVQISEEEQRCETQYDAYQNFQLEIEQLGGDIDSSKDTLEQAELTVKKLQTEV 856

Query: 513 TEHESEIKDLNQLLEEERSVLDEIK---LSLKDKTKDISTEI 551
           +EH+  ++DLNQ L++++  L+E +   + + D+ K+I   I
Sbjct: 857 SEHDMNLRDLNQALQDKQVELEEERNRLMGIDDELKEIEALI 898

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score =  108 bits (270), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 102/373 (27%), Positives = 187/373 (50%), Gaps = 37/373 (9%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV V F+    ++S     +   P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTVVFDNSDRDNSPIGFTN--SPKISVTRQVVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 335 NYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSK 394
            ++    E+  +  A  E  L+ ENR  + +          E  LE L  EK++ L    
Sbjct: 173 MFEDR-REKAERTMAKKETKLQ-ENRALLAEE--------IEPKLEKLRSEKRIFL---- 218

Query: 395 LFQFKVLQSNSKLASTLEKISSLN-KDFETEKVKFQESLK----KVEEVKTQRKEIKDRI 449
              F+  Q++  L  T   +S+ N  + +  +  F+++L+    K   +K + +++ + I
Sbjct: 219 --DFQTTQTD--LERTSRVVSAFNYYNMKHRQSSFEQTLQDSEDKCNHLKEEIEKVSEEI 274

Query: 450 SSNDSREKDLVLERR---ELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLK 506
            S +   ++L L+++   + EG  V+ E+   +L  +I + + T      SI EAE  L+
Sbjct: 275 KSLNEDLEELKLQKKNEMDNEGRLVNFEKEESDLLKQISRIKTTLSIKNDSIDEAEKELQ 334

Query: 507 ELHTQQTEHESEI 519
           +L++   E   E+
Sbjct: 335 KLNSNNEELTKEL 347

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score =  104 bits (260), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 98/182 (53%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F+    + S T     E P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNT--DKSNTPIGFSEYPKISVTRQIVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  I  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  104 bits (260), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 98/182 (53%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           I EL+++ FKSYA R V+  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F  +  + S      E  P L +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFSNLDPKCSPIGF--ENSPKLSVTRQIILGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 18/139 (12%)

Query: 699 DNSFDVAIS---TACPRLDDVVVDTVECAQQCIDY--LRK-------NKLGYARFILLDR 746
           +N++D A++    A  RL +V+VD    A Q ++   LRK       NK+   R I  + 
Sbjct: 535 ENNYDSALALQVCAGGRLFNVIVDDQNTASQLLERGKLRKRVTIIPLNKIA-TRVINSES 593

Query: 747 LRQFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RF 805
           L+   L     P  V    +LV  ++ + S A   +  ++LV    + A  + +  + R 
Sbjct: 594 LK---LAKQLAPGKVQLALNLVGYEE-EVSKAMEYIFGNSLVCNDAETAKRLTFHPQIRT 649

Query: 806 RVVTIDGKLIDISGTISGG 824
           R +T  G + D  GT+SGG
Sbjct: 650 RSITQQGDVYDPEGTLSGG 668

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  104 bits (260), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 96/181 (53%), Gaps = 15/181 (8%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRI--DEEKPGLVITRKAFKNNSSKYYI 272
            DLI+K       Q+  +      V D S  +S     E  P + +TR+     +SKY I
Sbjct: 63  QDLIYKRG-----QAGVIKASVTIVFDNSDPSSSPFGFETYPKISVTRQIILGGTSKYLI 117

Query: 273 NGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           NG  +    V  L ++  +++++  FLI+QG++  +  MKP       D +L  +E+  G
Sbjct: 118 NGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEAAG 170

Query: 333 T 333
           T
Sbjct: 171 T 171

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 89/190 (46%), Gaps = 20/190 (10%)

Query: 701 SFDVAIS---TACPRLDDVVVDTVECAQQCIDY--LRK-------NKLGYARFILLDRLR 748
           +FD A +    A  RL +V+VD  + A Q ++   LRK       NK+  AR I  D L 
Sbjct: 537 NFDSANALQVCAGGRLFNVIVDNEKTASQLLERGRLRKRVTIIPLNKIS-ARVINTDAL- 594

Query: 749 QFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRV 807
             N      P  V    +L+   + + + A   +   +L+ R    A  V +  + R R 
Sbjct: 595 --NKAKSLAPGAVELALNLI-GYEAEVARAMEFIFGGSLICRDAATAKKVTFHPQVRARS 651

Query: 808 VTIDGKLIDISGTISGGG-NHVSKGLMRL-GTNQSNKIDDYTPEEVNKIEHELSERENNF 865
           +T+DG + D  GT+SGG  +H S  L+ +   N++ K      +E+ +++  +SE EN  
Sbjct: 652 ITLDGDIYDPEGTLSGGSRSHTSSLLIDIQKYNEAAKQMMVLEKELYQVQANISEHENAS 711

Query: 866 RVANDTVHEM 875
           R+     +E+
Sbjct: 712 RMTKSLQNEL 721

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score =  102 bits (254), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 107/403 (26%), Positives = 191/403 (47%), Gaps = 68/403 (16%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F+     +S     +  K  + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNSDKTNSPIGFNNSSK--ISVTRQIILGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP       + +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAGTK 172

Query: 335 NYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSK 394
            ++       N+ E       +KE + +     +  LE   E  LE L  EK++ L    
Sbjct: 173 MFE-------NRREKAERTMAKKETKLQ---ESRTLLEEEIEPKLEKLRNEKRMFL---- 218

Query: 395 LFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLKKV-----EEVKTQRKEIKDRI 449
                                    +F+T +  F++++K V     + +  +   +KD +
Sbjct: 219 -------------------------EFQTTQADFEKTMKVVHAFDYKNMINRHASVKDVL 253

Query: 450 SSNDSRE---KDLVLERRELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHT-- 504
            S+++R    K L+L   E  G   SL E  + +  KI+K +   K    S  E E +  
Sbjct: 254 ESSEARMAELKGLILRTAEEIG---SLNEDLEQV--KIQKEKELDKDATLSRLEKEESEL 308

Query: 505 LKELHTQQTEHE---SEIKDLNQLLEEERSVLDEIKLSLKDKT 544
           L E+   +T H      IK+ N+ +E+ +S +++ KL+LK+K+
Sbjct: 309 LNEVSRIKTSHSICNDNIKENNKQVEKLKSDIEQFKLTLKEKS 351

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 60/134 (44%), Gaps = 14/134 (10%)

Query: 702 FDVAIS---TACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRL--RQFNLQPIS 756
           FD A +    A  RL +VVVD  + A   ++  R  K      I L+++  R  N + + 
Sbjct: 538 FDAASALQVCAGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLNKIAARTLNARTLQ 595

Query: 757 -----TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTI 810
                 P  V    +L+   D + S A   +   +LV +    A  V +  + R R +T+
Sbjct: 596 MAKDIAPGKVELALNLI-GYDDEVSRAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSITL 654

Query: 811 DGKLIDISGTISGG 824
           DG + D  GT+SGG
Sbjct: 655 DGDVYDPEGTLSGG 668

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  101 bits (252), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 97/182 (53%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F+     +S     +   P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNTDKSNSPIGFTN--SPQISVTRQVVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 75/165 (45%), Gaps = 21/165 (12%)

Query: 684 RINGFHGRLGDLGIIDNS---FDVAIST-ACPRLDDVVVDTVECAQQCIDYLRKNKLGYA 739
           + N  +G +G L  +D+    +  A+ T A  RL +VVV   + A Q ++  R  K    
Sbjct: 519 KANLVYGVVGQLFELDDDKIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK---- 574

Query: 740 RFILLDRLRQFNLQPIS----------TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVA 789
           R  ++  L + + +PIS           P  V    +L+K  D   + A   +  ++L+ 
Sbjct: 575 RVTIIP-LNKISTRPISPQVLELAKKIAPGKVELAINLIKF-DKSVTKAMEFIFGNSLIC 632

Query: 790 RSLKQANNVAYGRK-RFRVVTIDGKLIDISGTISGGGNHVSKGLM 833
              + A  + +  K R R +T+ G + D  GT+SGG  + S  L+
Sbjct: 633 EDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSDSLL 677

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score =  101 bits (252), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 97/182 (53%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F    D+ + +    E  P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFTN--DDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score =  101 bits (252), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 96/179 (53%), Gaps = 11/179 (6%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F+    +SS      E  P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVIKASVTIVFDNSDIKSSPIGF--ERYPKISVTRQIALGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
             +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEAAGT 171

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 40.0 bits (92), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 76/329 (23%), Positives = 140/329 (42%), Gaps = 69/329 (20%)

Query: 685 INGFHGRLGDLGIIDNSFDVAIS---TACPRLDDVVVDTVECAQQCID--YLRKNKLGYA 739
           + G   ++  LG   ++FD A +    A  RL +++VD  + A Q ++   LRK      
Sbjct: 523 VKGVAAQVFTLG--KDNFDSANALQVCAGGRLFNIIVDNEKTASQLLEKGMLRKR----V 576

Query: 740 RFILLDRL-------RQFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSL 792
             I L+++           L     P  V    +L+  ++   S A   +   +L+    
Sbjct: 577 TIIPLNKISTRVLSDESLALAKKIAPGKVELALNLIGYEED-VSKAMQYIFGGSLICADA 635

Query: 793 KQANNVAYGRK-RFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEV 851
           + A  + +  + R R +T+DG + D  GT+SGG ++ +  L++        I  Y     
Sbjct: 636 ETAKKITFHPQIRARSITLDGDIYDPEGTLSGGSSNNTNSLLK-------DIQKY----- 683

Query: 852 NKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIE--SKISKTEMEADSITSELTL 909
               +E S R  +F          E+EL  ++ Q    E  S+++K      S+ +EL L
Sbjct: 684 ----NEASRRSKSF----------ESELSLIQQQIMECERASQLTK------SLQNELDL 723

Query: 910 AEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSETKTKKEKIKVLQGEIMKI 969
           AE + + +      AL       +I KN E L  E +  +++   +K     LQ E+++I
Sbjct: 724 AEHKFQLS----QKALVSNPAAQIIKKNDEML-NEIETCKTDIDLQKISTAELQAEVVRI 778

Query: 970 ----------GGTKLQMQNSKVGSLCQRL 988
                      G+KL+  N +V +L +++
Sbjct: 779 QKDMQEFNTDKGSKLKQLNKEVSTLAKQI 807

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score =  101 bits (252), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 98/182 (53%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F+     +S     +   P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNTDKSNSPIGFTNS--PQISVTRQVVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFANANRV 1155

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 74/160 (46%), Gaps = 21/160 (13%)

Query: 689 HGRLGDLGIIDNS---FDVAIST-ACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILL 744
           HG +G L  IDN    +  A+ T A  RL +VVV   + A Q ++  R  K      I L
Sbjct: 524 HGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPL 581

Query: 745 DRLRQFNLQPIST----------PENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQ 794
           D++     +PIS+          P  V    +L++  D   + A   +  ++L+    + 
Sbjct: 582 DKIYT---RPISSQVLDLAKKIAPGKVELAINLIRF-DESITKAMEFIFGNSLICEDPET 637

Query: 795 ANNVAYGRK-RFRVVTIDGKLIDISGTISGGGNHVSKGLM 833
           A  + +  K R R +T+ G + D  GT+SGG  + S+ L+
Sbjct: 638 AKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSESLL 677

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 98/182 (53%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F+     +S     +   P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNTDKSNSPIGFANS--PQISVTRQVVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 71/157 (45%), Gaps = 15/157 (9%)

Query: 689 HGRLGDLGIIDNS---FDVAIST-ACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILL 744
           +G +G L  +DN    +  A+ T A  RL +VVV   + A Q ++  R  K      I L
Sbjct: 524 YGVVGRLFQLDNDNIRYSSALQTCAGGRLFNVVVRDSQTATQLLEGGRLRK--RVTIIPL 581

Query: 745 DRLRQFNLQPIS-------TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANN 797
           D++    + P          P  V    +L++   P  + A   +  ++L+    + A  
Sbjct: 582 DKIYTRPITPQVLELAKSIAPGKVELAINLIRFDKP-VTKAMEFIFGNSLICDDPETAKK 640

Query: 798 VAYGRK-RFRVVTIDGKLIDISGTISGGGNHVSKGLM 833
           + +  K R R +T+ G + D  GT+SGG  + S+ L+
Sbjct: 641 ITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSQSLL 677

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score =  101 bits (251), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 98/182 (53%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F+   D+S+      E  P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNS-DKSNAPIGF-ESSPTISVTRQVALGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 73/160 (45%), Gaps = 16/160 (10%)

Query: 685 INGFHGRLGDLGIIDNSFDVAIS---TACPRLDDVVVDTVECAQQCIDYLRKNKLGYARF 741
           + G   RL  L   +N++  A +    A  RL +VVVD  + A Q +   R  K      
Sbjct: 523 VKGVAARLFHLN--ENNYSSATALQVCAGGRLYNVVVDNEKTASQLLQRGRLRK--RVTI 578

