Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1448.258ON43843823680.0
YLR085C (ARP6)8.258ON43843821270.0
Skud_12.1538.258ON43843821260.0
Suva_10.1698.258ON43843820830.0
NDAI0B019608.258ON43944116500.0
NCAS0B049908.258ON42043816460.0
TDEL0F038508.258ON41944016290.0
ZYRO0C01738g8.258ON41443816250.0
Kpol_543.368.258ON42743916180.0
KAFR0B027008.258ON42043816030.0
TBLA0H014608.258ON44244715910.0
KLTH0G13772g8.258ON42043815820.0
SAKL0H17138g8.258ON41943915390.0
KNAG0G020108.258ON42443815220.0
CAGL0L12166g8.258ON42143314960.0
Kwal_56.238328.258ON41943814940.0
Ecym_43128.258ON41143514360.0
AGR091W8.258ON41043514050.0
KLLA0F19063g8.258ON41544213960.0
TPHA0A018308.258ON42144013960.0
NCAS0C037008.23ON3754362658e-25
TBLA0C004408.23ON3754362659e-25
TDEL0C004708.23ON3754362631e-24
CAGL0K12694g8.23ON3754362631e-24
Suva_6.188.23ON3754362631e-24
Smik_6.398.23ON3754362631e-24
YFL039C (ACT1)8.23ON3754362631e-24
TPHA0D002508.23ON3754362632e-24
KNAG0L002508.23ON3754362632e-24
KAFR0D009408.23ON3754362632e-24
ZYRO0F02772g8.23ON3754362622e-24
NDAI0G030408.23ON3754362622e-24
SAKL0B00968g8.23ON3754362613e-24
ABR222W8.23ON3764362613e-24
Kpol_1058.158.23ON3754362604e-24
KLLA0D05357g8.23ON3754362571e-23
KLTH0G18832g8.23ON3754362561e-23
Ecym_15208.23ON3764362517e-23
Skud_6.318.23ON3603872445e-22
Kwal_14.11098.23ON3603872365e-21
NDAI0G029003.161ON3913912155e-18
TBLA0F008703.161ON3913912137e-18
Ecym_63852.117ON3774422121e-17
SAKL0E11814g2.117ON3794522111e-17
KLTH0F06490g3.161ON3913862092e-17
ZYRO0B04928g3.161ON3913912074e-17
CAGL0K01595g3.161ON3913882031e-16
NCAS0C035503.161ON3923872022e-16
SAKL0C07370g3.161ON3913902013e-16
YDL029W (ARP2)3.161ON3913902004e-16
Smik_4.2063.161ON3913901994e-16
AFR051W2.117ON4054421995e-16
Suva_4.2203.161ON3913901986e-16
KNAG0K01130na 1ON3933891986e-16
KLLA0C03850g3.161ON3913861987e-16
Skud_4.2223.161ON3913901978e-16
Ecym_52373.161ON3913891979e-16
ZYRO0G05676g2.117ON3814441969e-16
Kwal_33.141773.161ON3373201951e-15
ADR316W3.161ON3913861961e-15
KLLA0E22925g2.117ON3804491942e-15
TDEL0D046103.161ON3913861923e-15
Kpol_479.253.161ON3913911906e-15
Kpol_1023.188.23ON3193501852e-14
NCAS0B071302.117ON3814481844e-14
Kwal_23.48482.248ON7451661857e-14
TDEL0B048102.117ON3734311817e-14
SAKL0E08602g2.248ON7471571812e-13
KNAG0H036502.117ON3874291782e-13
NDAI0B044602.117ON3814361772e-13
KNAG0I018602.248ON7531851803e-13
KLTH0G09482g2.248ON7451571793e-13
KAFR0C01040na 1ON3373201754e-13
Ecym_32852.248ON7461721776e-13
TPHA0A009203.161ON3913931747e-13
TPHA0I013002.117ON3794301712e-12
TDEL0C041402.248ON7491691722e-12
ADL253C2.248ON7511661624e-11
YNL059C (ARP5)2.248ON7551651615e-11
Skud_14.2722.248ON7551661599e-11
KAFR0D037001.514ON4494421571e-10
KLLA0B13904g1.514ON4562581561e-10
Kwal_33.146422.117ON3834421552e-10
TBLA0B010702.117ON3834501552e-10
Kpol_1003.162.248ON7491641572e-10
KLLA0F03421g2.248ON7471801572e-10
NDAI0D010602.248ON7531651572e-10
KNAG0B001701.514ON4534431552e-10
Skud_8.1902.117ON3844041542e-10
TPHA0C031602.248ON7551831562e-10
Suva_14.2812.248ON7551671553e-10
TBLA0D036801.514ON4584241534e-10
Suva_12.1541.514ON4492571534e-10
Smik_10.3551.514ON4492571524e-10
YJR065C (ARP3)1.514ON4492571524e-10
TPHA0O010401.514ON4582571525e-10
CAGL0H09042g2.117ON3874201516e-10
KLTH0B05940g2.117ON3834541506e-10
Skud_10.2891.514ON4492571516e-10
Smik_8.2102.117ON3844531506e-10
TDEL0F004701.514ON4613861516e-10
Smik_14.2672.248ON7551651527e-10
Suva_15.3262.117ON3843861507e-10
TBLA0E038602.248ON7591651511e-09
SAKL0D12804g1.514ON4564421491e-09
NCAS0A122701.514ON4542571481e-09
CAGL0F00517g1.514ON4542571481e-09
KAFR0F005902.117ON3864391471e-09
ZYRO0G01936g1.514ON4612541481e-09
AFR419C1.514ON4552571481e-09
NDAI0A039701.514ON4624491482e-09
YHR129C (ARP1)2.117ON3843881452e-09
Kpol_1056.161.514ON4602541453e-09
Kwal_27.99581.514ON4451921435e-09
KLTH0C02508g1.514ON4514421436e-09
Ecym_31531.514ON4582581401e-08
ZYRO0A01584g2.248ON7481671341e-07
CAGL0J10054g2.248ON7541581331e-07
KAFR0J011602.248ON7511651303e-07
Kpol_282.41.287ON5011061259e-07
AFR105C1.287ON4791051187e-06
KLLA0D02288g1.287ON5201051098e-05
TPHA0I010301.287ON5031061098e-05
Ecym_63301.287ON4801051081e-04
TBLA0D053601.287ON5961251043e-04
KLTH0H09702g1.287ON4811091034e-04
TDEL0D015501.287ON480931034e-04
ZYRO0G21428g1.287ON4831471027e-04
SAKL0D05874g1.287ON4971051019e-04
NDAI0G055801.287ON515242990.002
KAFR0A015601.287ON485113980.002
Kwal_14.23771.287ON48193980.002
CAGL0M03201g1.287ON493106960.003
NCAS0G030502.248ON743151960.003
SAKL0F13772g7.448ON422290940.005
Suva_6.1541.287ON489113940.005
NCAS0B060601.287ON497146900.016
Kwal_27.105527.448ON351211860.043
Skud_10.1321.287ON48893860.047
KNAG0B019201.287ON505105860.054
Smik_10.1611.287ON489237840.080
YJL081C (ARP4)1.287ON489105830.13
KLTH0C05324g7.448ON399216780.45
YNR023W (SNF12)6.322ON56626732.0
KLLA0E06315g7.448ON438141722.2
TDEL0C031207.448ON438145713.3
Suva_8.4237.14ON21674685.6
KNAG0K017503.158ON41462686.7
KNAG0I026506.373ON209150689.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.144
         (438 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   916   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   823   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   823   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   806   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   640   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   638   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   632   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   630   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   627   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   622   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   617   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   613   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   597   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   590   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   580   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   580   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   557   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   545   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   542   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   542   0.0  
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   106   8e-25
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   106   9e-25
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   105   1e-24
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   105   1e-24
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   105   1e-24
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   105   1e-24
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   105   1e-24
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   105   2e-24
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   105   2e-24
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   105   2e-24
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   105   2e-24
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   105   2e-24
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   105   3e-24
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   105   3e-24
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   104   4e-24
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   103   1e-23
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   103   1e-23
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   101   7e-23
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    99   5e-22
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    96   5e-21
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    87   5e-18
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    87   7e-18
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    86   1e-17
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    86   1e-17
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    85   2e-17
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    84   4e-17
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    83   1e-16
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    82   2e-16
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    82   3e-16
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    82   4e-16
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    81   4e-16
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    81   5e-16
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    81   6e-16
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    81   6e-16
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    81   7e-16
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    80   8e-16
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    80   9e-16
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    80   9e-16
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    80   1e-15
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    80   1e-15
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    79   2e-15
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    79   3e-15
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    78   6e-15
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    76   2e-14
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    75   4e-14
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    76   7e-14
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    74   7e-14
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    74   2e-13
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    73   2e-13
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    73   2e-13
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    74   3e-13
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    74   3e-13
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    72   4e-13
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    73   6e-13
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    72   7e-13
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    70   2e-12
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    71   2e-12
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    67   4e-11
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    67   5e-11
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    66   9e-11
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    65   1e-10
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    65   1e-10
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    64   2e-10
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    64   2e-10
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    65   2e-10
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    65   2e-10
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    65   2e-10
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    64   2e-10
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    64   2e-10
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    65   2e-10
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    64   3e-10
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    64   4e-10
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    64   4e-10
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    63   4e-10
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    63   4e-10
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    63   5e-10
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    63   6e-10
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    62   6e-10
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    63   6e-10
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    62   6e-10
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    63   6e-10
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    63   7e-10
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    62   7e-10
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    63   1e-09
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    62   1e-09
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    62   1e-09
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    62   1e-09
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    61   1e-09
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    62   1e-09
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    62   1e-09
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     62   2e-09
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    60   2e-09
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    60   3e-09
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    60   5e-09
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    60   6e-09
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    59   1e-08
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    56   1e-07
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    56   1e-07
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    55   3e-07
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    53   9e-07
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    50   7e-06
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    47   8e-05
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    47   8e-05
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    46   1e-04
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    45   3e-04
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    44   4e-04
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    44   4e-04
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    44   7e-04
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    44   9e-04
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    43   0.002
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    42   0.002
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    42   0.002
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    42   0.003
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    42   0.003
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    41   0.005
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    41   0.005
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    39   0.016
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    38   0.043
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    38   0.047
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    38   0.054
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    37   0.080
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    37   0.13 
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    35   0.45 
YNR023W Chr14 (670418..672118) [1701 bp, 566 aa] {ON}  SNF1273 k...    33   2.0  
KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {...    32   2.2  
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    32   3.3  
Suva_8.423 Chr8 (763701..764351) [651 bp, 216 aa] {ON} YOR367W (...    31   5.6  
KNAG0K01750 Chr11 (366717..367961) [1245 bp, 414 aa] {ON} Anc_3....    31   6.7  
KNAG0I02650 Chr9 complement(513892..520167) [6276 bp, 2091 aa] {...    31   9.1  

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/438 (100%), Positives = 438/438 (100%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF
Sbjct: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
           DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED
Sbjct: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF
Sbjct: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420
           NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420

Query: 421 EHGSDWCTKHRFGYQNWI 438
           EHGSDWCTKHRFGYQNWI
Sbjct: 421 EHGSDWCTKHRFGYQNWI 438

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/438 (90%), Positives = 408/438 (93%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           MET PIVIDNGSYEIKFGPSTN+KPFRALNALAKDKFGTSYLSNHIKNIKDISS+TFRRP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYC FNP EFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEYEFDSLFKSPVA FVPFTKSYK +M+ ISGKDED DIV   S+  +  S+  ++ Q  
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDS 180

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
            SDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLD+GGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 GSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           ETILVNNIKE+CLFVSPVSYFDSFK KDKHALEYVLPDFQTSFLGYVRN RKEN PL ED
Sbjct: 241 ETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPED 300

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQ ITLTDELFTIPETFFHPEI+QITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF
Sbjct: 301 AQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420
           NLPNFAQRLAAELQRQLPTDWTCHVSVPE DCALFGWEVMSQF+ T SYR ARVTREEYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYY 420

Query: 421 EHGSDWCTKHRFGYQNWI 438
           EHG DWCTKHRFGYQNWI
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/438 (89%), Positives = 403/438 (92%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME +PIVIDNGSYEIKF PSTNE PFRALNALAKDKFGTSYLSNHIKNIKDISS+TFRRP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYCFFNP EF GFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEYEFDSLFKSPVA FVPFTKSYK K+K ISGKDE+AD+V S S      S      Q  
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNS 180

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
           DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLD+GGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           ETILVNN+KEKCLFVSPVSYFDSFK KDKHALEYVLPDFQTSF+GYVRN R+ENSPL ED
Sbjct: 241 ETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPED 300

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQTI LTDELFTIPETFFHPEI+QITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF
Sbjct: 301 AQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420
           NLPNFAQRLAAELQRQLPTDWTCHVSVP  DCALFGWEVMSQF+ T SYR ARVTR+EYY
Sbjct: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYY 420

Query: 421 EHGSDWCTKHRFGYQNWI 438
           EHG DWCTK RFGYQNWI
Sbjct: 421 EHGPDWCTKQRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  806 bits (2083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/438 (86%), Positives = 402/438 (91%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME  PIVIDNGSYEIKFGPSTN+ PFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLTLWELESCIWDYC FNP EFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEYEFDSLFKSPVA FVPFTKSYK KM+ ISGKDEDAD+ +S S++    S  P D    
Sbjct: 121 EEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNS 180

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
           ++DYHDFQLVIDSGF+CTWIIPVLKGIPYYKAVKKLD+GGRFLTGLLKETLSFRHYNMMD
Sbjct: 181 NNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMD 240

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           ETILVNNIKEKCLFVSP SYFDSFK K+KH LEYVLPDFQTSF+GYVR+  +E+SPL  D
Sbjct: 241 ETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTD 300

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           AQ+ITLTDELFTIPETFFHPEI+QI KPGIVEAILESLSMLPEIVRPLM+GNIVCTGGNF
Sbjct: 301 AQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNF 360

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420
           NLPNFAQRLA ELQRQLPTDWTC+VSVPE DC LFGWEVMSQF+ T SY+ ARVTREEYY
Sbjct: 361 NLPNFAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYY 420

Query: 421 EHGSDWCTKHRFGYQNWI 438
           EHG DWCTKHRFGYQNWI
Sbjct: 421 EHGPDWCTKHRFGYQNWI 438

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/441 (65%), Positives = 356/441 (80%), Gaps = 5/441 (1%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           M++ P+V+DNGSYEIKFG S +E+P+RALN  A DK+G++YLSN +K I+++S VT RRP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WELESCIWDYC +NP EFDGF+L      HL+ SE CMTLPELSK+ DQVIF
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIF 120

Query: 121 EEYEFDSLFKSPVAAFVPF---TKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDT 177
           EEYEFDSLFK+P A ++PF       K  +  ISGK  D D++    N      N   D 
Sbjct: 121 EEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDK 180

Query: 178 QKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYN 237
           +KF +DY D++LVIDSGFNCTWIIP++KG+PYYKA+KKLD+GGRFLTGLLKETLSFRHY+
Sbjct: 181 KKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYD 240