Query: 742 ILLDRL-------RQFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQ 794
           I L+++       +  N+    +P NV    +L+  ++   + A   +   +L+ +  + 
Sbjct: 579 IPLNKIMARKLNDKTLNIAKEISPGNVELALNLIGYEED-VAKAMEFIFGSSLICKDAET 637

Query: 795 ANNVAYGRK-RFRVVTIDGKLIDISGTISGGGNHVSKGLM 833
           A  V +  + R R +T+ G + D  GT+SGG  +++  L+
Sbjct: 638 AKKVTFHPQVRTRSITLQGDVYDPEGTLSGGSRNMNSSLL 677

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 97/183 (53%), Gaps = 13/183 (7%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRID-EEKPGLVITRKAFKNNSSKYYIN 273
            DLI+K      +   SV + F    +     S I  E  P + +TR+     +SKY IN
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFA---NSDKNNSPIGFESYPKISVTRQIVLGGTSKYLIN 118

Query: 274 GKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
           G  +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 334 ANY 336
             +
Sbjct: 172 KMF 174

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMF 1388
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 60/128 (46%), Gaps = 19/128 (14%)

Query: 709 ACPRLDDVVVDTVECAQQCIDY--LRK-------NKLGYARFILLDRLRQ--FNLQPIST 757
           A  RL +VVV+    A Q ++   LRK       NK+  AR     RL Q   N      
Sbjct: 548 AGGRLFNVVVNNESTASQLLERGRLRKRVTIIPLNKIS-AR-----RLHQDTVNFAKQLA 601

Query: 758 PENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-RFRVVTIDGKLID 816
           P++V    +L+  +D + + A   +   +L+ R  + A  V +  K R R +T+ G + D
Sbjct: 602 PDSVELALNLIGYED-EVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIYD 660

Query: 817 ISGTISGG 824
             GT+SGG
Sbjct: 661 PEGTLSGG 668

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 97/182 (53%), Gaps = 11/182 (6%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F      +S     +   P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFNNTDKLNSPIGFTNS--PQISVTRQVVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V +L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 335 NY 336
            +
Sbjct: 173 MF 174

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 71/162 (43%), Gaps = 15/162 (9%)

Query: 684 RINGFHGRLGDLGIIDNS---FDVAIST-ACPRLDDVVVDTVECAQQCIDYLRKNKLGYA 739
           + N  HG +G L  +D     +  A+ T A  RL +VVV   + A Q ++  R  K    
Sbjct: 519 KANFVHGVVGQLFQLDYDNIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RV 576

Query: 740 RFILLDRLRQFNLQP-------ISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSL 792
             I LD++    + P          P  V    +L+K  D   + A   +  ++L+    
Sbjct: 577 TIIPLDKIYARTINPQVLELAKTVAPGKVELAINLIKF-DKTVTKAMEFIFGNSLICEDP 635

Query: 793 KQANNVAYGRK-RFRVVTIDGKLIDISGTISGGGNHVSKGLM 833
           + A  + +  K R R +T+ G + D  GT+SGG  + S  L+
Sbjct: 636 ETAKKITFHPKIRIRSITLQGDVYDPEGTLSGGSKNTSDSLL 677

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 96/179 (53%), Gaps = 11/179 (6%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F     ++S +    E    + ITR+      SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFNN--SDTSNSPIGFESHAKISITRQIILGGVSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
             +    V +L ++  +++++  FLI+QG++  +  MKP+        +L  +E+  GT
Sbjct: 120 HRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAGT 171

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 82/140 (58%), Gaps = 1/140 (0%)

Query: 1249 RDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1308
            + +++  +E L + + +  +  +  +S+    ++  +     A+LE  +  D  +EG+  
Sbjct: 1011 KQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLEV 1069

Query: 1309 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1368
             V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + 
Sbjct: 1070 KVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHL 1129

Query: 1369 IKERTKNAQFIVISLRNNMF 1388
            IK R K +QFIV+SL+  MF
Sbjct: 1130 IKTRFKGSQFIVVSLKEGMF 1149

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 88/294 (29%), Positives = 147/294 (50%), Gaps = 41/294 (13%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F+   D+S       E    + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNS-DKSKAPIGF-ETSLTISVTRQIVLGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTA 334
             +    V  L ++  +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEAAGTK 172

Query: 335 NYKPLIEEQMNQIEALNEVCLEKENRF---EIVDREKNSLESGKETALEFLAKEKQLTL- 390
            ++   E+ +  + A  E  L+ ENR    E ++ +   L   K T L+F  +E Q  L 
Sbjct: 173 MFEDRREKAIRTM-AKKETKLQ-ENRTLLKEEIEPKLEKLRLEKRTFLDF--QETQTDLE 228

Query: 391 -------------LKSK--LF-------QFKVLQSNSKLASTLEKISSLNKDFE 422
                        LKS+  LF       + K+   NS+++   E++ SLN+DFE
Sbjct: 229 ETDRVVNAYDYHRLKSQKELFKETLSSKENKIKDLNSQISKLAEELESLNEDFE 282

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1315 KSWR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1373
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1374 KNAQFIVISLRNNMFELAQQL 1394
            K +QFIV+SL+  MF  A ++
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRV 1155

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 97/179 (54%), Gaps = 11/179 (6%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQDRL 214
           + EL+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            DLI+K      +   SV + F+   D+S+     +   P + +TR+     +SKY ING
Sbjct: 63  QDLIYK-RGQAGVTKASVTIVFDNT-DKSNSPIGFNTS-PRISVTRQIVIGGTSKYLING 119

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
             +    V +L ++  +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAGT 171

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            AQFIV+SL+  MF  A ++
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 71/160 (44%), Gaps = 15/160 (9%)

Query: 686 NGFHGRLGDLGII-DNSFDVAIS---TACPRLDDVVVDTVECAQQCIDYLRKNKLGYARF 741
           N   G    L  I DN+ + A +    A  RL +VVVD    A Q ++  R  K      
Sbjct: 525 NSVKGVAATLFTINDNAIESASALQVCAGGRLYNVVVDNETTASQLLEKGRLRK--RVTI 582

Query: 742 ILLDRL--RQFNLQPIS-----TPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQ 794
           I L+++  R+ N   ++      P  V    +L+   D + S A   +   +L+ +  + 
Sbjct: 583 IPLNKIASRRLNENTVNFAKQLAPGKVDLALNLIGYSD-ELSRAMEFIFGTSLICKDSET 641

Query: 795 ANNVAYGRK-RFRVVTIDGKLIDISGTISGGGNHVSKGLM 833
           A  V + +  R R +T++G + D  GT+SGG  +    L+
Sbjct: 642 AKKVTFHQNIRQRSITLEGDVYDPEGTLSGGSRNNKNSLL 681

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 85.5 bits (210), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 117/237 (49%), Gaps = 41/237 (17%)

Query: 1215 IDETNVDIGVLEEYARRLAE----FKRRKLDLNQAVQKRDEVKGQVE----VLKKKRFDE 1266
            ++  N DI  L    +R  E    F  ++ +L +  ++ DE K  ++     LK+++ + 
Sbjct: 977  LNSVNEDISGLSNVNKRAFENFKKFGEKRTELEERAEELDESKSSIQNLITRLKRQKVNA 1036

Query: 1267 FMTGFNIISMTLKEMYQMITMGGNAEL---------------ELVD-------------S 1298
              + FN +S    ++++ +   G A+L               E V+             S
Sbjct: 1037 VDSTFNKVSENFSKVFEKLVPRGTAKLIIHRNTDIQEDPNDDEDVNMSDGDENDESRSKS 1096

Query: 1299 LDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1356
            ++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAA
Sbjct: 1097 VEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDAA 1156

Query: 1357 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNID 1413
            LD +  + VA+ IKE ++NAQFI  + R++M E+A +    Y+     + +TV  +D
Sbjct: 1157 LDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKF---YRVKYENKISTVIEVD 1210

 Score = 62.4 bits (150), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 87/187 (46%), Gaps = 17/187 (9%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y    ++  F    + V+G NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHF----EYVIDESSGTSRIDEEKPGLVITRKAFKNNSSK 269
              LIH+     ++ S SV + F      +I  S    R ++E    V  R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPSHRIILPSGIPPRENDE----VFVRRTVGLKKDD 114

Query: 270 YYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N +  + ++V ++L++ G  + +   ++ QG +  +   K       D   L  LE+
Sbjct: 115 YQLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK-------DRERLHLLEE 167

Query: 330 IIGTANY 336
           ++G  ++
Sbjct: 168 VVGAKSF 174

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 66/141 (46%), Gaps = 11/141 (7%)

Query: 690 GRLGDLGIIDNSFD-VAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  +++ +   A       L  +VVDT E A   I  L + K G   F+ L+R+ 
Sbjct: 537 GTLGELIKVNDKYKKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRV- 595

Query: 749 QFNLQPISTPEN-VPRLFDLVKP--KDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRF 805
            ++   I+ P N       L+K    D +F  A   V   T+V R L     +A   KRF
Sbjct: 596 -YSDPNITYPPNEQASCTPLIKKIRYDARFEKAVKQVFGKTIVVRDLSTGARLA---KRF 651

Query: 806 RV--VTIDGKLIDISGTISGG 824
           R+  +T+DG   D  G ++GG
Sbjct: 652 RLNAITLDGDRADKKGALTGG 672

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 84/171 (49%), Gaps = 26/171 (15%)

Query: 1247 QKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELEL----------- 1295
            Q ++ ++  VE LKK++ +     F+ ++     +++ +   G   L +           
Sbjct: 1041 QSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGT 1100

Query: 1296 -------------VDSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALH 1340
                          D+LD    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+ 
Sbjct: 1101 GQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQ 1160

Query: 1341 KYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1391
               P P Y+ DEIDAALD +  + VAN IKE + +AQFI  + R +M ++A
Sbjct: 1161 MVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVA 1211

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 150/335 (44%), Gaps = 52/335 (15%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  ++++ FK+Y     V  F   F+ V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYIN 273
              LIH+     ++ S  V + F    D+   TS I   +  +V  R+       +Y +N
Sbjct: 85  RQGLIHQGTG--SIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKDEYSVN 142

Query: 274 GKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
           GK    ++++++ ++ G    +   ++ QG +  +   K K         L  LED++G 
Sbjct: 143 GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER-------LLLLEDVVGA 195

Query: 334 ANYKPLIEEQMNQIEALNE-------VCLEKENRFEIVDREKNSLESGKET-----ALEF 381
            +++  + E   ++EA N           E + R E +D E+  LE  +E        +F
Sbjct: 196 RSFEIKLRESSKKMEATNRDRAKITSELSELKARLEELDEERQELEKYQELERDRRIFQF 255

Query: 382 LAKEKQLTLLKSKLFQFK-----VLQSNSKLASTLEK----ISSLNK------------- 419
           +  +++L  + S++   +     VLQS+ +    L K    I++L K             
Sbjct: 256 VLYDRELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKE 315

Query: 420 --DFETEKVKFQESLK-------KVEEVKTQRKEI 445
             DF+ +K + QE +K       + EE K QR ++
Sbjct: 316 STDFQQDKSRLQEIVKRKADLEIRYEETKRQRDQV 350

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 62/144 (43%), Gaps = 11/144 (7%)

Query: 687 GFHGRLGDLGIIDNSF-DVAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLD 745
             HG LG+L  ++  +   A +     L  VVVDT E A   +  L   K G   FI L+
Sbjct: 558 AVHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLN 617

Query: 746 RLRQFNLQPISTPENV-----PRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAY 800
           R+   N   ++ PEN      P L+ +    D  F  A   V   T+V R L   + +A 
Sbjct: 618 RISDRN--AVTFPENAQAECTPLLWKI--KYDKVFEKAVRHVFGRTIVVRDLGNGSKLAR 673

Query: 801 GRKRFRVVTIDGKLIDISGTISGG 824
                  VT+DG   D  G I+GG
Sbjct: 674 SYN-LDAVTLDGDRADNRGVITGG 696

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 66/109 (60%), Gaps = 3/109 (2%)

Query: 1301 PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358
            P   GV+ SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1359 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRST 1407
             +  + VAN +KE +KNAQFI  + R +M ++A +   + K +N+  S 
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRV-KYENKISSV 1206

 Score = 68.9 bits (167), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 133/279 (47%), Gaps = 29/279 (10%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  ++++ FK+Y    ++  F    + ++G NGSGKSN+  ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHK-SEAFPNLQSCSVAVHFE------YVIDESSGTSRIDEEKPGLVITRKAFKNN 266
              LIH+ +    ++ SCSV + F        +   +S   R + E    V  R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFHDPDNRMILASNASIVPRPNNE----VFIRRTVGLK 116

Query: 267 SSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 326
              Y IN +  + +++ ++L+  G  + +   ++ QG++  +   K K         L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------LQL 169

Query: 327 LEDIIGTANYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLESG-KETALEFLAKE 385
           LED++G  +++  + + + +I+       E E +   +D+E + L++   E   E L  E
Sbjct: 170 LEDVVGAKSFEIKLNDSLKKIK-------ETEFKKSTIDKELSELKNKLNEMEWEKLELE 222

Query: 386 KQLTLLKS-KLFQFKVLQSNSKLASTLEKISSLNKDFET 423
           K     K+ K+ QF +   + +L   + +I SL+ D+ +
Sbjct: 223 KFNKFDKNRKVLQFTLY--DRELNDLINQIESLDDDYNS 259

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 55/115 (47%), Gaps = 11/115 (9%)

Query: 716 VVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTP--ENVPRLFDLVKP--K 771
           ++VDT E A   +  L + K G   FI L+++  +N   I+ P  +       L+K    
Sbjct: 570 IIVDTEETASLLMQELYRMKGGRVTFIPLNKI--YNDPNITYPPADQYSSFTPLIKKLKY 627

Query: 772 DPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRV--VTIDGKLIDISGTISGG 824
           + KF  A   +   T+V + L     +A   K+F++  +T+DG   D  G ++GG
Sbjct: 628 ESKFEGAMKHIFGKTIVVKDLSYGLKLA---KKFKLNAITLDGDRADKRGVLTGG 679

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 100/193 (51%), Gaps = 20/193 (10%)

Query: 1235 FKRRKLDLNQAVQKRDE----VKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGN 1290
            F  +K++LN+   + D+    ++  +E LK+++     + F  +S     +++ +   G 
Sbjct: 1001 FNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVPRGT 1060

Query: 1291 AELEL------------VDSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALV 1336
            A+L +             +S +    G++ SV     K    ++  LSGG+KT+ ++AL+
Sbjct: 1061 AKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALI 1120

Query: 1337 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1396
             A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A +   
Sbjct: 1121 LAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFR 1180

Query: 1397 IYKRDNRTRSTTV 1409
            + K +N+  ST V
Sbjct: 1181 V-KYENKI-STVV 1191

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 92/223 (41%), Gaps = 28/223 (12%)

Query: 686 NGFHGRLGDLGIIDNSFD-VAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILL 744
           +   G LG+L  +   +   A       L +VVVDT E A   ++ L   K G   F+ L
Sbjct: 533 DAVFGTLGELIKVSEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHMKGGRVTFMPL 592

Query: 745 DRLRQFNLQPISTPEN----VPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAY 800
           +R+   N   I+ P N       L   +K  D ++  A   +   T+V + L + + +A 
Sbjct: 593 NRIHVDN--NITYPPNEQASCTPLIKKIKY-DVRYEKAVKHIFGRTIVVKDLLEGSKIA- 648

Query: 801 GRKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGT------------NQSNKIDDYTP 848
            + +   VT+DG   D  G ++GG  H      RL T              S +++D   
Sbjct: 649 KKLKLNAVTLDGDRADKMGVLTGG-YHDQHKKTRLDTLKELKVSRQQHIRTSKELEDVRE 707

Query: 849 E------EVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQ 885
           +      E++K+   + +  NN       +  +  +L NL+++
Sbjct: 708 KLQVLDSEIDKLNDSIRKATNNREAILTNIDSLNVKLNNLKNE 750

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
            YFR031C
          Length = 1171

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1317 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1375
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1376 AQFIVISLRNNMFELAQQL 1394
            +QFIV+SL+  MF  A ++
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 61/97 (62%), Gaps = 2/97 (2%)

Query: 1297 DSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1354
            DS++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1355 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1391
            AALD +  + VAN IKE + +AQFI  + R++M ++A
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVA 1188

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 94/202 (46%), Gaps = 17/202 (8%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y     V      F+ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFEYVIDESSG----TSRIDEEKPGLVITRKAFKNNSSK 269
              LIH+           ++ + E +  + SG    TS I   +  +V  R+       +
Sbjct: 61  RQGLIHQGTG------SVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRVRRTIGLKKDE 114

Query: 270 YYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +NGK    ++++++ ++ G    +   ++ QG +  +   K       D   L  LE+
Sbjct: 115 YSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAK-------DRERLALLEE 167

Query: 330 IIGTANYKPLIEEQMNQIEALN 351
           ++G  +++  + E   ++EA N
Sbjct: 168 VVGAKSFEIKLRESAKKMEATN 189

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 58/94 (61%), Gaps = 2/94 (2%)

Query: 1300 DPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1357
            D    GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAAL
Sbjct: 1098 DIVYTGVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAAL 1157

Query: 1358 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELA 1391
            D +  + VAN IKE + NAQFI  + R++M  +A
Sbjct: 1158 DKQYRTSVANTIKELSANAQFICTTFRSDMLRVA 1191

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 93/201 (46%), Gaps = 16/201 (7%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  + ++ FK+Y    ++  F    + V+G NGSGKSN   ++ FV     N ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFEYVIDESSG---TSRIDEEKPGLVITRKAFKNNSSKY 270
              LIH+           ++ + E V D S G    +      P  V+ R+       +Y
Sbjct: 61  RQGLIHQGSG------SVMSAYVEIVFDNSDGRLLNAAASPSSPDEVVIRRTIGLKKDEY 114

Query: 271 YINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 330
            +N K  S  E+  LL++ G    +  +++ QG +  +   K       D   L+ L+++
Sbjct: 115 SLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLKEV 167

Query: 331 IGTANYKPLIEEQMNQIEALN 351
            G  +++  + + +N+++A N
Sbjct: 168 TGANSFEKKLRDSLNKMDATN 188

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 60/142 (42%), Gaps = 5/142 (3%)

Query: 686 NGFHGRLGDLGIIDNSFDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILL 744
           N  +G LG+L  ++  +     T     L  VVVDT + A   +  L   K G   F+ L
Sbjct: 532 NAVYGPLGELIKVNEKYKTCAETVGGNSLFHVVVDTEDTAGLLMQELYNVKGGRVTFMPL 591

Query: 745 DRLRQFN--LQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGR 802
           +RL   N    P +   N   L   +K  D KF  A   V   T+V R L     +A   
Sbjct: 592 NRLHADNNVTYPSNEQSNCTALIKKIKY-DEKFERAVKHVFGKTIVVRDLTLGTKLARQY 650

Query: 803 KRFRVVTIDGKLIDISGTISGG 824
           K    +T+DG   D  G ++GG
Sbjct: 651 K-LNAITLDGDRADKRGVLTGG 671

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 110/233 (47%), Gaps = 37/233 (15%)

Query: 1215 IDETNVDIGVLEEYARRLAE----FKRRKLDLNQAVQKRDEVKGQVE----VLKKKRFDE 1266
            ++  N DI  L+   ++  E    F  +KL+L    ++ DE K  ++     LK+++   
Sbjct: 977  LNAVNEDISGLKNVNKKAFENFKKFHEKKLELEDRSKELDESKTSIQNLIVKLKQQKVAA 1036

Query: 1267 FMTGFNIISMTLKEMYQMITMGGNAELELVDSLDP------------------------F 1302
              + F  +S    E+++ +   G A+L +  S D                          
Sbjct: 1037 VDSTFENVSRNFTEVFEQLVPRGKAKLVIHRSSDARDDDVDAENDTAMTGDDDGTQTESM 1096

Query: 1303 SEGVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1360
              GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +
Sbjct: 1097 YTGVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQ 1156

Query: 1361 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNID 1413
              + VA  IK  + NAQFI  + R +M ++A +   + K +N+   +TV  +D
Sbjct: 1157 YRTAVAGIIKALSANAQFICTTFRTDMLQVADKFFRV-KYENKI--STVVEVD 1206

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 96/199 (48%), Gaps = 17/199 (8%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  ++++ FK+Y    V+  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHF----EYVIDESSGTSRIDEEKPGLVITRKAFKNNSSK 269
              LIH+     ++ S SV + F      +I  S    R ++E    V+ R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPDHRIILPSGVAPRSNDE----VLVRRTVGLKKDD 114

Query: 270 YYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N +  +  +V ++L++ G  +++   ++ QG +  +   K K         L+ LED
Sbjct: 115 YQLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDKER-------LQLLED 167

Query: 330 IIGTANYKPLIEEQMNQIE 348
           ++G  +++  +   + ++E
Sbjct: 168 VVGAKSFEVKLRASLKKME 186

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 79.0 bits (193), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 58/98 (59%), Gaps = 2/98 (2%)

Query: 1299 LDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1356
            L+    GV+ SV     K     +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1357 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1394
            LD +  + VAN IK+ +KNAQFI  + R +M  +A + 
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRF 1192

 Score = 65.9 bits (159), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 90/187 (48%), Gaps = 17/187 (9%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y    ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHF---EYVIDESSGT-SRIDEEKPGLVITRKAFKNNSSK 269
              LIH+     ++ S SV + F   ++ I  SSG   R ++E    V  R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPDHRIILSSGVIPRPNDE----VFVRRTVGLKKDD 114

Query: 270 YYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y IN +  + +++ ++L++ G  +     ++ QG +  +   K K         L  LED
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLLED 167

Query: 330 IIGTANY 336
           +IG  ++
Sbjct: 168 VIGAKSF 174

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 90/223 (40%), Gaps = 20/223 (8%)

Query: 686 NGFHGRLGDLGIIDNSF-DVAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILL 744
           +   G LG+L  +   +   A       L  VVVDT + A   +  L K K G   F+ L
Sbjct: 533 DAVFGTLGELLKVSEKYKTCAEVVGGNSLFHVVVDTDKTASLLMRELYKMKGGRVTFMPL 592

Query: 745 DRLRQ---FNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYG 801
           +RL +       P         L   +K  D KF  A   V   T+V R L     +A  
Sbjct: 593 NRLHEDSGVTFPPQDQSAACTPLLKKIKY-DAKFEKAVKHVFGKTIVVRDLTTGVKMAKS 651

Query: 802 RKRFRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSER 861
            +    +T+DG   D  G ++GG          L   +  ++D       ++ +HEL+ +
Sbjct: 652 YQ-LNAITLDGDRADNRGVLTGG---------YLDQRKKTRLDALKALTNSRNQHELTNK 701

Query: 862 E-----NNFRVANDTVHEMEAELKNLRDQEPAIESKISKTEME 899
           E        +  + T+  +  E++N+  ++  I + + ++ M+
Sbjct: 702 ELHAIKGKLQEIDTTIDNLNGEMRNIATRKETILANMEQSRMQ 744

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 79.0 bits (193), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 64/106 (60%), Gaps = 2/106 (1%)

Query: 1294 ELVDSLDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1351
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1352 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1397
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A +   +
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV 1197

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 146/304 (48%), Gaps = 28/304 (9%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y  + V+  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHF---EYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKY 270
              LIH+     ++ S SV + F   E+ +   SG   +  E    +  R+        Y
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPEHKMILPSGV--VPRENNDEICIRRTVGLKKDDY 117

Query: 271 YINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 330
            +N +  +  +V ++L++ G  + +   ++ QG++ ++   K K         L+ LED+
Sbjct: 118 QLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLEDV 170

Query: 331 IGTANYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLESG-KETALEFLAKEKQLT 389
           +G  +++  ++  + ++E       E E +   + +E + L S  KE   E    EK   
Sbjct: 171 VGAKSFEVKLKASLKKME-------ETEQKRARIAKEMDELNSKLKEMEQERKELEKYNA 223

Query: 390 LLKS-KLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDR 448
           L K+ K+FQF +   + +L   + ++  L+ D+       ++ +K+++    +R+EI   
Sbjct: 224 LEKNRKVFQFTLY--DRELNDIINQVERLDDDYNVTANSSEQYIKELD----KREEIISN 277

Query: 449 ISSN 452
           IS N
Sbjct: 278 ISKN 281

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/117 (37%), Positives = 68/117 (58%), Gaps = 5/117 (4%)

Query: 1299 LDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1356
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1357 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNID 1413
            LD +  + VA  I++ + NAQFI  + R +M E+A     + K +N+   +TV  ID
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRV-KYENKI--STVIEID 1212

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 106/219 (48%), Gaps = 36/219 (16%)

Query: 1215 IDETNVDIGVLEEYARRLAE----FKRRKLDLNQAVQKRDEVKGQVE----VLKKKRFDE 1266
            +++ N +I  L+   +R  E    F  ++ DL++   + DE K  ++     LK+++ + 
Sbjct: 981  LNDMNTEISGLKNVNKRAFENFKKFDEKRKDLSERASELDESKDSIQDLIVKLKQQKVNA 1040

Query: 1267 FMTGFNIISMTLKEMYQMITMGGNAELEL---------VDSLDP---------------- 1301
              + F  +S   + +++ +   G A+L +         +DS+D                 
Sbjct: 1041 VDSTFQKVSENFEAVFERLVPRGIAKLVIHRRDDTKDQMDSIDDDMDVASSERTSSKDGD 1100

Query: 1302 -FSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358
                GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD
Sbjct: 1101 IMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALD 1160