Query: 238 MMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPL 297
           +MDET+LVNNIKEKCLFVSP SYFDSFK K++ ++EY+LPD  +S+LGY R  +  + PL
Sbjct: 241 LMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENK--SKPL 298

Query: 298 AEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
            E +Q + L DELF++PETFFHPEI++I KPGIVE ILESLSM+PEI+RPL+V NIVCTG
Sbjct: 299 PEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTG 358

Query: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTRE 417
           GNFNLP+FA RLAAELQRQLPTDWTC +SVP+ +C LF W+ M QF++T SY+  R+++E
Sbjct: 359 GNFNLPHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKE 418

Query: 418 EYYEHGSDWCTKHRFGYQNWI 438
           EYYEHG DW TKH+FGYQNW+
Sbjct: 419 EYYEHGPDWLTKHKFGYQNWL 439

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/438 (68%), Positives = 358/438 (81%), Gaps = 18/438 (4%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME++PI IDNGSYEIKFG +    P+RA+NA A DK+ T+YLSN IKNIKDI+SVTFRRP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WELES IWDY  FNP EF GFDL + KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEYEFDS +KS +A F+ F     +K+  ISGK E+ DI +   N+              
Sbjct: 121 EEYEFDSYYKSSIAGFIQFADDKNTKI--ISGKTEE-DISLDSVNQVR------------ 165

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
           + +Y+D+QLVIDSGFNCTWIIPV+KG+PYYKAVKKLD+GGRFL GLLKETLSFRHY++MD
Sbjct: 166 EKEYNDYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMD 225

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           ETILVNNIKE CLFVSP SYFDSFK K++ A+EYVLP+FQT+FLG+VR++ K   PL E+
Sbjct: 226 ETILVNNIKENCLFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK---PLPEN 282

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
            QTI L DELF++PETFFHPEIA+I KPG+VE ILESLSM+PE++RPL+VGN+VCTGGNF
Sbjct: 283 TQTIKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNF 342

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420
           NLP+FA RL +ELQRQLPTDW C  SVP  +C LFGW+ M+QF+ST SYR  RVTREEYY
Sbjct: 343 NLPHFATRLTSELQRQLPTDWICRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYY 402

Query: 421 EHGSDWCTKHRFGYQNWI 438
           EHG+DW TK+RFGYQNWI
Sbjct: 403 EHGTDWLTKNRFGYQNWI 420

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/440 (66%), Positives = 360/440 (81%), Gaps = 23/440 (5%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME+ P+V+DNGSYE+KFG ST  +PFRALNALA+DKFG +YLSN I  IKDISSV+F+RP
Sbjct: 1   MESEPLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HE GQLT WEL+SC+WDYCFFNP EFDGFDLK+ KG HL+ASE+CMTLPELSK+ DQV+F
Sbjct: 61  HEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGK-DEDADIVVSKSNEADMPSNNPRDTQK 179
           EEYEFDSL K+P++ F+PF+K +    K ISGK D ++    S++               
Sbjct: 121 EEYEFDSLLKAPISGFMPFSK-HTENTKVISGKGDSESGTSTSETK-------------- 165

Query: 180 FDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMM 239
              DY  FQ+VIDSGFNCTW++P++KG+P+YKAVKKLD+GGRF+ GLLKETLSFRHYN+M
Sbjct: 166 ---DYEPFQMVIDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVM 222

Query: 240 DETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAE 299
           DETILVNNIKEKCLF+SPVSYFDSF  KD+ A+EYVLPDFQT+FLGYV +R+   +P ++
Sbjct: 223 DETILVNNIKEKCLFMSPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVADRK---NPPSK 279

Query: 300 DAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGN 359
           DAQT+TL DELF++PETFFHPEIAQ+ KPGI+E ILESLS++PE +RPLMV NI+CTGGN
Sbjct: 280 DAQTVTLRDELFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGN 339

Query: 360 FNLPNFAQRLAAELQRQLPTDWTCHVSVPE-SDCALFGWEVMSQFSSTASYRNARVTREE 418
           FNLP+F +RLA ELQRQLPTDW+  + +P+   C L GW  MS F+ST  Y+ ARV+R+E
Sbjct: 340 FNLPHFPERLATELQRQLPTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQE 399

Query: 419 YYEHGSDWCTKHRFGYQNWI 438
           YYEHG +W TK+RFGYQNWI
Sbjct: 400 YYEHGVEWTTKNRFGYQNWI 419

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/438 (68%), Positives = 349/438 (79%), Gaps = 24/438 (5%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME+ PIV+DNGSYEIKFG    E P RA NALA+DKFG+ YLSN IK IKDISSV FRRP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HE GQLT WELES IWDYCFFNP EF+GFDLK+ KG HLV SE+CMT+PELSK+ DQV+F
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEYEF S+FKSP+A F PF +       AISGK +D     ++  E D            
Sbjct: 121 EEYEFASMFKSPIAGFAPFGRP----SIAISGKGDDQP---NRKAEPDA----------- 162

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
              Y  FQLVID GFNCTW++PV+KGIPYYKAVKKLD+GGRFL GLLKETLSFRHYN+MD
Sbjct: 163 ---YEPFQLVIDVGFNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 219

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           ETILVNNIKE CLFVSPVSYF+SFK K++ A+EYVLPDFQTSFLGYV++ +K   PL +D
Sbjct: 220 ETILVNNIKENCLFVSPVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDPKK---PLPQD 276

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +QT+ L DELF++PETFFHPEI Q+ KPGI+E ILESLS+LPE +RPLM+GNIVCTGGNF
Sbjct: 277 SQTVELKDELFSVPETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNF 336

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420
           NLPNFA RLA ELQRQLPTDWTC V +P     L+GW  M+ F+++  Y +ARVTREEY+
Sbjct: 337 NLPNFATRLATELQRQLPTDWTCTVHLPSGPKELYGWSSMASFTNSPLYSDARVTREEYF 396

Query: 421 EHGSDWCTKHRFGYQNWI 438
           EHG DWCT+HRFGYQNW+
Sbjct: 397 EHGVDWCTRHRFGYQNWM 414

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/439 (67%), Positives = 354/439 (80%), Gaps = 13/439 (2%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME  PIVIDNGSYE+KFG S  + P RALNALAKDK+G  YLSN + NIKDISSVT RRP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQL  WELE  +WDYCFFNP EF  F+LKE KGHHLV SE+CMTLPELS + DQV+F
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEYEF+SLFKSPVA FVPF  + +  MK I GK +D           D+ SN   D+Q  
Sbjct: 121 EEYEFESLFKSPVAGFVPFL-NLQDNMKMICGKGDDV--------MGDLISN--MDSQNI 169

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
            + Y DF LVIDSGFNCTWIIP++KG+PYYKAVKK+++GGRFL GL KET+S+RHY++ D
Sbjct: 170 KNPYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTD 229

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           ETILVNNIKEKCLF+SP SY DSFK KD+++++YVLPDFQTSF+GYV++ +K NS L E+
Sbjct: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKD-KKSNSQLPEN 288

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +Q ITLTDELF++PET FHPE+A++ KPGIVE ILESLS++PE +RPL+V NIVC GGNF
Sbjct: 289 SQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNF 348

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFS-STASYRNARVTREEY 419
           N+PNF  RLA ELQRQLPTDW C++ +PE DC L GW+ MSQF+ +T  Y+ AR++REEY
Sbjct: 349 NMPNFGSRLATELQRQLPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEY 408

Query: 420 YEHGSDWCTKHRFGYQNWI 438
           YEHG+DW TK RFGYQNWI
Sbjct: 409 YEHGTDWTTKKRFGYQNWI 427

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/438 (65%), Positives = 347/438 (79%), Gaps = 18/438 (4%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME  P+VIDNGSY +KFGP++ E P+ ALNA+A DK+  SYLSN IK+IKDISSV+ +RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H LGQLT WE+++ IWDYC +NP EF+GF++ + K  HL+ SE+CMTLPEL K+ DQVIF
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEYEF SL KSPVA ++PF ++ K ++  I G+ +    V + S E              
Sbjct: 121 EEYEFGSLMKSPVAGYMPFLRNTKDQI--IIGERDTEPFVETPSTE-------------- 164

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
             +Y DFQLV+DSGFNCTWIIPV+KGIPYYKAVKKLD+GGRFL GLLKETLSFRHYN+MD
Sbjct: 165 --EYRDFQLVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMD 222

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           ETILVNNIKEKCLFVSP SYFDSFK KD  + EYVLPDFQTSFLGYVR   ++  PL ED
Sbjct: 223 ETILVNNIKEKCLFVSPASYFDSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPED 282

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +Q+ITL DELF +PETFFHPEI+QI KPG+VE ILESLSM+PE++RPLMV NI+C GGNF
Sbjct: 283 SQSITLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNF 342

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420
           NLP+FA R+A ELQRQLPTDW C +++ + +  L GW+ MS F+ST  Y+  RVTREEYY
Sbjct: 343 NLPHFASRVAKELQRQLPTDWKCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYY 402

Query: 421 EHGSDWCTKHRFGYQNWI 438
           EHG DWCTKHRFGYQNW+
Sbjct: 403 EHGIDWCTKHRFGYQNWV 420

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/447 (65%), Positives = 356/447 (79%), Gaps = 14/447 (3%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           M+  PIVIDNGSYEIKFG S +  PFRA+NA+AKDK+ T YLSN IK IKDISSV FRRP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           +ELGQLT WELES IWDYCF+NP EFDGF L++    HLV SE+C++LPE S++ D +IF
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDA---------DIVVSKSNEADMPS 171
           EEY + S++KSPVA F+PF    K  + +ISGK +D          + +V+      + S
Sbjct: 121 EEYNYGSIYKSPVAGFIPFADLTKDVI-SISGKADDDDDDNNAKFQEQLVTNDLNTYISS 179

Query: 172 NNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETL 231
             P  T+   ++Y DFQL+IDSGFNCTWIIPV+KGIPYYKA+KK+D+GGRFLTGLLKETL
Sbjct: 180 EEPSVTKT--AEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETL 237

Query: 232 SFRHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRR 291
           SFRHYN+ DETILVNNIKEKCLFV+P SY +SFK+K+K A+EYVLPDF T+F+GY+++  
Sbjct: 238 SFRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNS 297

Query: 292 KENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVG 351
           K  + L ++AQ ITL DELF++ ET FHPEI++I KPGI+E I+ESLSMLPE++RPLMV 
Sbjct: 298 K--TKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVN 355

Query: 352 NIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRN 411
           NIVC GGNFNLPNF++RL +ELQRQLPTDWT HV +P+ D  LFGW+ M+QFS T SYR 
Sbjct: 356 NIVCIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRK 415

Query: 412 ARVTREEYYEHGSDWCTKHRFGYQNWI 438
           AR+TREEY EHG +WCTKHRFGYQNWI
Sbjct: 416 ARITREEYMEHGVEWCTKHRFGYQNWI 442

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/438 (66%), Positives = 343/438 (78%), Gaps = 18/438 (4%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME APIVIDNGSYEIKFG +++ +PF ALN++AKDK+G  +LSN +++IKDISSVTF RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H+LGQL  WELES IWDYC FNP EFDG+ L   K  HL+ASESCMTLPELSK+ DQV+F
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEYE+DSLFK+PV  FVPF    +     I    EDAD+V S     D PS+N       
Sbjct: 121 EEYEYDSLFKAPVPVFVPFNA--EGDTTHILVAKEDADVVAS-----DHPSDN------- 166

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
             DY D++LVIDSGFNCTW++PV+KG+PYYKAVKKLD+GGRFL G L+E LSFRHYN+MD
Sbjct: 167 -KDYRDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 225

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           ETILVN+IKEKCLF+SP SYFDSF+ + K A EYVLPDF TSF GY+R   K    L ED
Sbjct: 226 ETILVNSIKEKCLFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLR---KPGQTLPED 282

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +QTI L DELF +PETFFHPEIA +  PGI+EAILES+SMLPE +RPL+VGN+V TGGNF
Sbjct: 283 SQTIILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNF 342

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420
           N+PNFA RLA ELQRQ PTDW+C VSVP  D  L+GW+ M +FS T +YR +RV+REEYY
Sbjct: 343 NIPNFASRLATELQRQCPTDWSCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYY 402

Query: 421 EHGSDWCTKHRFGYQNWI 438
           EHG DWCT  RFGYQ W+
Sbjct: 403 EHGVDWCTSKRFGYQAWL 420

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/439 (64%), Positives = 345/439 (78%), Gaps = 21/439 (4%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           M+  PI+IDNGSYE+KFGP+TN  PFRALNALA+DK+G  +LSN +  +KDIS+V FRRP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQLT WEL+SCIWDYC +NP EF+ +++   KG HLV SE CM++PELSK  DQV+F
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFN-WEIGNTKGKHLVLSEMCMSMPELSKGTDQVVF 119

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEYEF S FK PVA FVPF        +A+     + +++ +K +     S   +D+   
Sbjct: 120 EEYEFGSCFKGPVAGFVPFN------WQAL-----EHNMIYAKED-----SVYRKDSTGE 163

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
            ++Y+DFQLVIDSGFNCTW++P++KGIPYYKA+KKLD+GGRFL G LKETLSFRHYN+MD
Sbjct: 164 RNEYNDFQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMD 223

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           ETILVNNIKEKCLF+SPVSYF+SF+ K+    EYVLPDFQTSF GYV+ ++++   + ED
Sbjct: 224 ETILVNNIKEKCLFMSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQK---IPED 280

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +QTI L DELF+IPETFFHPEIA + KPGIVE ILES+SMLPE +RPLMV N V TGGNF
Sbjct: 281 SQTIKLYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNF 340

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPE-SDCALFGWEVMSQFSSTASYRNARVTREEY 419
           N+ NFA+RLA ELQRQ PTDW   VSVP  SD ALFGW+ M QFS T +Y+  RVTREEY
Sbjct: 341 NIRNFARRLATELQRQCPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEY 400

Query: 420 YEHGSDWCTKHRFGYQNWI 438
           YEHG DWCTK RFGYQ W+
Sbjct: 401 YEHGVDWCTKQRFGYQKWL 419

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/438 (63%), Positives = 330/438 (75%), Gaps = 18/438 (4%)

Query: 4   APIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHEL 63
            P VIDNGSYEIKFG +    PFRA N +AKDK+G SYLSNH+K I+DISS T RRPHEL
Sbjct: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61

Query: 64  GQLTLWELESCIWDYCFFNPIEFDGFDLKEG-KGHHLVASESCMTLPELSKHADQVIFEE 122
           GQL  WELE CIWDYC +NP EFDGF L +  +   L+ +E+C TLPELSK++DQV+FEE
Sbjct: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121

Query: 123 YEFDSLFKSPVAAFVPFTKSYKSK-MKAISGKDEDADIVVSKSNEADMPSNNPRDTQKFD 181
           YEF ++FKSP + F+PF     +K M+ + GKD                  N   T    
Sbjct: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAV---------------NTDYTTATT 166