Query: 1359 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1397
             +  + VA  IKE +KNAQFI  + R +M ++A +   +
Sbjct: 1161 KQYRTAVATLIKELSKNAQFICTTFRTDMLQVADKFFRV 1199

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 97/199 (48%), Gaps = 16/199 (8%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  ++++ FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHF----EYVIDESSGTSRIDEEKPGLVITRKAFKNNSSK 269
              LIH+     ++ S SV + F      +I  S   SR D+E    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N +  +  ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEEQMNQIE 348
           ++G  +++  ++  + ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 64/141 (45%), Gaps = 9/141 (6%)

Query: 690 GRLGDLGIIDNSFDVAIST-ACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  +++ +           L  VVVDT E A   ++ L + K G   FI L+RL 
Sbjct: 538 GTLGELIKVNDKYKACAEVIGGNSLFHVVVDTEETATLIMNELYRMKGGRVTFIPLNRLS 597

Query: 749 -----QFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK 803
                +F     +  +  P L   +K + P+F  A   V   T+V + L Q   +A  + 
Sbjct: 598 LDSDVKFPSNTTTQIQFTP-LIKKIKYQ-PRFEKAVKHVFGRTIVVKDLGQGLKLA-KKH 654

Query: 804 RFRVVTIDGKLIDISGTISGG 824
           +   +T+DG   D  G ++GG
Sbjct: 655 KLNAITLDGDRADKRGVLTGG 675

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 84/155 (54%), Gaps = 5/155 (3%)

Query: 1256 VEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKK 1315
            ++ LK+++ +     FN +S    ++++ +   G  EL +      +S GV+  V    K
Sbjct: 952  IDNLKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSK 1010

Query: 1316 S--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1373
            +     I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  +
Sbjct: 1011 NDEQLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLS 1070

Query: 1374 KNA-QFIVISLRNNMFELAQQLVGIYKRDNRTRST 1407
            +N  QFI+ + R++M E+A  ++ + K  N+  S 
Sbjct: 1071 QNGTQFILTTFRSDMIEIA-DMIYMVKYHNKVSSV 1104

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 73/149 (48%), Gaps = 9/149 (6%)

Query: 687 GFHGRLGDLGIIDNSFDVAIST-ACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLD 745
             +G LG+L  +   +   +   A   L +++VDT E A Q ++ L + + G   FI L+
Sbjct: 460 SIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPLN 519

Query: 746 RLRQ-FNLQ-PISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK 803
           R+    N+  P +   N   L   +K  D KF     +V   T+V + L+  N +    K
Sbjct: 520 RIENGVNINYPSNEESNCTALIKKIKY-DKKFEKVIRNVFGKTIVVKDLQLGNRLC---K 575

Query: 804 RFRV--VTIDGKLIDISGTISGGGNHVSK 830
            F++  +T+DG  ID  G +SGG  ++++
Sbjct: 576 EFKLQAITLDGDRIDSKGVVSGGYFNINR 604

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 75.5 bits (184), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 104/220 (47%), Gaps = 37/220 (16%)

Query: 1215 IDETNVDIGVLEEYARRLAE----FKRRKLDLNQAVQKRDEVKGQVE----VLKKKRFDE 1266
            +++ N +I  L+   +R  E    F  ++ DL+    + DE K  ++     LK+++   
Sbjct: 981  LNDMNTEISSLKNVNKRAFENFKKFNEKRKDLSGRASELDESKDSIQDLIVKLKQQKVSA 1040

Query: 1267 FMTGFNIISMTLKEMYQMITMGGNAELEL----VDSLDPFSE------------------ 1304
              + F  +S   K +++ +   G A+L +     DS+D  ++                  
Sbjct: 1041 VDSTFQKVSENFKTVFERLVPRGTAKLVIHRRNEDSIDQANDVDVDMDTGNNEDTINKEG 1100

Query: 1305 -----GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1357
                 GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAAL
Sbjct: 1101 ETVYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL 1160

Query: 1358 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1397
            D +  + VA  IKE + NAQFI  + R +M ++A +   +
Sbjct: 1161 DKQYRTAVATMIKELSTNAQFICTTFRTDMLQVADKFFRV 1200

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 97/199 (48%), Gaps = 16/199 (8%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  +V++ FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHF----EYVIDESSGTSRIDEEKPGLVITRKAFKNNSSK 269
              LIH+     ++ S SV + F      +I  S   SR D+E    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N +  +  ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEEQMNQIE 348
           ++G  +++  ++  + ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 85/198 (42%), Gaps = 20/198 (10%)

Query: 690 GRLGDLGIIDNSFDVAIST-ACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  +++ +           L  +VVDT E A   ++ L + K G   FI L++L 
Sbjct: 538 GTLGELIKVNDKYKACAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNKLS 597

Query: 749 -----QFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK 803
                +F     +  +  P L   +K + P+F  A   V   T+V + L Q   +A  + 
Sbjct: 598 LDADVKFPSNSTTQIQFTP-LIKKIKYQ-PRFEKAVKHVFGKTIVVKDLGQGLKLA-KKH 654

Query: 804 RFRVVTIDGKLIDISGTISGG--GNHVSKGLMRL-----GTNQSNKIDD---YTPEEVNK 853
           +   +T+DG   D  G ++GG    H    L  L       NQ   I D       E+N 
Sbjct: 655 KLNAITLDGDRADKRGVLTGGYLDQHKRTRLDSLKNLNESRNQHKSIGDELQVVRNELND 714

Query: 854 IEHELSERENNFR-VAND 870
           I+ ++ +   N R V+ND
Sbjct: 715 IDAQIDQLNGNIRKVSND 732

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 75.5 bits (184), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 105/220 (47%), Gaps = 37/220 (16%)

Query: 1215 IDETNVDIGVLEEYARRLAE----FKRRKLDLNQAVQKRDEVKGQVE----VLKKKRFDE 1266
            +++ N +I  L+   +R  E    F  R+ DL +   + DE K  ++     LK+++ + 
Sbjct: 981  LNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNA 1040

Query: 1267 FMTGFNIISMTLKEMYQMITMGGNAEL-------------ELVD-SLDPFSE-------- 1304
              + F  +S   + +++ +   G A+L             E +D  +D  S         
Sbjct: 1041 VDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDS 1100

Query: 1305 -----GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1357
                 GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAAL
Sbjct: 1101 EIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL 1160

Query: 1358 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1397
            D +  + VA  +KE +KNAQFI  + R +M ++A +   +
Sbjct: 1161 DKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRV 1200

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 97/199 (48%), Gaps = 16/199 (8%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I  ++++ FK+Y    ++  F    + ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHF----EYVIDESSGTSRIDEEKPGLVITRKAFKNNSSK 269
              LIH+     ++ S SV + F      +I  S   SR D+E    V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPDHSMILPSGVLSRGDDE----VTIRRTVGLKKDD 115

Query: 270 YYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLED 329
           Y +N +  +  ++ ++L+  G  +++   ++ QG++  +   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 330 IIGTANYKPLIEEQMNQIE 348
           ++G  +++  ++  + ++E
Sbjct: 169 VVGAKSFEVKLKASLKKME 187

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 87/198 (43%), Gaps = 20/198 (10%)

Query: 690 GRLGDLGIIDNSFDVAIST-ACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  +++ +           L  +VVDT E A   ++ L + K G   FI L+RL 
Sbjct: 538 GTLGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLS 597

Query: 749 QFNLQPISTPENVP---RLFDLVKP--KDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK 803
             +   +  P N     +   L+K    +P+F  A   V   T+V + L Q   +A  + 
Sbjct: 598 LDS--DVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLA-KKH 654

Query: 804 RFRVVTIDGKLIDISGTISGG--GNHVSKGLMRL-----GTNQSNKI---DDYTPEEVNK 853
           +   +T+DG   D  G ++GG    H    L  L       +Q  KI    D+   E+N 
Sbjct: 655 KLNAITLDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELND 714

Query: 854 IEHELSERENNFR-VAND 870
           I+ ++ +   N R V+ND
Sbjct: 715 IDTKIDQVNGNIRKVSND 732

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 57/95 (60%), Gaps = 2/95 (2%)

Query: 1305 GVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362
            GV+ SV     +    ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  
Sbjct: 1092 GVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYR 1151

Query: 1363 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1397
            + VA+ IK  + NAQFI  + R +M ++A +   +
Sbjct: 1152 TAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRV 1186

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/195 (20%), Positives = 93/195 (47%), Gaps = 9/195 (4%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I +++++ FK+Y    ++  F   ++ ++G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYIN 273
              LIH+     ++ S SV + F    +     S +       V  R+        Y IN
Sbjct: 61  RQGLIHQGSG--SVMSASVEIQFYDPGNSMILPSGVAVNPDSTVSIRRTVGLKKDDYQIN 118

Query: 274 GKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
            +  + +++ +++++ G  + +   ++ QG +  +   K K         L+ LED++G 
Sbjct: 119 DRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER-------LQILEDVVGA 171

Query: 334 ANYKPLIEEQMNQIE 348
            +++  +   + ++E
Sbjct: 172 KSFEAKLTASLKKME 186

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 66/141 (46%), Gaps = 11/141 (7%)

Query: 690 GRLGDLGIIDNSFD-VAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  +   +   A       L ++VVDT E A   +D L + K G   F+ L+R+R
Sbjct: 537 GTLGELIKVSEKYKRCAEVIGGNSLFNIVVDTDETASLIMDELYRMKGGRVTFMPLNRIR 596

Query: 749 ---QFNLQPISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRF 805
               F   P       P L   +K  D ++  A   V   T+V + L + + +A   KRF
Sbjct: 597 MDSNFTYPPNDQASCTP-LIKKIKF-DVRYEKAVMHVFGKTIVVKDLGEGSKLA---KRF 651

Query: 806 RV--VTIDGKLIDISGTISGG 824
           ++  +T+DG   D  G ++GG
Sbjct: 652 KMNAITLDGDRADKRGELTGG 672

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 74.7 bits (182), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 58/103 (56%), Gaps = 2/103 (1%)

Query: 1297 DSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1354
            D+ D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1355 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1397
            AALD +  + VA  IKE +  AQFI  + R++M  +A +   +
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRV 1195

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 97/197 (49%), Gaps = 14/197 (7%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++++  FK+Y  +  +  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRID-EEKPGLVITRKAFKNNSSKYYI 272
              LI++        S  ++ + E V  ++   + +   +  G +  R+       +Y I
Sbjct: 61  RRSLIYQG------TSSVMSGYVEIVFHDAENRTLLGIPDSNGAIRIRRTVGLKKDEYMI 114

Query: 273 NGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIG 332
           N K SS ++V +LL++ G    +   ++ QG + ++   K       D   L+ LE+++G
Sbjct: 115 NNKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAK-------DRERLQLLEEVVG 167

Query: 333 TANYKPLIEEQMNQIEA 349
             +++  ++E + +++A
Sbjct: 168 AKSFERKLKESLQRMDA 184

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 64/140 (45%), Gaps = 9/140 (6%)

Query: 690 GRLGDLGIIDNSFD-VAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  +   +   A       L  VVVDT   A   +  L  +K G   F+ L+R+ 
Sbjct: 534 GPLGELIKVSEKYKTCAEVVGGNSLFHVVVDTENTASLIMQELYNSKGGRVTFMPLNRIY 593

Query: 749 -QFNLQPISTPE-NVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFR 806
              N+Q  S  E N   L   +K  D KF  A   V   T+V + L Q + +A   K+F 
Sbjct: 594 VDPNIQYPSNEEYNCTPLIKKIKF-DGKFEKAVKHVFGKTIVVKDLLQGSKLA---KQFN 649

Query: 807 V--VTIDGKLIDISGTISGG 824
           +  VT+DG   D  G ++GG
Sbjct: 650 LNSVTLDGDKADNKGVLTGG 669

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 63/109 (57%), Gaps = 4/109 (3%)

Query: 1301 PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1358
            P+ EGV+ SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1359 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRST 1407
             +    VA  I + + NAQFI  + R++M + A +   + K +N+  S 
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRV-KYENKQSSV 1198

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 66/140 (47%), Gaps = 8/140 (5%)

Query: 690 GRLGDLGIIDNSFDVAIST-ACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLR 748
           G +G+L  ++  + V         L  VVVDT E A   ++ L + K G   F+ L++L+
Sbjct: 539 GTVGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLK 598

Query: 749 QFNLQPISTPE--NVPRLFDLVKPK-DPKFSNAFYSVLRDTLVARSLKQANNVAYGRK-R 804
             N Q I  P   N+P    + K K D +F      V    LV + L   N ++  ++ +
Sbjct: 599 NGN-QNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDL--TNGLSISKQYK 655

Query: 805 FRVVTIDGKLIDISGTISGG 824
              +T+DG  +D  G ++GG
Sbjct: 656 LSCITLDGDRVDGKGVLTGG 675

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 72.8 bits (177), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (54%), Gaps = 2/102 (1%)

Query: 1298 SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1355
            S D    GV+  V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDA
Sbjct: 1099 SQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1158

Query: 1356 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1397
            ALD +  + VA  +K+ +  AQFI  + R +M  +A +   +
Sbjct: 1159 ALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVADRFYRV 1200

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/195 (21%), Positives = 96/195 (49%), Gaps = 13/195 (6%)

Query: 154 LFINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213
           ++I ++++  FK+Y  +  +  F    + VVG NGSGKSN   ++ FV       ++++ 
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYIN 273
              LI++        S  ++ + E V   +   + +  +  G++  R+       +Y IN
Sbjct: 61  RRSLIYQG------TSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114

Query: 274 GKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGT 333
            K +S ++V +LL++ G    +   ++ QG + ++   + +         L+ LE++IG 
Sbjct: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVIGA 167

Query: 334 ANYKPLIEEQMNQIE 348
            +++  ++E + ++E
Sbjct: 168 KSFERKLKESLQKME 182

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 88/192 (45%), Gaps = 15/192 (7%)

Query: 643 EEMQKVLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQK-SGRIN----GFHGRLGDLGI 697
           +++Q VL +       A  +LSE  ++S + T L  + + + R+N       G LG+L  
Sbjct: 482 QKIQSVLESLVDDVKRAEGTLSETMDRS-LATGLKNVSEIAQRLNLPEGSVFGPLGELIK 540

Query: 698 IDNSFD-VAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFN--LQP 754
           I   +   A       L  VVVDT   A   +  L  +K G   FI L+R+   +  + P
Sbjct: 541 ISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVDSNIVYP 600

Query: 755 ISTPENVPRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRV--VTIDG 812
            +   +   L   +K  DPKF  A   V   T+V + L Q   +A   K+FR+  +T+DG
Sbjct: 601 SNDEHHCTPLIKKIKY-DPKFERAIKHVFGKTIVVKDLNQGTKLA---KQFRLNAITLDG 656

Query: 813 KLIDISGTISGG 824
              D  G ++GG
Sbjct: 657 DKADSRGVLTGG 668

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 72.4 bits (176), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 102/220 (46%), Gaps = 37/220 (16%)

Query: 1215 IDETNVDIGVLEEYARRLAE----FKRRKLDLNQAVQKRDEVKGQVE----VLKKKRFDE 1266
            +++ N +I  L+   +R  E    F  ++ DL++   + DE K  ++     LK+++   
Sbjct: 981  LNDMNTEISGLKNVNKRAFENFKKFNEKRKDLSERASELDESKNSIQDLIVRLKQQKVSA 1040

Query: 1267 FMTGFNIISMTLKEMYQMITMGGNAELEL----------VDSLD---------------- 1300
              + F  +S   + +++ +   G A+L +           DS D                
Sbjct: 1041 VDSTFQKVSENFETVFERLVPRGTAKLVIHRRNENVGDQTDSADVEMDADASKVTSSRDG 1100

Query: 1301 -PFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1357
                 GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAAL
Sbjct: 1101 ETVYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL 1160

Query: 1358 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGI 1397
            D +  + VA  IKE + +AQFI  + R +M ++A +   +
Sbjct: 1161 DKQYRTAVATLIKELSNDAQFICTTFRTDMLQVADKFFRV 1200

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 64/141 (45%), Gaps = 9/141 (6%)

Query: 690 GRLGDLGIIDNSFD-VAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLR 748
           G LG+L  +++ +   A       L  +VVDT E A   ++ L + K G   FI L+RL 
Sbjct: 538 GTLGELIKVNDKYKACAEVVGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRL- 596

Query: 749 QFNLQPISTPENVP---RLFDLVKP--KDPKFSNAFYSVLRDTLVARSLKQANNVAYGRK 803
            F    +  P N     +   L+K     P+F  A   V   T+V + L Q   +A  + 
Sbjct: 597 -FLDSDVKFPSNTTTQIQFTPLIKKIKYQPRFEKAVKHVFGKTIVVKELGQGLKLA-KKH 654

Query: 804 RFRVVTIDGKLIDISGTISGG 824
           +   +T+DG   D  G ++GG
Sbjct: 655 KLNAITLDGDRADKRGLLTGG 675

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 68.9 bits (167), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 1320 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1379
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1380 VISLRNNMFELAQQLVGIYKRDNRTRSTT 1408
              + R +M  +A     + K +N+  + T
Sbjct: 1177 CTTFRTDMINVADTFFRV-KFENKVSTVT 1204

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 77/181 (42%), Gaps = 22/181 (12%)

Query: 690 GRLGDLGIIDNSFDVAISTACPR-LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLR 748
           G +G+L  + + + +         L +VVVD  E A   I  L   K G   FI L++L 
Sbjct: 534 GPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKLH 593

Query: 749 QFNLQPISTPENVPR--LFDLVKP--KDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKR 804
                  + P N+ +     L+K    D KF      V   TLV +SL    ++A   K 
Sbjct: 594 VDT--NFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKEYK- 650

Query: 805 FRVVTIDGKLIDISGTISGGGNHVSKGLMRLGTNQSNKID---DY--TPEEVNKIEHELS 859
              +T+DG   D  G +SGG          L   +SN++D   D+  +  E  KI+ EL 
Sbjct: 651 LNAITLDGDRADSKGVLSGG---------YLDQYKSNRLDTLRDFKQSKREYKKIQVELQ 701

Query: 860 E 860
           E
Sbjct: 702 E 702

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 101/397 (25%), Positives = 172/397 (43%), Gaps = 53/397 (13%)

Query: 156 INELVLENFKSYAGRQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I ++ L+NF +YA    +  FH   S + ++GPNGSGKS  + ++      R   + R  
Sbjct: 48  IIKIRLKNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSK 103

Query: 213 RLSDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKN-NSSKYY 271
           R+ D I   E       C + +  +    +  G + +      + ITR   ++   S Y+
Sbjct: 104 RVEDFIKNGE-----DECEIEITLKNN-SKIQGIANVLSSDDVIKITRVLIRHRKKSDYF 157

Query: 272 INGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDII 331
           IN + +S   V  ++    I LD+    + Q  VE  A++K      SD  L E +  I 
Sbjct: 158 INDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLK------SDKLLFETIRSI- 210

Query: 332 GTANYKPLIEE----QMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQ 387
              +   ++EE    Q  ++    EV   K+ R + +  EK  LE+      EF  K+ Q
Sbjct: 211 -DTDLITVLEELKELQGEELAEEKEVSF-KQQRLQELTAEKERLETSVRVLEEFQRKKDQ 268

Query: 388 LTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEI-- 445
           L + K KL  +       K+    EKI +  K +E  K   +  L+  +     ++++  
Sbjct: 269 LEIHK-KLLPY------VKIKDHKEKIRASKKCYEDAKRNLKALLQDKKPFSHAKRQLER 321

Query: 446 --KDRISSNDSREKDLVLERRELEGTRVSL----EERTKNLANKIEKSERTSKCTKRSIS 499
             +D + S +++E++    + + +   VSL    EE  KN A       R++K  K+ I 
Sbjct: 322 ATEDALESKNNKEREYRENQVKFKSIPVSLEKIREEIQKNSAQINYYRGRSAKL-KQGIE 380

Query: 500 EAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEI 536
           E E  L          E++ +DLN L E E+   D I
Sbjct: 381 ELESQL----------ENQREDLNGLKEPEQGEFDSI 407

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1381 IS 1382
            I+
Sbjct: 1054 IT 1055

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 77/156 (49%), Gaps = 16/156 (10%)

Query: 159 LVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218
           L L NF +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + + + SD  
Sbjct: 60  LRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRSDSF 117

Query: 219 HKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESS 278
            K+ A     S  + V   ++  E  GT+     K   V+TR   K  +S YY++G E+S
Sbjct: 118 IKNGA----DSARIDV---WLAGEDPGTTL----KVSRVLTRNHKK--ASLYYVDGVETS 164

Query: 279 YTEVTKLLKNE-GIDLDHKRFLILQGEVENIAQMKP 313
              V +L+  +  I LD+    + Q  V+  A+++P
Sbjct: 165 EQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 66/153 (43%), Gaps = 6/153 (3%)

Query: 1215 IDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNII 1274
            I+     I +L+E  R+LA+ K R   L   V+K D     +  ++ +      T    I
Sbjct: 896  INHDESSIAILQEVERKLADVKAR---LPAMVRKLDAATASMSTMQAELEPRLDTIVEKI 952

Query: 1275 SMTLKEMYQMITMGGNAELELVDSLDPFSEG--VTFSVMPPKKSWRNITNLSGGEKTLSS 1332
            S     ++  +   G  +L        +     V F    P K   + T  SGGE+ +S+
Sbjct: 953  SERFTNLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLKRLDSHTQ-SGGERAVST 1011

Query: 1333 LALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1365
            +  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1012 VLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 101/392 (25%), Positives = 174/392 (44%), Gaps = 43/392 (10%)

Query: 156 INELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I ++ LENF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R
Sbjct: 36  IVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKR 92

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNS-SKYYI 272
           + D I   E   +  S  + +     ++   G   +D E   + ITR+  K+ S S+Y I
Sbjct: 93  VEDFIKNGE---DRGSIEITLKNSPKVE---GMPGVDSEADTIKITRELIKSKSKSRYMI 146

Query: 273 NGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK-----PKAEKESDDGLLEYL 327
           N +  S  +V  L+    I LD+    + Q  VE  A++K      +  +  D  LL+ L
Sbjct: 147 NDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLLDVL 206

Query: 328 EDIIGTANYKPLIEEQMNQIEALNEVCLEKENRFEI-VDREKNSLESGKETALEFLAKEK 386
           E          L + Q  +I +  E+ L K+   E+ V +EK S     E+   F    K
Sbjct: 207 E---------LLKDLQAKEISSQRELDLNKQKYDELLVQKEKLS-----ESVKAF----K 248

Query: 387 QLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIK 446
           +L   KS+L     L   +KL    EK++   +D +  K   +   K  +     ++ ++
Sbjct: 249 ELESKKSELELHLQLLPYAKLKDHKEKLADYKRDLDQAKANLKSLRKDKKPFSNAKQNLE 308

Query: 447 DR--ISSNDSREKDLVLERRELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHT 504
           +R  I SN    KD  L+  +    RV  E+  +++  +IEK E+  +  +    + E T
Sbjct: 309 ERLEILSNKRDLKDKQLKEDQASYRRV--EQELESIREEIEKKEQQIEYYRNRTKKLEET 366

Query: 505 LKELHTQQTEHESEIKDLNQLLEEERSVLDEI 536
             +    + E E++ K L  +    +SV DEI
Sbjct: 367 AAK---TREELENKYKLLETIELPSQSVFDEI 395

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1378
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1379 IVIS 1382
             +I+
Sbjct: 1039 FLIT 1042

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 76/164 (46%), Gaps = 22/164 (13%)

Query: 156 INELVLENFKSYAGRQVVGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I  L LENF +YA    +  FH S   + ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYA----LTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 213 RLSDLIHKSEAFPNLQSC---SVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKN-NSS 268
           ++ D I   E    ++            YV   S GT+++         TR   +N  +S
Sbjct: 103 KIEDYIKNGEDRSVIEVTLKRDPEAEDRYVA--SDGTTKV---------TRVLHRNRKAS 151

Query: 269 KYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
           +Y++NG+  + + V +L+    I LD+    + Q  VE  A++K
Sbjct: 152 EYFLNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1381 IS 1382
            ++
Sbjct: 1049 VT 1050

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 77/177 (43%), Gaps = 27/177 (15%)

Query: 1221 DIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKE 1280
            ++GV +E A  L E  R K +      K  E+ G +++L            ++    L+ 
Sbjct: 907  NVGVSKESASELLETSRAKYEAGYGTYK--EIDGALKILTH--------SIDVRVQNLQA 956

Query: 1281 MYQMITMGGNAELELVDSLD--PFSEGVTFSV----------MPPKKSWRNITNLSGGEK 1328
              +   +  +A+L+   SL    FS  + FS+           P     RN+  LSGGEK
Sbjct: 957  AQKSTCL--DADLDFRSSLKVRGFSGNLAFSIPAKQLMIYTLTPNDNRPRNVDTLSGGEK 1014

Query: 1329 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1382
            + S +AL+ A  K   + +  +DE D  +D  N  +    I E+ KN    Q I+I+
Sbjct: 1015 SFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKMGTRLILEKLKNNSRTQTIIIT 1071

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 99/429 (23%), Positives = 181/429 (42%), Gaps = 60/429 (13%)

Query: 156 INELVLENFKSYAGRQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           I +L LENF +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 69  IVKLRLENFVTYS----LTEFHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGK 124

Query: 213 RLSDLIHKSEAF----------PNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKA 262
           R+   I   E            P      VAV          GT+++         +R  
Sbjct: 125 RVDSFIKNGENRGLIEVTLKRDPGRTGSFVAV---------DGTTKV---------SRVL 166