Query: 182 SDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDE 241
            +Y DFQLVIDSGFNCTW++P++KG+P+YKA+KK+D+GGRFL GLLKETLSFRHYNMMDE
Sbjct: 167 KEYRDFQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDE 226

Query: 242 TILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDA 301
           TIL+NNIKEKCLFVSPVSYFDSFK K + A+EYVLPDFQTSFLGY+ +            
Sbjct: 227 TILLNNIKEKCLFVSPVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSV 286

Query: 302 QTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFN 361
           QTITLTDE F +PETFFHPE+A I KPG+VE ILE++SM+PE +RP++V NIVC GGNF 
Sbjct: 287 QTITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFK 346

Query: 362 LPNFAQRLAAELQRQLPTDWTCHVSVP-ESDCALFGWEVMSQFSSTASYRNARVTREEYY 420
           LP+ + RL +ELQRQLPTDWTC V+VP  SDC L  W  M+QFSST  Y+  RVTREEY 
Sbjct: 347 LPHMSSRLTSELQRQLPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYL 406

Query: 421 EHGSDWCTKHRFGYQNWI 438
           EHG+DWC+KHRF YQNWI
Sbjct: 407 EHGTDWCSKHRFTYQNWI 424

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/433 (61%), Positives = 338/433 (78%), Gaps = 18/433 (4%)

Query: 6   IVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHELGQ 65
           IVIDNGSY++KFG ++  +P  ALNALAKDK+G ++LSN ++NIKDISSV FRRPHELGQ
Sbjct: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66

Query: 66  LTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEF 125
           LT WELESCIWDYC +NP EF G D +  +  H+V SE+CMTLPELSK+ DQV+FEEYE 
Sbjct: 67  LTSWELESCIWDYCLYNPDEF-GIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEV 125

Query: 126 DSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKFDSDYH 185
           DSL+K+P AA++PF  +    +K ISGK +  ++ + +  EA               +Y+
Sbjct: 126 DSLYKAPTAAYIPFYTT-NENIKTISGKSDHGELDIEEKIEAG-------------KEYN 171

Query: 186 DFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETILV 245
           DF LVIDSGFNCTW+IP++KG+PYYKAVKKLDVGGRFL GLLKET+SFRHYN+MDE+ILV
Sbjct: 172 DFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILV 231

Query: 246 NNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTIT 305
           NNIKE+CL+V PVSYF++FK K K+ +++VLPDFQTSF GYVR+ +   + L ++AQ +T
Sbjct: 232 NNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPK---TALPDNAQILT 288

Query: 306 LTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNF 365
           LTDE F++PE FFHPEI+Q  KPGI+E +LES+ MLPE++RPLM  NIVC GGNFNLP F
Sbjct: 289 LTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGF 348

Query: 366 AQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSD 425
             RL +ELQRQLPTDW C   +   D +L GW  M++F+ T +Y+ ARVT+E+Y+EHG D
Sbjct: 349 TDRLVSELQRQLPTDWVCRAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLD 408

Query: 426 WCTKHRFGYQNWI 438
           W TK RFGYQNW+
Sbjct: 409 WTTKERFGYQNWV 421

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/438 (61%), Positives = 329/438 (75%), Gaps = 19/438 (4%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           ME +P++IDNGSYEIKFG  + ++P RALN++AKDK+G  +LSN +++IKDISSV F RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           HELGQL  WELE+ IWDYC FNP +F+G+ +   KG HL+ SESCMT+PELSK+ DQV+F
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEYEF+++FK+PV  FVPF    KS    +      A            P+ N       
Sbjct: 121 EEYEFETMFKAPVPVFVPFNTGKKSTHMLV------AKEDSEVEESEVAPAKN------- 167

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
              Y+DFQLVIDSGFNC+WI+PV+KG+PYYKAVKKLD+GGRFL G L+E LSFRHYN+MD
Sbjct: 168 ---YNDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMD 224

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           ETILVN+IKE CLF+SP +YF+SF+ + K A EYVLPDF TSF GY+R   K    L  +
Sbjct: 225 ETILVNSIKENCLFMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLR---KPGQVLPAE 281

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +QTI L DELF +PETFFHPEIA +   GIVE ILES+SMLPE +RPLMVGNIV TGGNF
Sbjct: 282 SQTIVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNF 341

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYY 420
           N+PNFA RLA ELQRQ PTDW+C VS+P+ D  L+GW+ M +FS T  Y  +RVTR+EYY
Sbjct: 342 NIPNFASRLATELQRQCPTDWSCRVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYY 401

Query: 421 EHGSDWCTKHRFGYQNWI 438
           EHG DWCT  RFGYQ W+
Sbjct: 402 EHGVDWCTAKRFGYQAWL 419

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/435 (61%), Positives = 327/435 (75%), Gaps = 26/435 (5%)

Query: 4   APIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHEL 63
            PI+IDNGSYEIKFGPS+ + P+RALN LA+DK+G  +LSN +K I+++S+   RRP EL
Sbjct: 3   VPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFEL 62

Query: 64  GQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEY 123
           GQL  WELE  IWDYC FN  EF  +DLK+ K   L+ SE+CM++PE+SKH DQV+FEEY
Sbjct: 63  GQLVSWELEEHIWDYCLFNSDEF-SWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121

Query: 124 EFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKFDSD 183
           EF SL K PVA ++PF              D  AD  V  S+   +P    +D      D
Sbjct: 122 EFGSLMKCPVAQYIPF--------------DNMADYKVYGSD--GLPVVRKKD------D 159

Query: 184 YHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI 243
           Y+DFQLV+DSGFNCTW+IPV+KG+PYYKAVKKLD+GGRFLTGLLKET+SFRHYN+MDETI
Sbjct: 160 YNDFQLVVDSGFNCTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETI 219

Query: 244 LVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQT 303
           L NNIKE+C F+ PVSYFDSF+ K +  ++YVLPDFQTS +GYVR  ++    + ED+QT
Sbjct: 220 LANNIKEQCCFMPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQA---IPEDSQT 276

Query: 304 ITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLP 363
           + L DELFTIPETFFHPEIA I KPG++E +LES+SMLPE++RPLMV NI   GGNFN+ 
Sbjct: 277 LNLEDELFTIPETFFHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNIS 336

Query: 364 NFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHG 423
           NFA RLA ELQRQ PTDW+  V +P+ D  L GW+ M +FS+T SY+  RVTR EY EHG
Sbjct: 337 NFASRLATELQRQCPTDWSVRVHLPKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHG 396

Query: 424 SDWCTKHRFGYQNWI 438
            DWCTK+RFGY+ WI
Sbjct: 397 VDWCTKYRFGYEQWI 411

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/435 (58%), Positives = 321/435 (73%), Gaps = 27/435 (6%)

Query: 4   APIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHEL 63
            P++++NGSYEIKFGP+  E P+RA N L +D++G  +LSN +  I+DIS    RRP EL
Sbjct: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62

Query: 64  GQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEY 123
           GQL  WELE  IWDYC FNP EF G++LK+ K   L+ASE+CMT+PE+SK+ DQV+FEEY
Sbjct: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121

Query: 124 EFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKFDSD 183
           EF S+ K PVA FVPF ++             D DIV       +  S            
Sbjct: 122 EFGSMMKCPVAQFVPFDRA------------RDYDIVGGAGEVVEAKSG----------- 158

Query: 184 YHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI 243
           Y++FQLV+DSGFNCTW++PV+KG+PYYKA KKLD+GGRFL GLLKET+SFRHYN+MDETI
Sbjct: 159 YNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETI 218

Query: 244 LVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQT 303
           L+NNIKE+C F+ PVSYFDSF+ K++  +EY+LPDFQTS +GYVR  ++    + + +Q 
Sbjct: 219 LINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQ---AIPKTSQI 275

Query: 304 ITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLP 363
           + L DELFT+PETFFHPEI+ I KPG+VE ILE +SM+PE++RPL+V NIV  GGNFN+ 
Sbjct: 276 LRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIA 335

Query: 364 NFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHG 423
           NFA RLA ELQRQ PTDW   V  P+ D AL GW+ M QFS T SY+N+RVTR EY EHG
Sbjct: 336 NFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395

Query: 424 SDWCTKHRFGYQNWI 438
           +DWCTKHRFGY+ WI
Sbjct: 396 ADWCTKHRFGYEQWI 410

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/442 (59%), Positives = 324/442 (73%), Gaps = 31/442 (7%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           M    +VIDNGSYEIKFG S  ++P RALN L KDK+   +LSN  K ++DIS    RRP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDL---KEGKGHHLVASESCMTLPELSKHADQ 117
           HELGQL  WELES +WDYCF+N  +F  ++L    + K HHLV SE+ MT+PELSK+ DQ
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119

Query: 118 VIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDT 177
           VIFEEY+F S+FK PVA ++PF +          G+ +D  +  ++  +           
Sbjct: 120 VIFEEYDFKSMFKGPVAQYIPFYQ----------GQYQDDAMTAAEDKKT---------- 159

Query: 178 QKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYN 237
               S Y DFQLVIDSGFNCTW +P++KG+PYYKA+KKLD+GGRFLTGLL+ET+SFRHYN
Sbjct: 160 ----SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN 215

Query: 238 MMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPL 297
           +M+ETILVNNIKE+C FV P SYF SF  K    +EYVLPDFQTSFLGYV+   KE   L
Sbjct: 216 VMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEK--L 273

Query: 298 AEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
            +DAQT+ LTDE+F++PETFFHPEIAQI KPGIVE ILE ++M PE+VRPL+V NIVCTG
Sbjct: 274 TDDAQTLLLTDEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTG 333

Query: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVP-ESDCALFGWEVMSQFSSTASYRNARVTR 416
           GNFN+PNF +RL  ELQRQ P DW+C V  P E D +L GWE M  F+++  +R+ARVTR
Sbjct: 334 GNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTR 393

Query: 417 EEYYEHGSDWCTKHRFGYQNWI 438
           EEY EHG DWCTK+RFGYQ W+
Sbjct: 394 EEYLEHGLDWCTKNRFGYQQWL 415

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/440 (58%), Positives = 329/440 (74%), Gaps = 21/440 (4%)

Query: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60
           M  AP++IDNGSYEIKFG S  E PF ALNALAKDK+ T YLSN I NIKDISSV+ +RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIF 120
           H+LGQL  WELE  IWDYCF+N  +F GF++ E   +HLV +E+ MTLPELS++ DQV+F
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVF 120

Query: 121 EEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKF 180
           EEY FDSL+K+P A F+PF K+  +    +SGK                 S    D  K 
Sbjct: 121 EEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGK-----------------SKTYLDGSK- 162

Query: 181 DSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMD 240
           +++Y DF LVIDSG+NC+WIIP++KG+PYYKAVKK+D+GGRFL GLLKET+S+RHY++ D
Sbjct: 163 ENNYQDFNLVIDSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTD 222

Query: 241 ETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
           E++LVNNIKE C+F+SPVSY +SFK K    +EYVLPDFQTSF+GYVR+ +K +S L E 
Sbjct: 223 ESMLVNNIKENCMFISPVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKK-HSTLPEH 281

Query: 301 AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNF 360
           +Q+I L DELF++PE FFHPE+A + KPGI+E ILESL +LPE +R LMV NIVCTGGNF
Sbjct: 282 SQSIILEDELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNF 341

Query: 361 NLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTAS--YRNARVTREE 418
           N+PNF  R+  ELQ+Q+ T+W C VS+P+++  L  W+ M  F+      Y++ RVT++E
Sbjct: 342 NIPNFGSRIYTELQKQVQTEWVCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQE 401

Query: 419 YYEHGSDWCTKHRFGYQNWI 438
           Y EHG +W TK RFGYQNW+
Sbjct: 402 YNEHGFEWTTKQRFGYQNWL 421

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  106 bits (265), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 106/436 (24%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP I  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  106 bits (265), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 105/436 (24%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMEVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/436 (24%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/436 (24%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/436 (24%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/436 (24%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 105/436 (24%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (263), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 105/436 (24%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (263), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 105/436 (24%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (263), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 105/436 (24%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 104/436 (23%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   G+ +    S+      VR  
Sbjct: 233 SSSVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKD 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  105 bits (262), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 105/436 (24%), Positives = 174/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTASQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG+   P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGSTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  105 bits (261), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 104/436 (23%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQILFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  105 bits (261), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 104/436 (23%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 63

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 64  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 115

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 116 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 151

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + 
Sbjct: 152 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKI 193

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 194 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 233

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 234 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKE 293

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 294 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 351

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 352 TFQQMWISKQEYDESG 367

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  104 bits (260), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 104/436 (23%), Positives = 172/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G      + ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  103 bits (257), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 103/436 (23%), Positives = 173/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKN 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQILFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           L+ R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LAERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTASQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSAVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  103 bits (256), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 103/436 (23%), Positives = 172/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 115 NREKMTQILFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G      + ++D+ GR +T  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 233 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKE 292

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 293 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 350

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 351 TFQQMWISKQEYDESG 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  101 bits (251), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 102/436 (23%), Positives = 171/436 (39%), Gaps = 87/436 (19%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +        Y+ +  ++ +
Sbjct: 5   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDCYVGDEAQSKR 63

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 64  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 115

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++          SG+                 
Sbjct: 116 NREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG-------------- 151

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G     A+ ++D+ GR +T  L + 
Sbjct: 152 ------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKI 193

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  D+        +
Sbjct: 194 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDYDQEMQTAAQ 233

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+      VR  
Sbjct: 234 SSAIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKE 293

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTA 407
           + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  W   S  +S  
Sbjct: 294 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 351

Query: 408 SYRNARVTREEYYEHG 423
           +++   ++++EY E G
Sbjct: 352 TFQQMWISKQEYDESG 367

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 98.6 bits (244), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 91/387 (23%), Positives = 156/387 (40%), Gaps = 75/387 (19%)

Query: 40  SYLSNHIKNIKDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHL 99
           SY+ +  ++ + I  +T R P E G +T W+    IW + F+N +          + H +
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPV 88

Query: 100 VASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADI 159
           + +E+ M      +   Q++FE +   + + S  A    ++          SG+      
Sbjct: 89  LLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYS----------SGRTTG--- 135

Query: 160 VVSKSNEADMPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVG 219
                                        +V+DSG   T ++P+  G     A+ ++D+ 
Sbjct: 136 -----------------------------IVLDSGDGVTHVVPIYAGFSLPHAILRIDLA 166

Query: 220 GRFLTGLLKETLSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLP 277
           GR LT  L + LS R Y+     E  +V +IKEK                    L YV  
Sbjct: 167 GRDLTDYLMKILSERGYSFSTTAEREIVRDIKEK--------------------LCYVAL 206

Query: 278 DFQTSFLGYVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILES 337
           DF+       ++   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S
Sbjct: 207 DFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNS 266

Query: 338 LSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFG 396
           +      VR  + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  
Sbjct: 267 IMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV-- 324

Query: 397 WEVMSQFSSTASYRNARVTREEYYEHG 423
           W   S  +S  +++   ++++EY E G
Sbjct: 325 WIGGSILASLTTFQQMWISKQEYDESG 351