Query: 263 FKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDG 322
           +    S+YY+N +  S   V  L+    I LD+    + Q  VE  A++K      SD  
Sbjct: 167 WVGKKSEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK------SDKL 220

Query: 323 LLEYLEDII-----GTANYKPLIEEQMNQIEALNEVCLEK-----ENRFEIVDREKNSLE 372
           L+E +  +         N K L EEQ+ + + L E+   K     E R ++V   + +LE
Sbjct: 221 LMETVRSVNVNLLESFKNLKTLQEEQITEAKEL-ELKTSKLRDLNETRDKLVSSVQ-ALE 278

Query: 373 SGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESL 432
           + K    E    EK L  +K K  + K  Q   K     +++ +L     T+K   +++ 
Sbjct: 279 AFKRKKQELDINEKLLPYVKIKDHKRKCAQYKKKYQEARDQLKALI----TDKEPMRQAQ 334

Query: 433 KKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNLANKIEKSERTSK 492
           + ++    ++++IK   S  +++ + L  E +     +  LEE+ +    KI+  E+ + 
Sbjct: 335 QAIDAEAAEKQDIK---SGLETKFQHLQSEFKVYPKKQQELEEKVREKQGKIKYYEQRTF 391

Query: 493 CTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSLKDKTKDISTEII 552
             K +IS  +  L     + T   +   +L   ++ ER  +    L L+ + +D++T   
Sbjct: 392 KVKEAISGIKEQLSNERNKLTTLPAPDNNLFDEIDTERKRVSIQNLELEQEVRDLNTRSY 451

Query: 553 QHEKELEPW 561
              + ++ W
Sbjct: 452 NLGRNIQNW 460

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1381 IS 1382
            ++
Sbjct: 1072 VT 1073

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 98/423 (23%), Positives = 186/423 (43%), Gaps = 47/423 (11%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           I ++ L+NF +Y  R        S + ++GPNGSGKS  + ++      +   + R  R+
Sbjct: 38  IVKIKLQNFVTY--RLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAKRV 95

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRID-----EEKPGLVITRKAFKNNS-- 267
            D I   E      +  + +  +   D +   S ++       K  L +TR   ++ +  
Sbjct: 96  DDFIKNGE-----DTSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGNKC 150

Query: 268 -SKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDD 321
            S Y+IN K  +   +  L+K   I LD+    + Q  VE  A++K      +  +  D 
Sbjct: 151 KSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVETVRSIDA 210

Query: 322 GLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEF 381
            LL+ L+D+  + N +  +E         NEV + K+ RF  ++ ++N LE+   +  EF
Sbjct: 211 QLLQILDDLKSSQNDETTLE---------NEVDI-KQKRFNELETDRNKLEASVRSLKEF 260

Query: 382 LAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQ 441
              ++ + + K KL  +       K+    E +  L  D+E  K   +  LK  +     
Sbjct: 261 ETMKEDIEIHK-KLLPY------VKVKDHKENLQRLKGDYELAKQNLRALLKDKKPFVDT 313

Query: 442 RKEIKDRIS----SNDSREKDLVLERRELEGTRVSLEERTKNLANKIEKSERTSKCTKRS 497
           + +++ ++     +  S+E++L L R +L      L+   +N+  K  ++      TK+ 
Sbjct: 314 KLDMETKVDEFAENKRSKEEELKLTRNKLMNVFNDLKVVRENIIKKQTQTAYYKTRTKKL 373

Query: 498 ISEAEHTLKELHTQQTE-HESEIKDLNQL--LEEERSVLDEIKLSLKDKTKDISTEI--I 552
             E   T + L   QT+  +  + D   L  +E++RS L +   ++++K  DI  +   I
Sbjct: 374 HEEMAKTKETLEANQTKLTQIALPDATLLEEIEKKRSALLDEDSNVRNKMGDIDNKANSI 433

Query: 553 QHE 555
            HE
Sbjct: 434 NHE 436

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1381 IS 1382
            I+
Sbjct: 1050 IT 1051

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] {ON}
            similar to uniprot|Q08204 YOL034W Saccharomyces
            cerevisiae YOL034W SMC5 Structural maintenance of
            chromosomes (SMC) protein, interacts with Rhc18p and
            Nse1p to form a large complex
          Length = 1119

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 80/187 (42%), Gaps = 33/187 (17%)

Query: 1215 IDETNVDIGVLEEYARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNII 1274
            + +TN DI +LE+    L    R KL  N   Q   E++  +E     R D+ +     I
Sbjct: 917  LKKTNEDISILEKTLPHL----RAKLASN--AQTILEIRNSLE----PRLDDIVKQ---I 963

Query: 1275 SMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL--------SGG 1326
            S     ++  +   G  EL+  DS + +        +  K  +R+ + L        SGG
Sbjct: 964  SKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSGG 1016

Query: 1327 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKNAQFIVI 1381
            E+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N   E T     I  
Sbjct: 1017 ERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLITP 1076

Query: 1382 SLRNNMF 1388
             L  N+F
Sbjct: 1077 KLLTNLF 1083

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 85/185 (45%), Gaps = 25/185 (13%)

Query: 159 LVLENFKSYAGRQVVGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLS 215
           L L NF +YA    +  FH   S + ++GPNGSGKS  + ++      +   + R  ++ 
Sbjct: 63  LKLTNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKVE 118

Query: 216 DLIHKS--EAFP--NLQSCSVAVHFEY-VIDESSGTSRIDEEKPGLVITRKAFKNNSSKY 270
           + I     E      L++ S  +H ++ +I+       +   K  L + +K      SKY
Sbjct: 119 EYIKNGTDEGVIEITLKNSSALLHSDFNMINTDDDVVHV---KRVLSMEKK-----KSKY 170

Query: 271 YINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDDGLLE 325
           YIN K  +   V  +++   I LD+    + Q  VE  A++KP     +  +  + GLLE
Sbjct: 171 YINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKPDTLLNETIRSIEAGLLE 230

Query: 326 YLEDI 330
            L ++
Sbjct: 231 KLSEL 235

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 83/198 (41%), Gaps = 21/198 (10%)

Query: 142 NSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTS--FSAVVGPNGSGKSNVIDSML 199
           N+ Q +  Q+G   I  + L NF +Y+    +  FH S   + ++GPNGSGKS  + ++ 
Sbjct: 34  NTVQYAHFQEGA--IVSIRLTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAIC 87

Query: 200 FVFGFRANKM-RQDRLSDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVI 258
                +   + R  R+ D I    A       ++ +      +  SG   I  E   + +
Sbjct: 88  LGLAGKPEYIGRAKRVEDFIKNGTA-----ESTIEIQLRNSRN-VSGLPMISAEDEAINV 141

Query: 259 TRKAFK-NNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP---- 313
                K      YYING+  S  ++  L+    I LD+    + Q  VE  A++K     
Sbjct: 142 RTVLMKARRKCAYYINGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLL 201

Query: 314 -KAEKESDDGLLEYLEDI 330
            +  +  D  LL  LE +
Sbjct: 202 EQTVRSVDASLLGLLEQL 219

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVSIVANYIKERTKNAQF 1378
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N   E T     
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1379 IVISLRNNM 1387
            I   L  N+
Sbjct: 1052 ITPKLLTNL 1060

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1308 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1367
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1368 YIKERTKN---AQFIVIS 1382
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 37.4 bits (85), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 155 FINELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQD 212
           +I ++VL NF  +   ++ +GP     + +VG NGSGKS ++ ++    G RA +  R +
Sbjct: 74  YIKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGN 130

Query: 213 RLSDLI 218
            L DLI
Sbjct: 131 SLKDLI 136

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 82/188 (43%), Gaps = 37/188 (19%)

Query: 156 INELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRL 214
           I +L L+N  +Y+  +  + P   S + +VGPNGSGKS  + ++      +         
Sbjct: 37  IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKP-------- 85

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPG------LVITRKAFKNNS- 267
            + I +S+   N             I     T++ID    G      + ITR   +N   
Sbjct: 86  -EYIGRSKKIDNF------------IKNGENTAQIDTFLRGHMPNEVIKITRIMTRNKKK 132

Query: 268 SKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDDG 322
           S+YYI+   S+ T V KL     I LD+    + Q  VE+ A++K      +  +  +  
Sbjct: 133 SEYYIDDSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPS 192

Query: 323 LLEYLEDI 330
           LLE LED+
Sbjct: 193 LLETLEDL 200

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1381 IS 1382
            I+
Sbjct: 1035 IT 1036

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 65/138 (47%), Gaps = 12/138 (8%)

Query: 1253 KGQVEVLK---KKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFS 1309
            K Q+ VL+   + + D  + G   IS    +++  +   G  +LE  ++   +   +   
Sbjct: 923  KSQIAVLRDNTEPKIDNLIKG---ISNKYSQLFTSVGSAGEIKLEKPNNFSNWQVKILVK 979

Query: 1310 VMPPKKSWRNITNLS--GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1367
                 +S R +T+ S  GGEK +S+   + +L  +   P  V+DEI+  +D RN  I+  
Sbjct: 980  -FRDNESVRELTSQSQSGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHR 1038

Query: 1368 YIKERT---KNAQFIVIS 1382
             + E       +Q+I+++
Sbjct: 1039 IMVENACEDNTSQYILVT 1056

 Score = 37.0 bits (84), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 18/74 (24%)

Query: 125 LQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFHTSFSAVV 184
           ++LSP++         Y+ +Q+ +       I ++ ++NF +Y    V      SF+ ++
Sbjct: 36  IKLSPIQ---------YDDYQAGS-------IIKIKMKNFMTYG--LVEYQLCPSFNMII 77

Query: 185 GPNGSGKSNVIDSM 198
           GPNGSGKS V+ ++
Sbjct: 78  GPNGSGKSTVVCAL 91

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 11/99 (11%)

Query: 1310 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
            + P    +R ++  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1370 KERTK---NAQFIVISLRNNMFELAQQLVGIYKRDNRTR 1405
             ++ K   N Q I+I+         Q + GI + D+  R
Sbjct: 1067 VKKLKDIPNTQTIIIT--------PQDIGGIAEIDDSVR 1097

 Score = 38.1 bits (87), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 155 FINELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           +I +L L NF  +    V +GP     + +VG NGSGKS ++ ++    G +A++  R  
Sbjct: 79  YIKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGS 135

Query: 213 RLSDLI 218
            L DLI
Sbjct: 136 SLKDLI 141

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1376 -AQFIVISLRN--NMFELAQQLVGIYKRDNRTRSTTVKNID 1413
              Q I+I+ ++   + E+    V I+K  +  R     N D
Sbjct: 1074 RTQTIIITPQDIGKITEIDSTGVKIHKMKDPQRQNNSNNTD 1114

 Score = 35.0 bits (79), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 86/411 (20%), Positives = 172/411 (41%), Gaps = 49/411 (11%)

Query: 155 FINELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           +I ++VL+NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A +  R +
Sbjct: 81  YIKKVVLKNFMCHEHFEMDLGP---KLNFIVGNNGSGKSAILTAITVGLGAKAAETNRGN 137

Query: 213 RLSDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYI 272
            L DLI +           +A+  E   +ES G  + D     ++I R   ++ ++ + +
Sbjct: 138 SLKDLIKEG-----CHRAKIAITLE---NESYGAYQPDVFGSEIIIERTIKRDGTATFSL 189

Query: 273 -----NGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYL 327
                N   +   +V  ++    + + +    + Q    +        +K        YL
Sbjct: 190 RTETRNVISTKRKDVLTIVDYFSVPISNPMCFLSQDAARSFLTASTPHDK--------YL 241

Query: 328 EDIIGTANYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQ 387
             + GT     L++E  + ++    +C   +N   +      +L+   E +   + +  Q
Sbjct: 242 HFMKGT-----LLQEINDNLDRAKLICETSQNNMVLHYSNLKTLKHDYEDSKRLVKELNQ 296

Query: 388 LTLLKSK--LFQFKVL----QSNSKLASTL-EKISSLNKDFETEKVKFQESLKKVEEVKT 440
            + L  +  L Q K L    + N K  STL EKI  +         K +   +K+E  KT
Sbjct: 297 TSNLTERKLLLQGKSLWLDIEHNEKSVSTLQEKIDEVKGKIREVDGKIEGKHQKIERFKT 356

Query: 441 QRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISE 500
             +++   I +        + E  E+E     + E+ + + NK E  +   K  + SI +
Sbjct: 357 DAEQVTSTIEAK-------LEEITEIESKHQEVREKLRVVRNKFEIEKSNEKQAQESIKK 409

Query: 501 AEHTLKELHTQQTEHESEI-KDLNQLLEEERSVLDEIKL---SLKDKTKDI 547
            E  ++ L       E E+ +++    E+ R  L+E++     L  K++DI
Sbjct: 410 CEENIRNLDVSIKRLEDELQREMGGDKEQMRQELNELEAKQEQLLSKSRDI 460

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1119

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 79/333 (23%), Positives = 144/333 (43%), Gaps = 51/333 (15%)

Query: 156 INELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I ++ LENF +Y   +  + P   S + ++GPNGSGKS  + +       +   + R  R
Sbjct: 52  IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKR 108

Query: 214 LSDLIHKSE-------AFPNLQSCSVAVHFEYV----------IDESSGTSRIDEEKPGL 256
           + D I   E          N++S     +F             +D   G  ++D  K   
Sbjct: 109 VDDYIKNGEDRSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCG--QLDLIKFTR 166

Query: 257 VITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP--- 313
           +I R   K   S YYIN K  S   V  L+K   I LD+    + Q  VE  A++K    
Sbjct: 167 IIHRDKKK---SDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARLKSDKL 223

Query: 314 --KAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSL 371
             +  +  D  LL+ LE++    N +  +E+++       E+   K+ R+  +  E+  L
Sbjct: 224 LVETVRSIDPNLLDILEELKVLQNEEQTVEDEL-------EI---KQKRYTELCNERTKL 273

Query: 372 ESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQES 431
           E+  ++  EF  K+ ++    +KL  + +++ +       EK+     D+E  K   ++ 
Sbjct: 274 EASVQSLKEFENKKLEIE-YHNKLLPYVMIKDHR------EKLQKFKGDYEIAKRNLRDL 326

Query: 432 LKKVEEVKTQRKEIKDRIS--SNDSREKDLVLE 462
           +K  +     + EI++ ++  + D R  +  LE
Sbjct: 327 MKDKKPFVKTKLEIEENLNEIAEDKRTNETALE 359

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1381 IS 1382
            I+
Sbjct: 1074 IT 1075

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 7/102 (6%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1372
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1373 TKNAQFIVISLRN--NMFELAQQLVGIYKRDNRTRSTTVKNI 1412
              + Q I+I+ ++   M  +  +   I+K  N  R   V ++
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKNPERHNNVNSL 1098

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 155 FINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I ++ L NF  +   ++   F    + +VG NGSGKS V+ ++    G +A+   R + 
Sbjct: 84  YIKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNS 141

Query: 214 LSDLI 218
           L DLI
Sbjct: 142 LKDLI 146

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 8/84 (9%)

Query: 155 FINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I +++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 87  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 144

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFE 237
           L DLI +        S  + +H E
Sbjct: 145 LKDLIREG-----CYSAKITLHLE 163

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 3/65 (4%)

Query: 155 FINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I +++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 214 LSDLI 218
           L DLI
Sbjct: 139 LKDLI 143

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 8/84 (9%)

Query: 155 FINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I +++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 81  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFE 237
           L DLI +        S  + +H +
Sbjct: 139 LKDLIREG-----CYSAKITLHLD 157

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 33.9 bits (76), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 8/84 (9%)

Query: 155 FINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I +++L NF  +   ++     +  + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 82  YIKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 139

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFE 237
           L DLI +        S  + +H +
Sbjct: 140 LKDLIREG-----CYSAKITLHLD 158

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 15/107 (14%)

Query: 1291 AELELVDSLD--PFSEGVTFSVMPPK----------KSWRNITNLSGGEKTLSSLALVFA 1338
            A+L+   SL    F+  +TF +   K          +  RN+  LSGGEK+ S LAL+ A
Sbjct: 969  ADLDFRASLKVRKFTGNLTFQIAERKLDMLILTANDEKARNVDTLSGGEKSFSQLALLLA 1028

Query: 1339 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1382
              K   + +  +DE D  +D  N  I    + ++ K+    Q I+I+
Sbjct: 1029 TWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLLRTQTIIIT 1075

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 11/78 (14%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1381 ISLRNNMFELAQQLVGIY 1398
            I+         + L G+Y
Sbjct: 1047 IT--------PKLLTGLY 1056

 Score = 36.6 bits (83), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 71/162 (43%), Gaps = 16/162 (9%)

Query: 156 INELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I ++ L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  ITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSEAFPNLQSC---SVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKY 270
           + D I   +    ++     S  VH    I+    T +I       +ITR   +   S Y
Sbjct: 99  VEDFIKNGQDVSRIEITLKNSPKVHDIENINAHDETIKITR-----IITRSKRR---SDY 150

Query: 271 YINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
            IN  + S   V  L+    I LD+    + Q  VE  A++K
Sbjct: 151 LINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLK 192

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
            (REAL)
          Length = 1092

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1381 IS 1382
            I+
Sbjct: 1047 IT 1048

 Score = 37.0 bits (84), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 142/316 (44%), Gaps = 46/316 (14%)

Query: 147 STKQQGRLFINELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFR 205
           S+ Q G +   ++ L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +
Sbjct: 35  SSFQPGSII--KIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGK 89

Query: 206 ANKM-RQDRLSDLIHKSEAFPNLQSC---SVAVH---FEYVIDESSGTSRIDEEKPGLVI 258
              + R  ++ D I   +    ++     S  +H   F    DE+   +RI        I
Sbjct: 90  PEYIGRSKKVEDFIKNGQDTSRIEITLKNSPKIHDIEFINTHDETIKVTRI--------I 141

Query: 259 TRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP----- 313
           TR   +   S Y IN ++ S   V  L+    I LD+    + Q  VE  A++K      
Sbjct: 142 TRSKRR---SDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLV 198

Query: 314 KAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKNSLES 373
           +  +  D  LL+ L++++     +  +++ ++ ++ L  V L +E+     D+ + S+ES
Sbjct: 199 ETIRSIDASLLDVLDELMELQANEQSLQKDLD-VKKLKVVHLRQES-----DKLRKSVES 252

Query: 374 GKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLK 433
            ++       K+K    L S+L  +       K+    EK+++  +++E  K   +  LK
Sbjct: 253 LRD-----FQKKKGEIELHSQLLPY------VKVKDHKEKLNTYKEEYERAKSNLRALLK 301

Query: 434 KVEEVKTQRKEIKDRI 449
             +     +K +++R+
Sbjct: 302 DKKPFANTKKTLENRV 317

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1381 IS 1382
            I+
Sbjct: 1047 IT 1048

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 132/302 (43%), Gaps = 44/302 (14%)

Query: 161 LENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLSDLI 218
           L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  R+ D I
Sbjct: 47  LQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFI 103

Query: 219 HKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEE-KPGLVITRKAFKNNSSKYYINGKES 277
              +    ++   + +     +++    +  DE  K   +ITR   +   S Y IN  E 
Sbjct: 104 KNGQDVSRIE---ITLKNSPKVNDIENVNAHDETIKITRIITRSKRR---SDYLINDCEV 157

Query: 278 SYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKP-----KAEKESDDGLLEYLEDIIG 332
           S + V  L+    I LD+    + Q  VE  A++K      +  +  D  LL+ L     
Sbjct: 158 SESVVKALVAQLNIQLDNLCQFLSQERVEEFARLKSVKLLVETIRSIDSSLLDVL----- 212

Query: 333 TANYKPLIEEQMNQIEALNEVCLEKE-----NRFEIVDREKNSLESGKETALEFLAKEKQ 387
                    +++ +++  NE CL+K+     ++   + +E + L    E+  +F  K+ +
Sbjct: 213 ---------DELRELQG-NEQCLQKDLDVKKSKILHLRQESDKLRKSVESLRDFQKKKGE 262

Query: 388 LTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKD 447
           +  L S+L  +       K+    EK++   +++E  K   +  LK  +     +K +++
Sbjct: 263 IE-LHSRLLPY------VKVKDHKEKLNVYKEEYERAKANLRAILKDKKPFAHTKKTLEN 315

Query: 448 RI 449
           R+
Sbjct: 316 RV 317

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1381 IS 1382
            I+
Sbjct: 1047 IT 1048

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 72/163 (44%), Gaps = 18/163 (11%)

Query: 156 INELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I ++ L++F +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSEAFP----NLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSK 269
           + D I   +        L++       EY ID    T +I       +ITR   +   S 
Sbjct: 99  VEDFIKNGQDVSKIEITLKNSPNVTDIEY-IDARDETIKITR-----IITRSKRR---SD 149

Query: 270 YYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
           Y IN  + S + V  L+    I LD+    + Q  VE  A++K
Sbjct: 150 YLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.8 bits (94), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 15/80 (18%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1378
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1379 IVISLRNNMFELAQQLVGIY 1398
             +I+         + L G+Y
Sbjct: 1056 FLIT--------PKLLTGLY 1067

 Score = 34.3 bits (77), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 7/67 (10%)

Query: 159 LVLENFKSYAGRQVVGPF--HTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRLS 215
           L +ENF +Y     V  F    S + ++GPNGSGKS  + ++      +   + R  +L 
Sbjct: 49  LRMENFVTYK----VAEFDLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKLE 104

Query: 216 DLIHKSE 222
           D I   E
Sbjct: 105 DFIKNGE 111

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1381 IS 1382
            I+
Sbjct: 1072 IT 1073

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 69/157 (43%), Gaps = 16/157 (10%)

Query: 161 LENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR-LSDLI 218
           L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + + R + D I
Sbjct: 71  LHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRNVDDYI 127

Query: 219 HKSEAFPNLQSC---SVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGK 275
              E    ++     S A+H    + E S T  I       ++TR   K   S+Y IN  
Sbjct: 128 KNDEEHGEIEITLKNSEAIHDVEGVLEGSDTITITR-----ILTRSKKK---SEYKINDS 179

Query: 276 ESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
             +   V +L+    I LD+    + Q  VE  A++K
Sbjct: 180 LVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLK 216

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 65/131 (49%), Gaps = 21/131 (16%)

Query: 1263 RFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITN 1322
            R DE +     IS   ++++  + +G   E+ LV   D +SE      +  K  +R++  
Sbjct: 933  RLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK----IEIKVKFRDVAE 982

Query: 1323 L--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-- 1372
            L        SGGE+ +S++  + +L ++   P  V+DEI+  +D RN  IV   + E   
Sbjct: 983  LKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIVHKAMVENAC 1042

Query: 1373 TKN-AQFIVIS 1382
             KN +Q+ +I+
Sbjct: 1043 AKNTSQYFLIT 1053

 Score = 40.0 bits (92), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 134/303 (44%), Gaps = 42/303 (13%)

Query: 142 NSHQSSTKQQGRLFINELVLENFKSYAGRQVVGPFH--TSFSAVVGPNGSGKSNVIDSML 199
           N+   S  Q+G +   +L L NF +Y+    +  FH   S + ++GPNGSGKS+ + ++ 
Sbjct: 34  NNQDYSEFQEGAII--KLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAIC 87

Query: 200 FVFGFRANKM-RQDRLSDLIHKSEAFPNLQSCSVAVHFEYVIDES---SGTSRI---DEE 252
                +   + R  ++ D I       N    SV    E  +  S   SG S I   DE 
Sbjct: 88  LGLAGKPEYIGRAKKVEDFI------KNGTEESV---IELTVKNSKAVSGYSMIGGSDEV 138

Query: 253 KPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
                +  KA K     YYING+     +V  L+    I LD+    + Q  VE  A++K
Sbjct: 139 INIKTVIMKAKKK--CIYYINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK 196

Query: 313 PKAEKESDDGLLEYLEDIIGTANYK--PLIEEQMNQIEALNEVCLEKENRFEIVDREKNS 370
                 SD  L E +  I  T   K   L ++Q  ++    +V L K    +++ R K S
Sbjct: 197 ------SDKLLEETIRSIDSTLVEKLDMLKDKQQEEVTIGRDVELNKSKLEKLIIR-KES 249

Query: 371 LESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNKDFETEKVKFQE 430
           LES      E+  K+ ++ + K  L   +V   N KL     ++++L K +E  K + ++
Sbjct: 250 LESQVRALEEYERKKNEIDIHKKLLPYVRV--KNHKL-----QLNNLKKVYEQSKQELKD 302

Query: 431 SLK 433
            LK
Sbjct: 303 FLK 305

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1089

 Score = 40.4 bits (93), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1380
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1381 IS 1382
            I+
Sbjct: 1044 IT 1045

 Score = 39.7 bits (91), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 67/158 (42%), Gaps = 14/158 (8%)

Query: 156 INELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDRL 214
           I ++ L NF +Y+  +       S + ++GPNGSGKS  + ++      +   + R  +L
Sbjct: 44  IIKIKLWNFVTYSLAEFT--LSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSKL 101

Query: 215 SDLIHKSEAFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYING 274
            D I   E     QS  V V  + V +    T  I      L+ T         +Y ING
Sbjct: 102 EDYIKNGED----QSV-VEVTLKNVPESDFNTDTI------LIKTTINRGKKKPEYAING 150

Query: 275 KESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMK 312
              + T +   +K   I LD+    + Q  VE  A++K
Sbjct: 151 STVTETYIRAFVKKLNIQLDNLCQFLSQERVEEFARLK 188

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 39.7 bits (91), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1321 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1380
            T LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1381 ISL 1383
            IS+
Sbjct: 655  ISI 657

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034w SMC5
          Length = 1105