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 95.5 bits (236), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 89/387 (22%), Positives = 155/387 (40%), Gaps = 75/387 (19%)

Query: 40  SYLSNHIKNIKDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHL 99
           SY+ +  ++ + I  +T R P E G +T W+    IW + F+N +          + H +
Sbjct: 37  SYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPV 88

Query: 100 VASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADI 159
           + +E+ M      +   Q++FE +   + + S  A    ++          SG+      
Sbjct: 89  LLTEAPMNPKSNREKMTQILFETFNVPAFYVSIQAVLSLYS----------SGRTTG--- 135

Query: 160 VVSKSNEADMPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVG 219
                                        +V+DSG   T ++P+  G      + ++D+ 
Sbjct: 136 -----------------------------IVLDSGDGVTHVVPIYAGFSLPHGILRIDLA 166

Query: 220 GRFLTGLLKETLSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLP 277
           GR +T  L + LS R Y+     E  +V +IKEK                    L YV  
Sbjct: 167 GRDMTDYLMKILSERGYSFSTTAEREIVRDIKEK--------------------LCYVAL 206

Query: 278 DFQTSFLGYVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILES 337
           DF+       ++   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S
Sbjct: 207 DFEQEMQTAAQSSAIEKSYELPDGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNS 266

Query: 338 LSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFG 396
           +      VR  + GNIV +GG    P  A+R+  E+    P+      ++ PE   ++  
Sbjct: 267 IMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV-- 324

Query: 397 WEVMSQFSSTASYRNARVTREEYYEHG 423
           W   S  +S  +++   ++++EY E G
Sbjct: 325 WIGGSILASLTTFQQMWISKQEYDESG 351

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 89/391 (22%), Positives = 149/391 (38%), Gaps = 92/391 (23%)

Query: 4   APIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKN 48
           +PIV+D G+  +K G           PS   +P   L A  +    T      + +   +
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERANITTPLRDIMIGDEASD 62

Query: 49  IKDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTL 108
           ++    +++  P E G +  W     +WDY FFN ++     L    G  ++ +E  M  
Sbjct: 63  VRSYLQISY--PMENGIIKNWTDMELLWDYAFFNQMK-----LNNTSGGKILLTEPPMNP 115

Query: 109 PELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEAD 168
            +  +   +V+FE+Y+F  ++ +  A    + +   S                       
Sbjct: 116 LKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 MPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLK 228
                               +V+DSG   T I+PV + +      ++LDV GR +T  L 
Sbjct: 154 --------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLI 193

Query: 229 ETLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFL 284
           + LS R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD      
Sbjct: 194 DLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD------ 247

Query: 285 GYVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEI 344
                            +TI +  E F  PE  F P +  + +PG+ E +  ++      
Sbjct: 248 ----------------GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVD 291

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           VR  +   IV +GG+   P    RL  EL++
Sbjct: 292 VRSALYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 86.7 bits (213), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 89/391 (22%), Positives = 147/391 (37%), Gaps = 92/391 (23%)

Query: 4   APIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKN 48
           +PIV+D G+  +K G           PS   +P   L A  +    T      + +    
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERGTISTPLKDIMIGDEASE 62

Query: 49  IKDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTL 108
           ++    +++  P E G +  W     +WDY FFN ++     L    G  ++ +E  M  
Sbjct: 63  VRSYLQISY--PMENGIIKNWTDMELLWDYAFFNQMK-----LPTTSGGKVLLTEPPMNP 115

Query: 109 PELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEAD 168
            +  +   +V+FE Y+F  ++ +  A    + +   S                       
Sbjct: 116 VKNRERMCEVMFERYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 MPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLK 228
                               +V+DSG   T I+PV + +      ++LDV GR +T  L 
Sbjct: 154 --------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLI 193

Query: 229 ETLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFL 284
           + LS R Y  N   +   V  IKEK  +VS     D+   ++   L  EY LPD      
Sbjct: 194 DLLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLVQEYELPD------ 247

Query: 285 GYVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEI 344
                            + I +  E F  PE  F P++  +  PG+ E +  ++      
Sbjct: 248 ----------------GRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADID 291

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           VR  +   IV +GG+   P    RL  EL++
Sbjct: 292 VRSSLYKAIVLSGGSSMYPGLPSRLERELKQ 322

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 102/442 (23%), Positives = 174/442 (39%), Gaps = 88/442 (19%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK G S  EKP    +  +  +  +K       G +++ N  + ++ +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 55  VTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +  W     IW Y F   ++     L+  + H ++ +E+ +      + 
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSYVFNKSLQ-----LQNVEDHPILITEAPLNPRNNRER 121

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
             +++FE +   +L+ S  A    +           SG+                     
Sbjct: 122 MCELLFESFNVPALYVSIQAVLSLYA----------SGRTTGC----------------- 154

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++D+ GR    FL  LL++T
Sbjct: 155 ---------------VVDCGDGCCHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKT 199

Query: 231 LSFRHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNR 290
                 +  +  + V  IKEK  +V+          KD H  E    +F  +      N 
Sbjct: 200 TGVSLLSSSEREV-VRIIKEKACYVA----------KDPHIEEQ---NFSIN-----PNY 240

Query: 291 RKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMV 350
            K   P   D +TI L  E F  PE  F PE+       + +   +S+  +   +R L+ 
Sbjct: 241 TKFKLP---DGKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLF 297

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYR 410
            N++ +GG   LP F  RL +EL+    +     +  P  +     W   S  S  ++++
Sbjct: 298 SNVLLSGGTSILPGFGDRLLSELKSLSDSQTKIKIFAP-PERKYSTWIGGSILSGLSTFK 356

Query: 411 NARVTREEYYEHGSDWCTKHRF 432
              VTR E +E  +D C   RF
Sbjct: 357 KLWVTRAE-WEEAAD-CIHSRF 376

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 97/452 (21%), Positives = 176/452 (38%), Gaps = 108/452 (23%)

Query: 5   PIVIDNGSYEIKFGPSTNEKPF----------RALNALAKDKFGTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK G S  E+P           +    +A    G  ++ N  + ++ +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL-- 68

Query: 55  VTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +  W     IW++ F   ++ +  +      H ++A+E+ +   +  + 
Sbjct: 69  LKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLNNIE-----EHPVLATEAPLNPLKNREA 123

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
             +++FE +   +++ S  A    +           SG+                     
Sbjct: 124 MCEMLFETFNVPAVYVSIQAVLSLYA----------SGRTTGC----------------- 156

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++DV GR    FL  LL++T
Sbjct: 157 ---------------VLDCGDGCCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKT 201

Query: 231 LSFRHYNMMDETILVNNIKEKCLFVS--PVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
                 +  +  I V  IKEK  +V+  P++   ++ +     + + LP           
Sbjct: 202 TGVSLLSSSEREI-VRIIKEKACYVARDPLTEEQTYHLTPTSTI-FKLP----------- 248

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
                      D + + L +E F  PE  F P++       I E   +S+S +   +RP 
Sbjct: 249 -----------DGKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPA 297

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFG--------WEVM 400
           ++ NIV +GG    P F  RL  EL+         ++S P++   +F         W   
Sbjct: 298 LLSNIVLSGGTTMFPGFGDRLLTELR---------NLSEPQTKIKIFAPPERKYSTWIGG 348

Query: 401 SQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
           S  S  ++++   VT+ E+ E+    C   RF
Sbjct: 349 SILSGLSTFKKIWVTKSEWQENPD--CVHSRF 378

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 87/386 (22%), Positives = 143/386 (37%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        +N +  +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASAVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY F+     D   L    G  ++ +E  M      +
Sbjct: 66  YLQISYPMENGVIKNWSDMELLWDYAFY-----DQMKLPSTSGGKVMLTEPPMNPLRNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173
              +V+FE+Y+F  ++ +  A    + +   S                            
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG--------------------------- 153

Query: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LDV GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYVRN 289
           R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD           
Sbjct: 199 RGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD----------- 247

Query: 290 RRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLM 349
                       + I +  E F  PE  F P +  + +PG+ E +  ++      VR  +
Sbjct: 248 -----------GRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSAL 296

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375
              IV +GG+   P    RL  EL++
Sbjct: 297 YRAIVLSGGSSMYPGLPSRLEKELKQ 322

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 87/391 (22%), Positives = 149/391 (38%), Gaps = 92/391 (23%)

Query: 4   APIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKN 48
           +PIV+D G+  +K G           PS   +P   L A  +    T      +     +
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERGSISTPLKDIMIGEEASD 62

Query: 49  IKDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTL 108
           ++    +++  P E G +  W+    +WDY F+N ++F         G  ++ +E  M  
Sbjct: 63  VRSYLQISY--PMENGIIRNWQDMEHLWDYAFYNQMKF-----PSTSGGKILLTEPPMNP 115

Query: 109 PELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEAD 168
            +  +   +V+FE+Y+F  ++ +  A    + +   S                       
Sbjct: 116 LKNRELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 MPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLK 228
                               +V+DSG   T I+PV + +      ++LDV GR +T  L 
Sbjct: 154 --------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLI 193

Query: 229 ETLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFL 284
           + LS R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD      
Sbjct: 194 DLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLVENYELPD------ 247

Query: 285 GYVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEI 344
                            + I +  E F  PE  F P++  + +PGI E +  ++      
Sbjct: 248 ----------------GRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVD 291

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +R  +   IV +GG+   P    RL  EL++
Sbjct: 292 IRSSLYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 88/388 (22%), Positives = 146/388 (37%), Gaps = 88/388 (22%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNEKP-FRALNALAKDK-FGTSYLSNHIKNIKD 51
           PIV+D G+  +K G           PS   +P  RA      +K      + +   +++ 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVRS 65

Query: 52  ISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPEL 111
              +++  P E G +  W     +WDY FFN ++     L    G  ++ +E  M   + 
Sbjct: 66  YLQISY--PMENGIIKNWTDMELLWDYAFFNQMQ-----LPTTSGGKILLTEPPMNPVKN 118

Query: 112 SKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPS 171
            +   +V+FE+Y+F  ++ +  A    + +   S                          
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------------- 153

Query: 172 NNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETL 231
                            +V+DSG   T I+PV + +      ++LDV GR +T  L + L
Sbjct: 154 -----------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLL 196

Query: 232 SFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYV 287
           S R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD         
Sbjct: 197 SRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD--------- 247

Query: 288 RNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRP 347
                         + I +  E F  PE  F P +  + + GI E +  ++      VR 
Sbjct: 248 -------------GRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRS 294

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQR 375
            +   IV +GG+   P    RL  EL++
Sbjct: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 87/387 (22%), Positives = 146/387 (37%), Gaps = 84/387 (21%)

Query: 4   APIVIDNGSYEIKFGPSTNEKP-FRALNALAKDKFGTSYLSNHIKNIKDI---------- 52
           +PIV+D G+  +K G +    P +   + + +        +N    +KDI          
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVR 64

Query: 53  SSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELS 112
           S +    P E G +  W     +WDY FF  ++     L       ++ +E  M   +  
Sbjct: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMK-----LPTTSNGKILLTEPPMNPTKNR 119

Query: 113 KHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSN 172
           +   +V+FE+Y+F  ++ +  A    + +   S                           
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------------- 153

Query: 173 NPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLS 232
                           +V+DSG   T I+PV + +      ++LDV GR +T  L + LS
Sbjct: 154 ----------------VVVDSGDGVTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLS 197

Query: 233 FRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYVR 288
            R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD          
Sbjct: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD---------- 247

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
                        +TI +  E F  PE  F P +  + +PG+ E + +++      VR  
Sbjct: 248 ------------GRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSA 295

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQR 375
           +   IV +GG+   P    RL  EL++
Sbjct: 296 LYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 86/390 (22%), Positives = 145/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASITTPLKDIMIGDEASDV 63

Query: 50  KDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLP 109
           +    +++  P E G +  W     +WDY F+  ++     L    G  ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWADMELLWDYAFYEQMK-----LPSTSGGKVLLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADM 169
              +   +V+FE+Y+F  ++ +  A    + +   S                        
Sbjct: 117 RNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG----------------------- 153

Query: 170 PSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKE 229
                              +V+DSG   T I+PV + +      K+LDV GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD       
Sbjct: 195 LLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVENYELPD------- 247

Query: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV 345
                           + I +  E F  PE  F P +  + +PG+ E +  ++      V
Sbjct: 248 ---------------GRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDV 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   +V +GG+   P    RL  EL++
Sbjct: 293 RTALYRAVVLSGGSSMYPGLPSRLEKELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 87/390 (22%), Positives = 146/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +    +
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASVATPLKDIMIGDEASEV 63

Query: 50  KDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLP 109
           +    +++  P E G +  W     +WDY FF  ++     L       ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFFEQMK-----LPSTSNGKILLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADM 169
           +  +   +V+FE+Y+F  ++ +  A    + +   S                        
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG----------------------- 153

Query: 170 PSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKE 229
                              +V+DSG   T I+PV + +      ++LDV GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKEK  +VS     D+   ++  AL   Y LPD       
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPD------- 247

Query: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV 345
                           +TI +  E F  PE  F P +  + +PG+ E +  ++      +
Sbjct: 248 ---------------GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDI 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    RL  EL++
Sbjct: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 87/390 (22%), Positives = 147/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASVTTPLKDIMIGDEASDV 63

Query: 50  KDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLP 109
           +    +++  P E G +  W     +WDY FF  ++     L       ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFFEQMK-----LPSTSNGKILLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADM 169
           +  +   +V+FE+Y+F  ++ +  A    + +   S                        
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG----------------------- 153

Query: 170 PSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKE 229
                              +V+DSG   T I+PV + +      ++LDV GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKEK  +VS     D+   ++  AL   Y LPD       
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPD------- 247

Query: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV 345
                           +TI +  E F  PE  F P +  + +PG+ E +  ++      +
Sbjct: 248 ---------------GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDI 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    RL  EL++
Sbjct: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 98/442 (22%), Positives = 167/442 (37%), Gaps = 88/442 (19%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP----------FRALNALAKDKFGTSYLSNHIKNIKDISS 54
           P+V+DNGS  IK G S  EKP           +    +A    G +++ N  + ++ +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 55  VTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +T W     +W Y F   ++     L+  + H  + +E+ +   +  + 
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGYVFNKSLQ-----LQNVEDHPNLVTEAPLNPHKNREK 149

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
             +++FE +   +L+ S  A    +           SG+                     
Sbjct: 150 MCELLFESFNVPALYVSVQAVLSLYA----------SGRTTGC----------------- 182

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGR----FLTGLLKET 230
                          V+D G  C   +PV  G     +++++D+ GR    FL  LL++T
Sbjct: 183 ---------------VVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKT 227

Query: 231 LSFRHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNR 290
                 +  +  I V  IKEK  FV+          KD    E   P    SF  +    
Sbjct: 228 TGVSLLSSSEREI-VRTIKEKACFVT----------KDPKLEEQNFP-MNPSFSKFK--- 272