 Score = 39.3 bits (90), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 102/422 (24%), Positives = 183/422 (43%), Gaps = 67/422 (15%)

Query: 156 INELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           I ++ LENF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 38  IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQ 94

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFEYVID-ESSGTS----RIDEEKPGLV----------- 257
           + D I   +    ++   + +  +  ID E  G+S    R +    GL+           
Sbjct: 95  VEDFIKNGQDTSKIE---IVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTK 151

Query: 258 ITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEK 317
           I R   K  + +Y ING  ++ + V  L+    I LD+    + Q  VE  A+++P  EK
Sbjct: 152 IGRNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP--EK 209

Query: 318 ESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNEVCLEKENRFEIVDREKN-----SLE 372
             D+ +     +++    ++ L + Q+ +IE  NE+    ++  ++   E+N      L 
Sbjct: 210 LLDETIRAIDSELLSM--FEVLKKLQLQEIEMSNEIQTNTDSLKKLKTDEENFQQEVQLL 267

Query: 373 SGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLEKISSLNK---DFETEKVKFQ 429
           +  +  L+ L K K+L      L   K+     KL +   ++    K   +F+ E+  + 
Sbjct: 268 NEYQETLDTLDKHKKL------LPYLKIQDHREKLLTYKRQVEGAKKQLQEFQKEREPYM 321

Query: 430 ESLKKVEEVKTQ----RKEIKD-RISSNDSREK---DLVLERRELEGTRVSLEE---RTK 478
           + L  + E   Q    ++ I++ ++S+    EK    L   R E+E   + +E    R+ 
Sbjct: 322 QVLASLNESDAQLNIEKENIEEKKVSTKRKLEKTVSKLNALREEIEKKNLQIEYYKGRSN 381

Query: 479 NLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDL----NQLLEEERSVLD 534
            L  KIE  +      KR IS+ E          T  ESE+ +L    N L+E E  V  
Sbjct: 382 KLKIKIETKKEDIDNIKRKISDIE----------TPEESEVTELERKRNDLIERESQVNS 431

Query: 535 EI 536
           EI
Sbjct: 432 EI 433

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1324 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD-----FRNVSIVANYIKERTKNAQF 1378
            SGGE+ +S++  + AL K+   P  V+DEI+  +D       + ++V N  +E T  +Q+
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEGT--SQY 1057

Query: 1379 IVIS 1382
             +I+
Sbjct: 1058 FLIT 1061

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 39.3 bits (90), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1315 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1374
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1375 N---AQFIVIS 1382
            +    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 155 FINELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN 207
           +I  + L+NF  +   ++  GP     + +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YIKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKAS 111

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++  +  
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 38.1 bits (87), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 8/84 (9%)

Query: 155 FINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           +I +++L NF  +    V    + +F  +VG NGSGKS ++ +++   G +A++  R   
Sbjct: 72  YIRKVILRNFMCHENFSVELTPNLNF--IVGNNGSGKSAILTAIIVALGVKASETSRGSS 129

Query: 214 LSDLIHKSEAFPNLQSCSVAVHFE 237
           L +LI K        S  V +H +
Sbjct: 130 LKELIRKG-----CNSSKVTLHLD 148

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1364
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I    I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTIGTKLI 1061

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.7 bits (86), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1302 FSEG-VTFSVMPPKKSW-RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1359
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1360 RNVSI----VANYIKERTKNAQFIV 1380
             N  I    + N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 155 FINELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQD 212
           FI ++ L NF  +   ++ +GP     + +VG NGSGKS V+ ++    G +A    R  
Sbjct: 69  FIKKVQLRNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGS 125

Query: 213 RLSDLI 218
            L DLI
Sbjct: 126 SLKDLI 131

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 37.0 bits (84), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 1346 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQQLVG 1396
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1397 IYKRDNRTRST 1407
              K+ +  +S 
Sbjct: 999  FIKKVDSCKSC 1009

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 36.6 bits (83), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1302 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1361
            F EGV   V P        T LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1362 VSIVANYIKERT 1373
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 36.6 bits (83), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 10/78 (12%)

Query: 1302 FSEGVTFSV----------MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1351
            FS G+ F+            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +D
Sbjct: 976  FSGGLNFNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALD 1035

Query: 1352 EIDAALDFRNVSIVANYI 1369
            E D  +D  N  I    I
Sbjct: 1036 EFDVFMDQVNRQIGTKLI 1053

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1375
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1376 -AQFIVIS 1382
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 5/65 (7%)

Query: 156 INELVLENFKSYAGRQV-VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQDR 213
           + +++L NF  +   ++ +GP     + +VG NGSGKS ++ ++    G +A++  R   
Sbjct: 72  LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 214 LSDLI 218
           L DLI
Sbjct: 129 LKDLI 133

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 36.2 bits (82), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 155 FINELVLENFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN 207
           ++  + L+NF  +   ++   F    + +VG NGSGKS ++ ++  VFG +A+
Sbjct: 61  YMKRITLKNFMCHEHFEL--EFGPRLNFIVGSNGSGKSAILTAITVVFGAKAS 111

 Score = 35.0 bits (79), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1318 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1369
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essential
            protein involved in the vesicle-mediated ER to Golgi
            transport step of secretion; binds membranes and
            functions during vesicle docking to the Golgi; required
            for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score = 35.8 bits (81), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 5/90 (5%)

Query: 871  TVHEMEAELKNLRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHN-ALSDKA 929
            T  E+EAEL   ++ +  +E+K+  +E        E+   E+ +KE +I     A   K 
Sbjct: 1083 TREELEAELAAYKNLKNELETKLETSE----KALKEVKENEEHLKEEKIQLEKEATETKQ 1138

Query: 930  QVNMIMKNLERLKGEHDDLQSETKTKKEKI 959
            Q+N +  NLE L+ EH+DL ++ K  +E+I
Sbjct: 1139 QLNSLRANLESLEKEHEDLAAQLKKYEEQI 1168

>NDAI0A00830 Chr1 complement(166377..168431) [2055 bp, 684 aa] {ON}
           Anc_1.162 YKL179C
          Length = 684

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 54/107 (50%), Gaps = 9/107 (8%)

Query: 454 SREKDLVLERRELEGTRV-SLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQ 512
           S E +L+++  E   +R+  LEER   L  K+      +K T     EA    KEL   Q
Sbjct: 235 STEFNLLVQELESAQSRIMQLEERNVTLNTKL------TKATSEEEKEAHLHAKELKINQ 288

Query: 513 TEHESEIKDLNQLLEEERSVLDEIKLSLKDKTKDISTEIIQHEKELE 559
            E E+ +  L+   E ERS L +IK  L+D+ K++  E I  + ELE
Sbjct: 289 LESENVL--LSASFERERSELSKIKDELQDQIKEVKNESISVKSELE 333

>TPHA0O01930 Chr15 (382854..386099) [3246 bp, 1081 aa] {ON} Anc_2.16
           YNL225C
          Length = 1081

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 59/108 (54%), Gaps = 11/108 (10%)

Query: 428 FQESLKKVEEVKTQRKEI-------KDRISSN--DSREKDLVLERRELEGTR--VSLEER 476
           F++S+K V+E   + K++        +R++S+  +SR  +LVL+ + ++G+    +L++ 
Sbjct: 189 FKQSIKNVKEENNELKKLLEEKVIENNRLNSDILNSRNSNLVLQNKLVDGSDEITNLQDE 248

Query: 477 TKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQ 524
              L +K+   E  +K  K  I   E    ELH +  E E+++K LN+
Sbjct: 249 VNILKDKLSYFEADNKILKNDIYSLESNYDELHRELNEWETKVKTLNK 296

>NDAI0E02460 Chr5 (509417..510877) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 90/173 (52%), Gaps = 10/173 (5%)

Query: 369 NSLESGKETALEFLAKEKQLTLLKSKLFQFK-VLQSNSKLASTLEKISSLNKDFETEKVK 427
           +S+ SGK T +E    EKQL  L      FK V+     + S  +K+++L ++F +  + 
Sbjct: 136 DSISSGKLTLVEEKVLEKQLKSLNKVYNDFKSVVPIVKSIGSDEKKVTALKEEFSS--LN 193

Query: 428 FQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVSLEERTKNLANKIEKS 487
            +E   KVE+++ + KE+++++    S+E+ ++L+R +L   R       ++   +I+K+
Sbjct: 194 PREVTAKVEQLQNKLKELQNQVEKTYSKEEAVILQRDKLHQVR-------EDKYAEIQKT 246

Query: 488 ERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSVLDEIKLSL 540
           +R      ++  + E   K    +Q  ++ E K L  L E + S++ +I+  L
Sbjct: 247 KRHYNKMFKNFKKQEGVYKTAMKEQLLNKEERKRLRNLAEAKESIVTKIQERL 299

>TPHA0I02920 Chr9 (639184..642786) [3603 bp, 1200 aa] {ON} Anc_7.488
           YBL047C
          Length = 1200

 Score = 33.9 bits (76), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 71/142 (50%), Gaps = 26/142 (18%)

Query: 346 QIEALNEVCLEKENRFEIV--DREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQS 403
           ++  LNE  L+ ENR   +    E+NS+++ K               L++ L Q  ++  
Sbjct: 675 ELRTLNETKLKVENRINALRAAHEQNSMQTQK---------------LEASLAQ--IMAE 717

Query: 404 NSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLER 463
           N +L +TL++++S +   +T+     E+L K +   TQ  E+K+++++++   K L  + 
Sbjct: 718 NEQLETTLQEVTSTHTQLQTDAQLLDENLTKTQ---TQNSELKEQLANSNIMSKSLQEQL 774

Query: 464 R----ELEGTRVSLEERTKNLA 481
           R    E+   + S +   K+LA
Sbjct: 775 RSKQIEIRDVKASADATVKDLA 796

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
            (REAL)
          Length = 1782

 Score = 33.9 bits (76), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 109/222 (49%), Gaps = 25/222 (11%)

Query: 339  LIEEQMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLA-KEKQLTLLKSKLFQ 397
            ++E+Q+N++E       E E++  ++D  KN LE    +  E L  K  ++  +K ++  
Sbjct: 1387 MLEDQLNKLEN------ENESKTRLIDTSKNELEKATLSHDEILEEKRNEIKSMKDEILS 1440

Query: 398  FK--VLQSNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSR 455
            +K  + ++N+KL ST        +D E+     +E L+ V+E K + +   + +    + 
Sbjct: 1441 YKEKINEANTKLLST-------ERDHESRSNSLKEQLEAVQESKAEVERKMNEMEEESAH 1493

Query: 456  EKDLVLERREL-EGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTE 514
             K  + + +E+ E  +  +E   K L   +E  + + +  K+    ++  +KEL  ++T+
Sbjct: 1494 YKSELNKSKEIVENLKSDIENNEKKLELLVESGKESDEKLKQYTKNSQIDIKELQNEKTD 1553

Query: 515  HESEIKDLNQLLEEERSVLDEIKLSLKDKTKDIS-TEIIQHE 555
             ES+I +  + +E       E+   LKD+ +  S TE IQ E
Sbjct: 1554 LESQIIEFKKKIE-------ELHGKLKDEAESNSKTEAIQQE 1588

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 33.1 bits (74), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 11/82 (13%)

Query: 1302 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1361
            F EG+  +V P        T LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGPRG------TQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1362 VSIVANYIKERTKNAQFIVISL 1383
              IVA+ + +R + A+ I IS+
Sbjct: 605  EDIVASTLLQRCQEAK-ITISI 625

>SAKL0F04026g Chr6 complement(322105..325524) [3420 bp, 1139 aa]
           {ON} similar to uniprot|P24384 Saccharomyces cerevisiae
           YER013W PRP22 RNA-dependent ATPase/ATP-dependent RNA
           helicase in the DEAH-box family associates with the
           lariat intermediate before the second catalytic step of
           splicing
          Length = 1139

 Score = 33.1 bits (74), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 41/99 (41%), Gaps = 6/99 (6%)

Query: 180 FSAVVGPNGSGKSNVIDSMLFVFGFRANKM---RQDRLSDLIHKSEAFPNLQSCSVAVHF 236
           F  +VG  GSGK+  I   L+  GF  N +    Q R    I  ++       C+V    
Sbjct: 495 FLVIVGETGSGKTTQITQYLYEEGFGRNGIIGCTQPRRVAAISVAKRVAEEVGCTVGEEV 554

Query: 237 EYVI---DESSGTSRIDEEKPGLVITRKAFKNNSSKYYI 272
            Y I   DE+S  ++I     G++       +  SKY I
Sbjct: 555 GYTIRFEDETSPMTKIKYMTDGMLQREALLDSKMSKYSI 593

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 138,406,298
Number of extensions: 6157165
Number of successful extensions: 43499
Number of sequences better than 10.0: 1808
Number of HSP's gapped: 41506
Number of HSP's successfully gapped: 3926
Length of query: 1418
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1296
Effective length of database: 39,492,147
Effective search space: 51181822512
Effective search space used: 51181822512
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)