Query: 291 RKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMV 350
                    D +TI L  E +  PE  F PE+       + +   +S+  +   +R L+ 
Sbjct: 273 -------LPDGKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLY 325

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYR 410
            NI+ +GG   LP F  RL  EL+    +     +  P  +     W   S  S  ++++
Sbjct: 326 SNILLSGGTSMLPGFGDRLLKELKSLSGSRTKIKIFAP-PERKYSTWIGGSILSGLSTFK 384

Query: 411 NARVTREEYYEHGSDWCTKHRF 432
              VT+ E+ E     C   RF
Sbjct: 385 KLWVTKSEWEEFPD--CIHSRF 404

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 86/390 (22%), Positives = 147/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASVTTPLKDIMIGDEASDV 63

Query: 50  KDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLP 109
           +    +++  P E G +  W     +WDY FF  ++     L+      ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFFEQMK-----LQSTSNGKILLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADM 169
           +  +   +V+FE+Y+F  ++ +  A    + +   S                        
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG----------------------- 153

Query: 170 PSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKE 229
                              +V+DSG   T I+PV + +      ++LDV GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD       
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD------- 247

Query: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV 345
                           +TI +  E F  PE  F P +  + +PG+ E +  ++      +
Sbjct: 248 ---------------GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDI 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    RL  EL++
Sbjct: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 80.9 bits (198), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 88/389 (22%), Positives = 145/389 (37%), Gaps = 86/389 (22%)

Query: 4   APIVIDNGSYEIKFGPSTNEKP---FRALNALAKDKFGTSYLSNHIKNIKDI-------- 52
           +PIV+D G+  +K G +    P   F ++      +       +    IKDI        
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASD 64

Query: 53  --SSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
             S +    P E G +  W     +WD+ FF  ++     L    G  ++ +E  M   +
Sbjct: 65  VRSYLQISYPMENGIIKHWTDMELLWDHAFFEKMK-----LPSTSGGKILLTEPPMNPLK 119

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   QV+FE+Y+F  ++ +  A    + +   S                         
Sbjct: 120 NREMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------------ 155

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T I+PV + +      ++LDV GR +T  L + 
Sbjct: 156 ------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDL 197

Query: 231 LSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGY 286
           LS R Y  N   +   V  IKEK  +VS    FD+   ++   L   Y LPD        
Sbjct: 198 LSRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLARETTTLVENYELPD-------- 249

Query: 287 VRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVR 346
                          + I +  E F  PE  F P +  + +PG+ E +  ++      +R
Sbjct: 250 --------------GRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIR 295

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
             +   IV +GG+   P    RL  EL++
Sbjct: 296 SSLYKAIVLSGGSSMYPGLPSRLEKELKQ 324

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 80.9 bits (198), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 86/386 (22%), Positives = 141/386 (36%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKN-IKDI----------S 53
           PIV+D G+  +K G +    P     ++       +    H    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY FF  ++     L    G  ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIRNWADMELLWDYAFFEQMK-----LPTTSGGKVLLTEPPMNPIKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173
              +V+FE+Y+F   + +  A    + +   S                            
Sbjct: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSG--------------------------- 153

Query: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LDV GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYVRN 289
           R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD           
Sbjct: 199 RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD----------- 247

Query: 290 RRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLM 349
                       + I +  E F  PE  F P +  + +PG+ E +  ++      +R  +
Sbjct: 248 -----------GRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSL 296

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375
              IV +GG+   P    RL  EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 86/390 (22%), Positives = 146/390 (37%), Gaps = 92/390 (23%)

Query: 5   PIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKNI 49
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASVATPLKDIMIGDEASDV 63

Query: 50  KDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLP 109
           +    +++  P E G +  W     +WDY FF  ++     L       ++ +E  M   
Sbjct: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFFEQMK-----LPSTSNGKILLTEPPMNPL 116

Query: 110 ELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADM 169
           +  +   +V+FE+Y+F  ++ +  A    + +   S                        
Sbjct: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG----------------------- 153

Query: 170 PSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKE 229
                              +V+DSG   T I+PV + +      ++LDV GR +T  L +
Sbjct: 154 -------------------VVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLID 194

Query: 230 TLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLG 285
            LS R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD       
Sbjct: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLVESYELPD------- 247

Query: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV 345
                           +TI +  E F  PE  F P +  + +PG+ E +  ++      +
Sbjct: 248 ---------------GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDI 292

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           R  +   IV +GG+   P    RL  EL++
Sbjct: 293 RSSLYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 80.5 bits (197), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 84/389 (21%), Positives = 143/389 (36%), Gaps = 88/389 (22%)

Query: 4   APIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKN 48
            PIV+D G+  +K G           PS   +P   L A  +    T      + +   N
Sbjct: 5   VPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAGERSNISTPLKDIMIGDEASN 62

Query: 49  IKDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTL 108
           ++    +++  P E G +  W     +WDY F+     D   +    GH ++ +E  M  
Sbjct: 63  VRSYLQISY--PMENGIIKNWADMEQLWDYAFY-----DQMKIPSTAGHKVLLTEPPMNP 115

Query: 109 PELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEAD 168
            +  +   +V+FE+Y+F  ++ +  A    + +   S                       
Sbjct: 116 LKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 MPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLK 228
                               +V+DSG   T I+PV + +      ++LDV GR +T  L 
Sbjct: 154 --------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLI 193

Query: 229 ETLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGY 286
           + LS R Y  N   +   V  IKEK  +VS   Y      K  H    ++  ++      
Sbjct: 194 DLLSRRGYAFNKTADFETVRQIKEKLCYVS---YDLDLDTKLAHETTTLVETYELP---- 246

Query: 287 VRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVR 346
                        D + I +  E F  PE  F P +  + + GI E +  ++      + 
Sbjct: 247 -------------DGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDII 293

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
             +   IV +GG+   P    RL  EL++
Sbjct: 294 SALYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 101/444 (22%), Positives = 169/444 (38%), Gaps = 91/444 (20%)

Query: 3   TAPIVIDNGSYEIKFGPSTNEKP-FRALNALAKDKFG--------TSYLSNHIKNIKDIS 53
           + P+V+DNGS  +K G S  ++P F   + +   + G         +++ N  +  + I 
Sbjct: 10  SQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI- 68

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P + G +  W     IWDY F      D   LK+   H ++ +E+ +       
Sbjct: 69  -LQLRHPVDHGVVKNWNDMELIWDYMFK-----DKLKLKDVDEHPVLITEAPLNPVSNRD 122

Query: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173
               ++FE +   +L+ +  A    +          ISG                     
Sbjct: 123 EMCDLLFESFGVQALYVANPAVLSLYASG------KISG--------------------- 155

Query: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233
                           V+D G   +  +PV +G     A+K++D+GGR LT  L+  L  
Sbjct: 156 ---------------CVLDCGDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQ--LQL 198

Query: 234 RHYNMMDETI-----LVNNIKEKCLFVSPVSYFDSFKVK---DKHALEYVLPDFQTSFLG 285
           R    +  T      LV  IKEK  +V+     +  K     D+  L++ LPD       
Sbjct: 199 RKSTGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKCNYEGDQVGLKFKLPD------- 251

Query: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV 345
                           + ITL+ + F +PE  F P +       I E I +S+S L   +
Sbjct: 252 ---------------GKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDL 296

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSS 405
           RP M  +I+ +GG   L  F  RL  EL +         +  P  +     W   S  + 
Sbjct: 297 RPQMWSDILLSGGTTMLKGFGNRLVQELDKLNQAQSRVKIWAP-PERKYTSWIGGSILAE 355

Query: 406 TASYRNARVTREEYYEHGSDWCTK 429
            ++++   VT+ ++ E  S   TK
Sbjct: 356 LSTFQKIIVTKSQWQEDPSIIHTK 379

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 119/320 (37%), Gaps = 73/320 (22%)

Query: 60  PHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119
           P E G +  W     +WDY F+     D   L    G  ++ +E  M   +  +   +V+
Sbjct: 18  PMENGVIKNWSDMELLWDYAFY-----DQMQLPSTSGGKVMLTEPPMNPVKNREQMCEVM 72

Query: 120 FEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQK 179
           FE+Y+F  ++ +  A    + +   S                                  
Sbjct: 73  FEKYDFGGVYVAIQAVLALYAQGLSSG--------------------------------- 99

Query: 180 FDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHY--N 237
                    +V+DSG   T I+PV + +      ++LDV GR +T  L + LS R Y  N
Sbjct: 100 ---------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFN 150

Query: 238 MMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYVRNRRKENS 295
              +   V  IKEK  +VS     D+   ++   L   Y LPD                 
Sbjct: 151 RSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLVENYELPD----------------- 193

Query: 296 PLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVC 355
                 + I +  E F  PE  F P +  + +PG+ E +  ++      VR  +   IV 
Sbjct: 194 -----GRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVL 248

Query: 356 TGGNFNLPNFAQRLAAELQR 375
           +GG+   P    RL  EL++
Sbjct: 249 SGGSSMYPGLPSRLEKELKQ 268

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/386 (22%), Positives = 142/386 (36%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP-FRALNALAKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P +   + + +        +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY F+  ++     L    G  ++ +E  M      +
Sbjct: 66  YLQISYPMENGIIRDWADMELLWDYAFYEQMK-----LPSTSGGKVLLTEPPMNPLRNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173
              +V+FE+Y+F  ++    A    + +   S                            
Sbjct: 121 QMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSG--------------------------- 153

Query: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LDV GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYVRN 289
           R Y  N   +   V  IKEK  +VS     D+   ++   L  +Y LPD           
Sbjct: 199 RGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLVEQYELPD----------- 247

Query: 290 RRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLM 349
                       + I +  E F  PE  F P +  + +PGI E +  ++      +   +
Sbjct: 248 -----------GRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTL 296

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375
              IV +GG+   P    RL  EL++
Sbjct: 297 YKAIVLSGGSSMYPGLPSRLEKELKQ 322

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 97/449 (21%), Positives = 177/449 (39%), Gaps = 102/449 (22%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP---------FRALNALAKDKF-GTSYLSNHIKNIKDISS 54
           PIV+DNGS  IK G    +KP             + +   +F G +++ N  + I+ +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 55  VTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P E G +T W     +W + F       G  L   + H ++ +E+ +   +  + 
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVFEK-----GLQLSSLQDHPVLVTEAPLNPKKNREQ 124

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
             +++FE +   +++ S  A    +           SG+                     
Sbjct: 125 MCELLFETFSVPAVYVSIQAVLSLYA----------SGRTTGC----------------- 157

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFR 234
                          V+DSG  C+  +PV  G     A++++D+ GR ++ LL+  +   
Sbjct: 158 ---------------VLDSGDGCSHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIRKS 202

Query: 235 HYNMM---DETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRR 291
               +    E  +V  IKEK  +++     D  K ++K+   Y +   QT F        
Sbjct: 203 TGVSLLSSSEREIVRIIKEKACYIA----LDP-KEEEKN---YTMHGKQTMFR------- 247

Query: 292 KENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVG 351
                   D + I L +E F  PE  F+P++       + E + ES+  +   +R  +  
Sbjct: 248 ------LPDGKQIELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLFS 301

Query: 352 NIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFG--------WEVMSQF 403
           NIV +GG   +P F  R+  EL+       +C    P++   +F         W   S  
Sbjct: 302 NIVFSGGTTMIPGFGDRVLKELK------LSCE---PQTKIKIFAPPERKYSTWIGGSIL 352

Query: 404 SSTASYRNARVTREEYYEHGSDWCTKHRF 432
           S  ++++   VT++E+ E+    C   RF
Sbjct: 353 SGLSTFKKIWVTKKEWEENPR--CVHARF 379

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/386 (22%), Positives = 140/386 (36%), Gaps = 84/386 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNEKPFRALNAL-AKDKFGTSYLSNHIKNIKDI----------S 53
           PIV+D G+  +K G +    P     ++  +        +N    +KDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVRS 65

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +    P E G +  W     +WDY FF     D   L       ++ +E  M   +  +
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----DQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173
              +V+FE+Y+F  ++ +  A    + +   S                            
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG--------------------------- 153

Query: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233
                          +V+DSG   T I+PV + +      ++LDV GR +T  L + LS 
Sbjct: 154 ---------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSR 198

Query: 234 RHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYVRN 289
           R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LPD           
Sbjct: 199 RGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLVENYELPD----------- 247

Query: 290 RRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLM 349
                       + I +  E F  PE  F P +  + + G+ E +  ++      +R  +
Sbjct: 248 -----------GRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSAL 296

Query: 350 VGNIVCTGGNFNLPNFAQRLAAELQR 375
              IV +GG+   P    RL  EL++
Sbjct: 297 YRAIVLSGGSSMYPGLPSRLEKELKQ 322

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 85/391 (21%), Positives = 145/391 (37%), Gaps = 92/391 (23%)

Query: 4   APIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKN 48
           +PIV+D G+  +K G           PS   +P   L A  +    T      + +    
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASISTPLKDIMIGDEASE 62

Query: 49  IKDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTL 108
           ++    +++  P E G +  W     +WDY F+  ++     L    G  ++ +E  M  
Sbjct: 63  VRSYLQISY--PMENGIIKNWTDMELLWDYAFYEQMK-----LPSTSGGKVLLTEPPMNP 115

Query: 109 PELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEAD 168
            +  +   +V+FE+Y+F  ++ +  A    + +   S                       
Sbjct: 116 LKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG---------------------- 153

Query: 169 MPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLK 228
                               +V+DSG   T I+PV + +      ++LDV GR +T  L 
Sbjct: 154 --------------------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLI 193

Query: 229 ETLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFL 284
           + LS R Y  N   +   V  IKEK  +VS     D+   ++   L  +Y LPD      
Sbjct: 194 DLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLVEKYELPD------ 247

Query: 285 GYVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEI 344
                            + I +  E F  PE  F P +  +   G+ E +  ++      
Sbjct: 248 ----------------GRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVD 291

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
           VR  +   IV +GG+   P    RL  EL++
Sbjct: 292 VRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 80/350 (22%), Positives = 130/350 (37%), Gaps = 84/350 (24%)

Query: 2   ETAPIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTSYLSNHIKNIK 50
           E A +VIDNGS   K G           PS   +P R    +       SY+ +  ++ +
Sbjct: 4   EVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP-RHQGIMVGMGQKDSYVGDEAQSKR 62

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            I  +T R P E G +T W+    IW + F+N +          + H ++ +E+ M    
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRV------APEEHPVLLTEAPMNPKS 114

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
             +   Q++FE +   + + S  A    ++    +                         
Sbjct: 115 NREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG------------------------ 150

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKET 230
                             +V+DSG   T ++P+  G      + ++D+ GR LT  L + 
Sbjct: 151 ------------------IVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKI 192

Query: 231 LSFRHYNM--MDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVR 288
           LS R Y+     E  +V +IKEK                    L YV  DF+       +
Sbjct: 193 LSERGYSFSTTAEREIVRDIKEK--------------------LCYVALDFEQEMQTAAQ 232

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESL 338
           +   E S    D Q IT+ +E F  PE  FHP +  +   GI +    S+
Sbjct: 233 SSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSI 282

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 75.5 bits (184), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 97/448 (21%), Positives = 170/448 (37%), Gaps = 96/448 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP-FRALNALAKDKFGTSYLSNHIKN----------IKDIS 53
           P+V+DNGS  IK G S   KP     N +   K+    L+N I N           K   
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQKSRG 69

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P   G +  W+    +W + F + ++ + FD      H L+ +E+ +   +   
Sbjct: 70  LLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFD-----EHPLLITEAPLNPEKNRD 124

Query: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173
              +V FE+++F +++ +  +    +           SG+                    
Sbjct: 125 KMCEVFFEKFDFAAVYIANPSTLSLYA----------SGRTTGC---------------- 158

Query: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233
                           V+D G      +P+ +G     +++++DVGGR +T  L+     
Sbjct: 159 ----------------VLDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQ--FQI 200

Query: 234 RHYNMMD-----ETILVNNIKEKCLFVSPVSYFD---SFKVKDKHALEYVLPDFQTSFLG 285
           R Y  +      E  +V N+KEK  +VS     D   S    +K   ++ LPD +   L 
Sbjct: 201 RKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPDGKDLILD 260

Query: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV 345
             R                      F  PE  F P+I  +    + +   ES+S +   +
Sbjct: 261 KAR----------------------FRAPEILFRPQIMGLEYDSVSDMCFESISKVDLEL 298

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQ-RQLPTDWTCHVSVPESDCALFGWEVMSQFS 404
           RP +  +I+  GG+     F  RL  ELQ R    +    ++ PE       W   S  +
Sbjct: 299 RPKLFSSIILNGGSTMFRGFGDRLLKELQIRTGNKNLIKIIAPPERKYT--SWIGGSILT 356

Query: 405 STASYRNARVTREEYYEHGSDWCTKHRF 432
             ++++   +T+ E+ E   D   ++RF
Sbjct: 357 GLSTFKQLWMTKAEWQE---DNNLRYRF 381

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 75.9 bits (185), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 79/166 (47%), Gaps = 12/166 (7%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILE 336
           D++ S L  ++R  R  +S        + L  E   +PE  F P +  + + GI+E I E
Sbjct: 577 DWRNSTLHLFLRGPRPHDSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIE-ICE 635

Query: 337 S--------LSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP 388
           +               +   +  N+  TGGN  LP   +R+  E +  LP     +V + 
Sbjct: 636 TNFLKKFGSSRSELSSISRSLASNVFLTGGNMRLPGMRERVVREFRGLLPIGTELNVRMA 695

Query: 389 ESDCALFGWEVMSQFSSTAS-YRNARVTREEYYEHGSDWCTKHRFG 433
            +DCAL  W  M++ S T S +R+  VTR+EY+E+G D+  +H  G
Sbjct: 696 -NDCALDAWRGMAKLSRTDSLFRDTYVTRQEYHEYGPDYIKEHNLG 740

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGR----FLTGLLKETLSFRHYNMMDETIL 244
           LVI SG   T IIPV+ G       K+++ GGR    +L+ LL   L + ++ +   T  
Sbjct: 183 LVISSGNEDTHIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL--ALKYPYFPIKPSTHQ 240

Query: 245 VNNIKEKCLFVSP 257
              + ++  +VSP
Sbjct: 241 FKALYDEFCYVSP 253

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 93/431 (21%), Positives = 159/431 (36%), Gaps = 82/431 (19%)

Query: 5   PIVIDNGSYEIKFGPSTNEKPFRALNALAKDK------FGT----SYLSNHIKNIKDISS 54
           P+VIDNGS  +K G    EKP     +L  D        G     S++ N  + ++ +  
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL-- 68

Query: 55  VTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  + P E G ++ W+    +W +     I FD   L  G  H L+ +E+ +  PE +K 
Sbjct: 69  LKLKHPMERGVVSDWDDMELLWSH-----ILFDSLQLTSGMEHPLLITEAPLN-PESNKE 122

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
               +F    F++     +   +P   S  +     SG+                     
Sbjct: 123 KMLEVF----FETFNIPAICVSIPGVLSLYA-----SGRTTGC----------------- 156

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFR 234
                          V+D G      +PV +G     ++K++++GG  +T  L+  L   
Sbjct: 157 ---------------VVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQFQLRKE 201

Query: 235 HYNMM---DETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRR 291
               +    E  LV  +KEK  +VS        ++KD+    +      T+F        
Sbjct: 202 SGVWLFSSGERELVRTMKEKSCYVS------LNQLKDEEKFTFEPGKMNTNFK------- 248

Query: 292 KENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVG 351
                   D   +TL+   F  PE  F P+I    +P + E  L+S+  +   +RP ++ 
Sbjct: 249 ------LPDGNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMS 302

Query: 352 NIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRN 411
            I  +GG      F  R   ELQ          +  P        W   S  +   ++R 
Sbjct: 303 RITLSGGTTMFRGFGDRFLQELQISTCKKSNIRILAPPER-KYTAWIGGSMLAGLTTFRK 361

Query: 412 ARVTREEYYEH 422
              T+ ++ EH
Sbjct: 362 MLTTKSDWREH 372

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 77/157 (49%), Gaps = 11/157 (7%)

Query: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLP--- 342
           ++R  R  +S  A +   + L  E   +PE  F P +  + + GI+E + E++ M     
Sbjct: 587 FLRGPRPHDSEDAHEQHQMHLNVERIRVPEVIFQPPMGGLDQAGIIE-LSETIIMNKFGS 645

Query: 343 -----EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGW 397
                  V   M  N+  TGGN  +P    R+  E    LP     ++ V  SD A+  W
Sbjct: 646 SRRQLSSVSQEMANNVFLTGGNVRVPGLRDRIVREFTEFLPVGTKYNIKVA-SDPAIDAW 704

Query: 398 EVMSQFS-STASYRNARVTREEYYEHGSDWCTKHRFG 433
           + M++F+ S+  Y+ + VT++EY E+G D+  +H+ G
Sbjct: 705 KGMAKFAQSSTDYKGSYVTKKEYEEYGPDYIKEHKLG 741

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/429 (19%), Positives = 172/429 (40%), Gaps = 76/429 (17%)

Query: 5   PIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISS--------VT 56
           P+V+DNGS  +K G S +E P      +A        ++  +++   + +        + 
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLRGLLA 72

Query: 57  FRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            RRP   G++T W+    +W + F++ ++    + + G  H L+ +E+ +   +  +   
Sbjct: 73  LRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGD-HPLLITEAPLNSTKNRETMC 131

Query: 117 QVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRD 176
           ++++E + FD+L+ +  A    +     +                               
Sbjct: 132 EILYETFNFDALYVAHPAVLSLYATGQTTG------------------------------ 161

Query: 177 TQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLL----KETLS 232
                        V++ G   +   PV +G     +++++D+GGR +T  L    +++  
Sbjct: 162 ------------CVLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTG 209

Query: 233 FRHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRK 292
              ++  ++ I V  IKEK  +V               AL+Y   + +     ++  R  
Sbjct: 210 LSLFSNSEQEI-VRTIKEKANYV---------------ALDYKFEEEKF----FIHEREN 249

Query: 293 ENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGN 352
            ++    D Q +T     +   E  F P++       + E +LES++ +   +R  ++ N
Sbjct: 250 TSTVKLPDGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLEN 309

Query: 353 IVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNA 412
           IV +GG   L  F QR  +E ++ LP      +    ++ +   W   S  S    +RN 
Sbjct: 310 IVLSGGTTMLKGFDQRTMSETKKMLPKHTKVKIR-SLAERSYIAWIGGSILSGLYGFRNL 368

Query: 413 RVTREEYYE 421
            +TRE Y E
Sbjct: 369 WLTREMYEE 377

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 94/436 (21%), Positives = 172/436 (39%), Gaps = 92/436 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNEKPFR---ALNALAK-DKFGTS--------YLSNHIKNIKDI 52
           PIVIDNGS  IK G S  +KP      L  + K DK   +        Y+ N  ++I+ +
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 53  SSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELS 112
             +  + P   G +  W+    +W +  FN    D  +++  + H L+ +E+ +T+ +  
Sbjct: 71  --LRLQHPMNRGVVDNWDDMELLW-WHIFN----DTLNVQNIEEHPLLITEAPLTIEKQR 123

Query: 113 KHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSN 172
               + +FE +   SL+ +                                         
Sbjct: 124 HIMCERLFETFNIPSLYVA----------------------------------------- 142

Query: 173 NPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLL----K 228
           NP     + S  +    V+D G       P+ +G     +++K++VGGR +T  L    +
Sbjct: 143 NPSVLSLYASG-NTTGCVVDCGDGYCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIR 201

Query: 229 ETLSFRHYNMMDETILVNNIKEKCLFVSP---VSYFDSFKVKDKHALEYVLPDFQTSFLG 285
           ++     Y+  +E  +V  IKEK  ++S     S    +  +D+ + ++ LPD       
Sbjct: 202 KSSGISLYSS-NEKEIVRTIKEKVCYISEDFNKSEESYYLRQDEMSCKFKLPD------- 253

Query: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV 345
                           + +TL  E F  PE  F+P++  +    +     ES+S +   +
Sbjct: 254 ---------------GKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLEL 298

Query: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSS 405
           RP +  NI+ TGG+     F  RL  +LQ          +  P  +     W   S  + 
Sbjct: 299 RPKLFSNILLTGGSTLFKGFGSRLLGDLQELTNNRAKIKILAP-PERKYTSWIGGSILTG 357

Query: 406 TASYRNARVTREEYYE 421
            ++++N  VT+ ++ E
Sbjct: 358 LSTFKNLWVTKSDWEE 373

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 84/185 (45%), Gaps = 13/185 (7%)

Query: 258 VSYFDSFKVKDKHALEYVLPDFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPET 316
           + Y  +F  +D    +Y   D++ S L  ++R  R  +S        + L  E   +PE 
Sbjct: 564 LEYDPTFTEEDTLDAQY---DWRNSTLHLFLRGPRPHDSEDVHQQHQLHLNTERIRVPEI 620

Query: 317 FFHPEIAQITKPGIVE----AILESLSMLP---EIVRPLMVGNIVCTGGNFNLPNFAQRL 369
            F P IA   + GI E     +L+     P         MV N+  TGGN  +P    R+
Sbjct: 621 LFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWITGGNARIPGIKNRI 680

Query: 370 AAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTAS-YRNARVTREEYYEHGSDWCT 428
             E    LP      V + E D +L  W+ M++ ++  + Y+N  VTR+EY E+G D+  
Sbjct: 681 VKEFTEFLPAGTPLSVHMSE-DPSLDAWKGMAKLANNETDYKNTAVTRKEYEEYGPDYIK 739

Query: 429 KHRFG 433
           +H+ G
Sbjct: 740 EHKLG 744

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 72/157 (45%), Gaps = 11/157 (7%)

Query: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVE--------AILES 337
           ++R  R  +S    +   + L  E   +PE  F P +A + + G+ E            +
Sbjct: 586 FLRGPRPHDSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGST 645

Query: 338 LSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGW 397
            S L E  + L   N+  TGGN  LP   +R+  E    LP     +V +  SD A+  W
Sbjct: 646 RSQLSEGSKKL-AANVFLTGGNMRLPGVRERIVREFTGMLPMGSNLNVRMA-SDSAVDAW 703

Query: 398 EVMSQFSSTAS-YRNARVTREEYYEHGSDWCTKHRFG 433
             M++ S   S Y+ + +TR+EY E G+D+  +H  G
Sbjct: 704 RGMAKLSQAGSQYKGSYITRKEYQELGADYIKEHNLG 740

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGR----FLTGLLKETLSFRHYNMMDETIL 244
           LVI+SG   T +IPV+ G       K+++ GGR    +L+ LL   L + ++ +   T  
Sbjct: 183 LVINSGNEDTHVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL--ALKYPYFPIKPSTHQ 240

Query: 245 VNNIKEKCLFVSPVSYFDSFK 265
             ++ E   +VS V Y D  +
Sbjct: 241 FQSLYEDFCYVS-VDYQDEIR 260

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 72/320 (22%), Positives = 119/320 (37%), Gaps = 73/320 (22%)

Query: 60  PHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119
           P E G +  W     +WDY F+  ++    D   GK   ++ +E  M   +  +   +V+
Sbjct: 18  PMENGIIKNWTDMELLWDYAFYEQMKLP--DTSNGK---ILLTEPPMNPIKNREKMCEVM 72

Query: 120 FEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQK 179
           FE+Y F  ++ +  A    + +   S                                  
Sbjct: 73  FEKYNFGGVYVAIQAVLALYAQGLSSG--------------------------------- 99

Query: 180 FDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHY--N 237
                    +V+DSG   T I+PV + +      ++LDV GR +T  L + LS R Y  N
Sbjct: 100 ---------VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFN 150

Query: 238 MMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLGYVRNRRKENS 295
              +   V  IKEK  +VS     D+   ++   L   Y LPD                 
Sbjct: 151 RTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLVESYELPD----------------- 193

Query: 296 PLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVC 355
                 + I +  E F  PE  F P +  + + G+ E +  ++      +R  +   IV 
Sbjct: 194 -----GRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVL 248

Query: 356 TGGNFNLPNFAQRLAAELQR 375
           +GG+   P    RL  EL++
Sbjct: 249 SGGSSMYPGLPSRLEKELKQ 268

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 84/172 (48%), Gaps = 14/172 (8%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILE 336
           D++ S L  ++R  R  +S    +   + L  E   +PE  F P I  + + GIVE + E
Sbjct: 577 DWRNSVLHLFLRGPRSHDSESIHEQHQMHLNVERIRVPEVIFQPSIGGLDQAGIVE-LCE 635

Query: 337 SLSM---------LPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV 387
           +L +         L EI + +M  NI  TGGN  LP   +R+  E    LP     +V +
Sbjct: 636 TLLLKKFGSNRRELSEISK-MMAKNIFITGGNAKLPGIRERVVREFTGFLPVGTNLNVKL 694

Query: 388 PESDCALFGWEVMSQFSSTAS-YRNARVTREEYYEHGSDWCTKHRFGYQNWI 438
            E D ++  W  M++F++  S Y  + +T++EY E G ++  +H  G   ++
Sbjct: 695 AE-DPSMSAWRGMAKFANNTSLYETSIMTKKEYEELGPEYIKEHNLGNAKFV 745

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 86/393 (21%), Positives = 144/393 (36%), Gaps = 96/393 (24%)

Query: 4   APIVIDNGSYEIKFG-----------PSTNEKP-FRA-----LNALAKDKFGTSYLSNHI 46
           +PIV+D G+  +K G           PS   +P  RA     LN   KD      +    
Sbjct: 5   SPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVM----IGEEA 60

Query: 47  KNIKDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCM 106
             ++    +++  P E G +  W     +WDY F+  ++     L    G  ++ +E  +
Sbjct: 61  SAVRSYLQISY--PMENGIIKNWTDMELLWDYAFYEQMK-----LPSTSGGKVLLTEPPL 113

Query: 107 TLPELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNE 166
              +  +   +V+FE+Y+F  ++ +  A    + +   S                     
Sbjct: 114 NPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG-------------------- 153

Query: 167 ADMPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGL 226
                                 +VIDSG   T I+PV + +      ++LDV GR +T  
Sbjct: 154 ----------------------VVIDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRH 191

Query: 227 LKETLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTS 282
           L + LS R Y  N   +   V  IKEK  +VS     D+   ++   L   Y LP     
Sbjct: 192 LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLVENYELP----- 246

Query: 283 FLGYVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLP 342
                            D + I +  E F   E  F P +  +   G+ E +  ++    
Sbjct: 247 -----------------DGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSAD 289

Query: 343 EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
             VR  +   IV +GG+   P    R+  EL++
Sbjct: 290 IDVRSSLYKAIVLSGGSSMYPGLPSRIEKELKQ 322

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/430 (18%), Positives = 165/430 (38%), Gaps = 82/430 (19%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP--FRALNALAKDKFG---------TSYLSNHIKNIKDIS 53
           P+VIDNG+  +K G   ++KP  F+  N +   KF            Y+ N  +  + + 
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKPKCFQH-NIVGTPKFDKVMIGGLDDNMYIGNKAQENRGL- 67

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P E G++  W+    +W +   + +     +++  + H ++ +E+ +   +  +
Sbjct: 68  -LRLRHPMEHGEVKHWDEMEAVWKHTLLHDL-----NIQHIEEHPILITEAPLNSSKNRE 121

Query: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173
           H  +++FE +   ++     A    ++    +                            
Sbjct: 122 HMCEILFESFNIPAIHVENPAVLALYSGGRTTG--------------------------- 154

Query: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233
                           VID G      +P+ +G     +++++D+GGR +T    E L F
Sbjct: 155 ---------------CVIDCGEGYCSAVPIYEGFALTPSIRRIDIGGREIT----EQLQF 195

Query: 234 RHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKE 293
           +    +  ++  +N KE    +             K    YV  D       Y+ +    
Sbjct: 196 QIRKSVGMSLFSSNEKEIVRTI-------------KERACYVADDISKEEHKYILDSESN 242

Query: 294 NSPLA-EDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGN 352
           +S     D +++++ +  F   E  F+P +       + E + ++LS +   +RP++  +
Sbjct: 243 SSKFKLPDGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKS 302

Query: 353 IVCTGGNFNLPNFAQRLAAELQRQLPTDWTCH-VSVPESDCALFGWEVMSQFSSTASYRN 411
           +V  GG   LP F  R+  ELQ     D     ++ PE       W   S  +  ++++ 
Sbjct: 303 LVLNGGTTVLPGFGNRILKELQILTKQDTKLRIIASPERKYTT--WIGGSILAGLSTFQK 360

Query: 412 ARVTREEYYE 421
             VT+  + E
Sbjct: 361 ILVTKSNWNE 370

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 84/169 (49%), Gaps = 10/169 (5%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVE---- 332
           D++ S L  ++R  R  +S  + +   + L  E   +PE FF P +    + G+ E    
Sbjct: 580 DWRNSTLHLFLRGPRPHDSENSHEQHQMHLNVERIRVPEVFFQPTMCGEDQAGVSELCER 639

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            +L      P  +  +   M  N+  TGGN  +P   +R+  E    LP + + +V++  
Sbjct: 640 VLLSKFGASPRQMSSITSEMAKNVWVTGGNAKIPGLRERIVKEFTGFLPVNTSFNVNIS- 698

Query: 390 SDCALFGWEVMSQFSSTAS-YRNARVTREEYYEHGSDWCTKHRFGYQNW 437
           SD +L  W  M++++   + Y+ + ++++EY E+G D+  +H+ G  N+
Sbjct: 699 SDPSLDAWRGMAKYAQNETDYKKSFISKKEYEEYGPDYIKEHKLGNMNY 747

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 81/166 (48%), Gaps = 12/166 (7%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILE 336
           D++ S L  ++R  R  +S    +   + +  E   +PE  F P I  + + G+VE + E
Sbjct: 582 DWRNSTLHLFLRGPRPHDSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVE-LCE 640

Query: 337 S--LSMLPEIVRPL------MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP 388
           +  L       R L      M  N+  TGGN  LP   +R+  E    LP      V++ 
Sbjct: 641 TVLLKKFDSSRRALSATCEKMAKNVFITGGNTKLPGIRERIVREFTGFLPVGTELKVTLA 700

Query: 389 ESDCALFGWEVMSQFSST-ASYRNARVTREEYYEHGSDWCTKHRFG 433
           + D +L  W+ M++F+S   SY+++ +T+ EY E+G ++  +H  G
Sbjct: 701 K-DPSLSAWKGMAKFASDPTSYKSSILTKREYEEYGPEYIKEHNLG 745

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 78/165 (47%), Gaps = 10/165 (6%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVE---- 332
           D++ S L  ++R  R  +S    +   + L  E   +PE  F P +    + GI E    
Sbjct: 585 DWRNSILHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSET 644

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            +L+     P  +      MV N++ TGGN  +P   +R+  E    LPT     V++  
Sbjct: 645 ILLKKFGSQPGKLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNM-S 703

Query: 390 SDCALFGWEVMSQFS-STASYRNARVTREEYYEHGSDWCTKHRFG 433
           SD +L  W+ M+  + +   YR   ++++EY E+G ++  +H+ G
Sbjct: 704 SDPSLDAWKGMAALARNEEQYRKTVISKKEYEEYGPEYIKEHKLG 748

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 77/166 (46%), Gaps = 12/166 (7%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILE 336
           D++ S L  ++R  R  +S    +   + L  E   +PE  F P +    + GI E + E
Sbjct: 585 DWRNSLLHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICE-LSE 643

Query: 337 SLSMLP--------EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVP 388
           ++ M                MV NI+ TGGN  +P   +R+  E    LP      V++ 
Sbjct: 644 TILMKKFGSQRGKLSSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNI- 702

Query: 389 ESDCALFGWEVMSQFS-STASYRNARVTREEYYEHGSDWCTKHRFG 433
            S+ +L  W  M+  + + A Y+   +++EEY E+G D+  +H+ G
Sbjct: 703 SSNPSLDAWRGMAALARNKAEYKKTVISKEEYEEYGPDYIKEHKLG 748

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 99/442 (22%), Positives = 171/442 (38%), Gaps = 102/442 (23%)

Query: 17  FGPSTNEKPFRALNA---LAKD---KFGTS----YLSNHIKNIKDISSVTFRRPHELGQL 66
           FG ST+   F +LNA   L+ +   K GT     Y+ N         S +   P   GQ+
Sbjct: 62  FGNSTSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSYSLSYPIRHGQI 121

Query: 67  TLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFD 126
             W+     W+   F  +        E + H  + +E  +  PE  +   ++ FE +   
Sbjct: 122 ENWDHMERFWENSIFKYLR------TEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 175

Query: 127 SLFKSPVAAFVPFTKSYKSKM--KAISGKDEDADIVVSKSNEADMPSNNPRDTQKFDSDY 184
            L+ +  A          SK+  ++++G                                
Sbjct: 176 GLYIAVQAVLALAASWTSSKVTDRSLTGT------------------------------- 204

Query: 185 HDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI- 243
                VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D ++ 
Sbjct: 205 -----VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGETDTSLR 257

Query: 244 LVNNIKEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDA 301
               IK++  +V P  V  F+ F   D++      PD    F+  V N+ K    +    
Sbjct: 258 TAERIKQEYCYVCPDIVKEFNKF---DRN------PDKFAQFI--VENQEKTQKKI---- 302

Query: 302 QTITLTDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
             + +  E F  PE FF+PEIA        P IV+  +++    P  VR  +  NIV +G
Sbjct: 303 --VDVGYERFLAPEIFFNPEIASSDFLTPLPTIVDHTIQA---CPIDVRKGLYNNIVLSG 357

Query: 358 GNFNLPNFAQRLAAELQ----------------RQLPTDWTCHVSVPESDCALFGWEVMS 401
           G+    +F +RL  +++                +    D        + +   FG  +++
Sbjct: 358 GSTMFKDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLLA 417

Query: 402 QFSSTASYRNARVTREEYYEHG 423
           Q   TA +++   T+++Y E+G
Sbjct: 418 Q---TAEFKSYCHTKKDYEEYG 436

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 112/258 (43%), Gaps = 46/258 (17%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D ++     I
Sbjct: 212 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQDASLRTAERI 269

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F    +   +++           V N+ +         + + +
Sbjct: 270 KQEYCYVCPDIVKEFNKFDRDSEKFAQFI-----------VENKERTTK------KVVDV 312

Query: 307 TDELFTIPETFFHPEIAQ---ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLP 363
             E F  PE FF+PEIA    +T   +V  + E++   P  VR  +  NIV +GG+    
Sbjct: 313 GYERFLAPEIFFNPEIASSDFLTPLPVV--VDETIQACPIDVRKGLYNNIVLSGGSTMFK 370

Query: 364 NFAQRLAAELQ----------------RQLPTDWTCHVSVPESDCALFGWEVMSQFSSTA 407
           +F +RL  +L+                R    D +      + +   FG  +++Q   T 
Sbjct: 371 DFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWFGGSLLAQ---TG 427

Query: 408 SYRNARVTREEYYEHGSD 425
            +++   T+++Y E+G D
Sbjct: 428 EFKSYCHTKQDYEEYGPD 445

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 91/442 (20%), Positives = 166/442 (37%), Gaps = 84/442 (19%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP----FRALNALAKDKFGTSYLSNHIKNI-----KDISSV 55
           P+V+DNGS  IK G S  EKP    +  +     DK     LS+  + +     K    +
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 56  TFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHA 115
             + P E G +  W     +W + F++ ++ +         H ++ +E+ +   E     
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNIG-----DHPMLVTEAPLNPLENRDKM 125

Query: 116 DQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPR 175
            ++++E +   +++ S  A    +     +                              
Sbjct: 126 CEMLYETFNVPAVYVSIQAVLALYAGGRTTG----------------------------- 156

Query: 176 DTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGR----FLTGLLKETL 231
                         VID G  C   +PV  G     A++++DV GR    FL  LL++++
Sbjct: 157 -------------CVIDCGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSI 203

Query: 232 SFRHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRR 291
                +  +  I V  IKEK  +V+P    +  K       E  L  F+           
Sbjct: 204 GVTLLSSSEREI-VRMIKEKACYVAPEVAAEEQKYASSRGSEE-LTKFKLP--------- 252

Query: 292 KENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVG 351
                   D + ++L  E F  PE  F P++       I +   +S+S +   +R  +  
Sbjct: 253 --------DGKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYS 304

Query: 352 NIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHV-SVPESDCALFGWEVMSQFSSTASYR 410
           ++V +GG+     F  RL  EL+ +   +    + + PE   ++  W   S  +  +++ 
Sbjct: 305 SLVLSGGSTLFAGFGDRLLNELRSRCEPNVKIKIFAPPERKYSV--WIGGSILAGLSTFE 362

Query: 411 NARVTREEYYEHGSDWCTKHRF 432
              VTR E+ E+    C   RF
Sbjct: 363 KIWVTRSEWQEN--PQCVHSRF 382

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 91/450 (20%), Positives = 175/450 (38%), Gaps = 102/450 (22%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP----FRALNALAKDKFGTS------YLSNHIKNIKDISS 54
           PIV+DNGS  +K G   ++KP    +  +     DK          ++ N  +  + +  
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGL-- 70

Query: 55  VTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +  WE    +WD+ F + ++    +L E   H LV +E+ +      + 
Sbjct: 71  LKLRYPMDHGIIENWEHMETVWDHIFKDCLKVS--NLGE---HPLVVTEAPLNPKPNREK 125

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
             + +FE +   +L+ +  A    +           SG+                     
Sbjct: 126 MCETLFESFNIPALYIANPAVLSLYA----------SGRTTGC----------------- 158

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFR 234
                          V+++G      +P+ +G     +++++D+GGR +T  L+  L  R
Sbjct: 159 ---------------VVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQ--LQLR 201

Query: 235 HYNMM-----DETILVNNIKEKCLFVSPVSYFDSFKV---KDKHALEYVLPDFQTSFLGY 286
               M      E  +V  IKE   ++      +  K    ++K ++ + LPD +   +G 
Sbjct: 202 KSTGMWLYSSSEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKKSISFKLPDGKNLVIGP 261

Query: 287 VRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVR 346
            R                      F  PE  F+P +       + + I++S+S +   +R
Sbjct: 262 GR----------------------FRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLR 299

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV---PESD-CALFGWEVMSQ 402
             ++ NI  +GG+     F  RL  EL      D T  V +   PE    A  G  +++ 
Sbjct: 300 SKLLNNITLSGGSTMFQGFCDRLITEL--DFSVDKTTKVRILAPPERKYSAFIGGSILAN 357

Query: 403 FSSTASYRNARVTREEYYEHGSDWCTKHRF 432
            S   ++RN  VT++++   G +   +++F
Sbjct: 358 LS---TFRNMWVTKDQW--EGDNRIIENKF 382

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 75/164 (45%), Gaps = 9/164 (5%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVE---- 332
           D++ S L  ++R  R  +S    +   + L  E   +PE  F P +    + G+ E    
Sbjct: 581 DWRNSILHLFLRGPRPHDSDDVHEQHQMHLNIERIRVPEVLFQPTMGGCDQAGVAELCET 640

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            +L+     P  +      M  NI  +GGN  +P    R+  E    LP      V++  
Sbjct: 641 ILLKKFGSSPNQLSKTAEDMANNIWLSGGNAKVPGLKNRIVKEFTSFLPVGTKLSVNMS- 699

Query: 390 SDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRFG 433
           SD  L  W+ M++++ +  Y  + +T++EY E+G ++  +H+ G
Sbjct: 700 SDPLLDSWKGMAKWAKSEDYNKSFITKKEYEEYGPEYIKEHKMG 743

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 82/180 (45%), Gaps = 14/180 (7%)

Query: 263 SFKVKDKHALEYVLPDFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPE 321
           SF  +D    +Y   D++ S L  ++R  R  N         + L  E    PE  F P 
Sbjct: 567 SFTEEDTLDAQY---DWRNSVLHLFLRGPRPHNGEDVHQQHQLHLNIERIRAPEVIFQPS 623

Query: 322 IAQITKPGIVE---AIL-----ESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAEL 373
           +  + + GI E    IL        S L +     M  NI  TGGN  +PN  +R+  E 
Sbjct: 624 MGGLDQAGIAELADGILTKKFGSGSSKLSQQCLD-MASNIFITGGNTKIPNLRERIVNEF 682

Query: 374 QRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRFG 433
              LP +   +V+  + + +L  W+ M++F+ + +Y +  VT+ EY E G ++  +H+ G
Sbjct: 683 TGFLPVNTPLNVNYAQ-NVSLDAWKGMAKFARSDTYSSTCVTKVEYEEFGPNYIKEHKLG 741

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 90/239 (37%), Gaps = 51/239 (21%)

Query: 3   TAPIVIDNGSYEIKFGPSTNEKPFRALNAL------AKDKFGTSYLSNHIKNIKDISSVT 56
             PI +D GSYE++ G ++ + P              K +   +++ N       + S +
Sbjct: 39  NTPIALDFGSYEVRAGFTSQDTPSHVFPTKIVRYKERKIQKALTFIGNDCSLDNAVRSHS 98

Query: 57  FRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            R P++   +T WE    +  Y F +     G    +G  + ++ +E   T+     +  
Sbjct: 99  -RSPYDGSLITNWEYMEDMLSYTFHHL----GVQPNDGISNPMILTEKMATVQAQRSNWY 153

Query: 117 QVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRD 176
           Q++FE Y        P   F             I G      +    +N      N+P  
Sbjct: 154 QLLFECYGI------PQVTF------------GIDG------LFSFYAN------NSPDS 183

Query: 177 TQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRH 235
           T           L+I+SG   T IIPV+KG       K++D GG      LK  LS ++
Sbjct: 184 TG----------LIINSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 77/165 (46%), Gaps = 10/165 (6%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVE---- 332
           D++ S L  ++R  R  +S        I L  E   +PE  F P +  + + GI E    
Sbjct: 584 DWRNSTLHLFLRGPRPHDSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSET 643

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            +L      P+ +  L   M  NI  TGGN  +P   +R+  E +  LP +   +V++  
Sbjct: 644 ILLRKFGSEPKHLSELSLTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNTQFNVNMT- 702

Query: 390 SDCALFGWEVMSQFSSTAS-YRNARVTREEYYEHGSDWCTKHRFG 433
           SD     W  M++ +   + Y+   ++++EY E+G ++  +H+ G
Sbjct: 703 SDPTFDAWNGMAKLAQNETDYKKTIISKKEYEEYGPEYIKEHKLG 747

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 100/443 (22%), Positives = 169/443 (38%), Gaps = 104/443 (23%)

Query: 17  FGPSTNEKPFRAL-------NALAKDKFGTSYLSNHIKNIKDISS----VTFRRPHELGQ 65
           FG ST+   F  L       N LA  K GT  L  +I N   I+S     +   P   GQ
Sbjct: 66  FGNSTSATSFNNLSSQMLMSNNLA-GKRGTEDLDFYIGNEALIASQGASYSLSYPIRHGQ 124

Query: 66  LTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEF 125
           +  W+     W+   F  +        E + H  + +E  +  PE  +   ++ FE +  
Sbjct: 125 VENWDHMERFWENSIFKYLR------TEPEDHFFLLTEPPLNPPENREQIAEIFFESFNC 178

Query: 126 DSLFKSPVAAFVPFTKSYKSKM--KAISGKDEDADIVVSKSNEADMPSNNPRDTQKFDSD 183
             L+ +  A          SK+  ++++G                               
Sbjct: 179 AGLYIAVQAVLALAASWTSSKVVDRSLTGT------------------------------ 208

Query: 184 YHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI 243
                 VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D ++
Sbjct: 209 ------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSL 260

Query: 244 -LVNNIKEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAED 300
                IK++  +V P  V  F+ F    +   +YV           V N+ K        
Sbjct: 261 RTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYV-----------VENQEKTQK----- 304

Query: 301 AQTITLTDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCT 356
            + + +  E F  PE FF+PEIA        P IV+   +++   P  VR  +  NIV +
Sbjct: 305 -KVVDVGYERFLAPEIFFNPEIASSDFLTPLPTIVD---QTIQACPIDVRKGLYNNIVLS 360

Query: 357 GGNFNLPNFAQRLAAELQ----------------RQLPTDWTCHVSVPESDCALFGWEVM 400
           GG+    +F +RL  +L+                +    D +      + +   FG  ++
Sbjct: 361 GGSTMFKDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGSLL 420

Query: 401 SQFSSTASYRNARVTREEYYEHG 423
           +Q   TA +++   T+++Y E+G
Sbjct: 421 AQ---TAEFKSYCHTKKDYEEYG 440

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 84/404 (20%), Positives = 152/404 (37%), Gaps = 99/404 (24%)

Query: 5   PIVIDNGSYEIKFGPSTNEKPFRAL-----------NALAKDKFGTSYLSNHIKNIKDIS 53
           PIVIDNGS  IK G S  E+P +AL             + +   G +++ N  + ++ + 
Sbjct: 14  PIVIDNGSGIIKVGFSGEERP-KALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL- 71

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P   G +  W+    IW Y   N +      L+  + H L+ +E+ M   +  +
Sbjct: 72  -LRLRYPMTHGVVEDWDSMELIWSY-MLNEV----LQLQNIEEHPLLITEAPMNPLKNRE 125

Query: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173
              QV+FE +   +L+ S  A    +           SG+                    
Sbjct: 126 VMAQVLFETFNLPALYISNPAVLSLYA----------SGRTTGC---------------- 159

Query: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233
                           V+D G      +P+  G     ++ ++D+GGR +T    E L F
Sbjct: 160 ----------------VVDCGEGYCSTVPIYDGFALPASIMRMDIGGRDIT----EQLQF 199

Query: 234 RHYNMM-------DETILVNNIKEK-CLFVSPVSYFDSFKVKDKHALEYV--LPDFQTSF 283
           +             E  +V  IKEK C     +   +   ++  H L  V  LPD     
Sbjct: 200 QLRKSAGISLFSSSELEVVRMIKEKVCYLAKNIKKEEDRYLQGHHDLGSVFKLPD----- 254

Query: 284 LGYVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPE 343
                             + I + ++ +  PE  F P+I      G+ +  ++S+  +  
Sbjct: 255 -----------------GKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDL 297

Query: 344 IVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV 387
            +R  ++ +I+ +GG   L  F +R+  +L+    +  TC + +
Sbjct: 298 DLRKTLLSSIILSGGTTTLRGFGERMLHDLEAL--SKGTCKIKI 339

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 90/183 (49%), Gaps = 14/183 (7%)

Query: 261 FDS-FKVKDKHALEYVLPDFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFF 318
           FDS F ++D    +Y   D++ S L  ++R  R  +S  + +   + +  E   +PE  F
Sbjct: 571 FDSNFTMEDTVDAQY---DWRNSTLHLFLRGPRPFDSENSHEQHQMHMNIERPRVPEILF 627

Query: 319 HPEIAQITKPGIVE----AILESLSMLPEIVR---PLMVGNIVCTGGNFNLPNFAQRLAA 371
            P +    + GI+E     +L+     P  +      M  N+  TGG+  LP    R+  
Sbjct: 628 QPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGLKTRIVK 687

Query: 372 ELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSST-ASYRNARVTREEYYEHGSDWCTKH 430
           E    LP D    V++ +   +L  W+ M++FSS  A ++++ ++++EY E+G ++  +H
Sbjct: 688 EFTSFLPNDAKFSVNISKH-PSLDAWKGMAKFSSDDADFKSSLISKKEYEEYGPEYIKEH 746

Query: 431 RFG 433
           R G
Sbjct: 747 RLG 749

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 79/167 (47%), Gaps = 14/167 (8%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVE---- 332
           D++ S L  ++R  R  +S    +   + L  E   +PE  F P +    + GI E    
Sbjct: 585 DWRNSILHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSET 644

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLP--TDWTCHVSV 387
            +L+     P  +      MV N+  TGGN  +P   +R+  E    LP  T+++ ++S 
Sbjct: 645 ILLKKFGSQPGKLSSTSLDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMS- 703

Query: 388 PESDCALFGWEVMSQFSSTA-SYRNARVTREEYYEHGSDWCTKHRFG 433
             SD +L  W+ M+  +     Y+   ++++EY E+G D+  +H+ G
Sbjct: 704 --SDPSLDAWKGMAALAQNKEEYKKTVISKKEYEEYGPDYIKEHKLG 748

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 95/424 (22%), Positives = 161/424 (37%), Gaps = 90/424 (21%)

Query: 10  NGSYEIKFGPSTNEKPFRAL--------NALAKDKFGTSYLSNHIKNIKDIS----SVTF 57
           NGS    FG ST+   F  L        N LA  K GT  L  +I N   ++    S + 
Sbjct: 63  NGSSNPYFGNSTSATNFGGLTGGKMLLSNNLA-GKRGTEDLDFYIGNEALVAAQSPSYSL 121

Query: 58  RRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQ 117
             P   GQ+  W+     W+   F  +        E + H+ + +E  +  PE  +   +
Sbjct: 122 SYPIRHGQVENWDHMERFWENSIFKYLR------TEPEDHYFLLTEPPLNPPENREQVAE 175

Query: 118 VIFEEYEFDSLFKSPVAAFVPFTKSYKSKM--KAISGKDEDADIVVSKSNEADMPSNNPR 175
           + FE +    L+ +  A          SK+  ++++G                       
Sbjct: 176 IFFESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGT---------------------- 213

Query: 176 DTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRH 235
                         VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R 
Sbjct: 214 --------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLL--RE 257

Query: 236 YNMMDETI-LVNNIKEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRK 292
               D ++     IK++  +V P  V  F+ F  + +   ++++   + +          
Sbjct: 258 RGEADTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIVESQEKT---------- 307

Query: 293 ENSPLAEDAQTITLTDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPL 348
                    + + +  E F  PE FF+PEIA        P +V+   +++   P  VR  
Sbjct: 308 -------KQKVVDVGYERFLAPEIFFNPEIASSDYLTPLPTVVD---QTIQACPIDVRKG 357

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTAS 408
           +  NIV +GG+    +F++R    LQR + +     +S  E    +    V  Q  S   
Sbjct: 358 LYNNIVLSGGSTMFKDFSRR----LQRDMKSIVNARISQNEKMTGVKSSGVDVQVISHRK 413

Query: 409 YRNA 412
            RNA
Sbjct: 414 QRNA 417

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 111/257 (43%), Gaps = 48/257 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F        ++V+ + +       + RRK           + +
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQE-------KTRRK----------AVDI 305

Query: 307 TDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEIA        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 306 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 363 PNFAQRLAAELQ----------------RQLPTDWTCHVSVPESDCALFGWEVMSQFSST 406
            +F +RL  +L+                +    D +      + +   FG  +++Q   T
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ---T 419

Query: 407 ASYRNARVTREEYYEHG 423
           A ++    T+++Y E+G
Sbjct: 420 AEFKGYCHTKKDYEEYG 436

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 111/257 (43%), Gaps = 48/257 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F        ++V+ + +       + RRK           + +
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQE-------KTRRK----------VVDI 305

Query: 307 TDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEIA        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 306 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 363 PNFAQRLAAELQ----------------RQLPTDWTCHVSVPESDCALFGWEVMSQFSST 406
            +F +RL  +L+                +    D +      + +   FG  +++Q   T
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ---T 419

Query: 407 ASYRNARVTREEYYEHG 423
           A ++    T+++Y E+G
Sbjct: 420 AEFKGYCHTKKDYEEYG 436

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 111/257 (43%), Gaps = 48/257 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F        ++V+ + +       + RRK           + +
Sbjct: 263 KQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQE-------KTRRK----------VVDI 305

Query: 307 TDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEIA        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 306 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 363 PNFAQRLAAELQ----------------RQLPTDWTCHVSVPESDCALFGWEVMSQFSST 406
            +F +RL  +L+                +    D +      + +   FG  +++Q   T
Sbjct: 363 KDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ---T 419

Query: 407 ASYRNARVTREEYYEHG 423
           A ++    T+++Y E+G
Sbjct: 420 AEFKGYCHTKKDYEEYG 436

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 113/257 (43%), Gaps = 48/257 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEADSSLKTAERI 271

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F  + +   +++           + N+ K         + I +
Sbjct: 272 KQEYCYVCPDIVKEFNKFDRQPEKFAQFI-----------IENQDKTTK------KVIDI 314

Query: 307 TDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEIA        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 315 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 371

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSV------PESDCALFGWEVMSQFSST 406
            +F++RL  +++            L    +  V V       + +   FG  +++Q   T
Sbjct: 372 KDFSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAVWFGGSLLAQ---T 428

Query: 407 ASYRNARVTREEYYEHG 423
           A ++    T+++Y EHG
Sbjct: 429 AEFKGYCHTKKDYEEHG 445

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 78/420 (18%), Positives = 159/420 (37%), Gaps = 90/420 (21%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP-----FRALNALAKDKFGT-----SYLSNHIKNIKDISS 54
           P+++DNGS  IK G + +++P         N LA+    T     +Y+ N     +  ++
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR--AT 69

Query: 55  VTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +    P+    +  W+    +WDY   N +E +   L+E   H +V + S  T  +  + 
Sbjct: 70  LHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIE--QLQE---HPVVLTNSMSTSKKEEEK 124

Query: 115 ADQVIFEEYEFDSLF--KSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSN 172
             +V+FE++   +++  + P+ +     ++                              
Sbjct: 125 MCEVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCS-------------------------- 158

Query: 173 NPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLS 232
                             +  G     I  V+ G+    + +  + GG  +T  + + L 
Sbjct: 159 ------------------VSCGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLR 200

Query: 233 FRH---YNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGY--V 287
             H    N  +   L+ +IKE+C  +S                     DF      Y  +
Sbjct: 201 HNHPKLENGQNGIELIRSIKERCCVLSK--------------------DFYNEIRAYELI 240

Query: 288 RNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRP 347
            ++   N     D   I +  E F  PE  F+P+    ++  + + I+ S+S    + R 
Sbjct: 241 TSKTSNNKYRLPDGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRS 300

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCAL--FGWEVMSQFSS 405
            ++ +IV +GG+  +  F +RL  E+++++  +    ++ P     L   G  V+S  S+
Sbjct: 301 QLLESIVLSGGSSLIKGFGERLTKEIRKEIDGNQKIMLNAPHERRFLPWIGGSVLSGLST 360

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 93/454 (20%), Positives = 167/454 (36%), Gaps = 108/454 (23%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP------------FRALNA--LAKDKFGTSYLSNHIKNIK 50
           P+V+DNGS  IK G S  E+P            +  + A  LA D   +  + N  + ++
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASD---SQLIGNEAQKMR 67

Query: 51  DISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPE 110
            +  + +  P E G +  W     +W + F+N ++    +      H ++ +E+ +   +
Sbjct: 68  GLLKLHY--PLEHGVVQDWPGLEQLWTHVFYNSLKLANIE-----EHPMLITEAPLNPMK 120

Query: 111 LSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMP 170
                 +++FE +   +++ S  A    +     +                         
Sbjct: 121 NRNKMCEMLFETFGSPAVYVSIQAVLALYAGGRTTG------------------------ 156

Query: 171 SNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGR----FLTGL 226
                              VID G  C   +PV  G     A++++DV GR    FL  L
Sbjct: 157 ------------------CVIDCGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLL 198

Query: 227 LKETLSFRHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGY 286
           L+++      +  +  I V  IKEK  FV+     +    +  ++ E      +T F   
Sbjct: 199 LRKSSGVTLSSSSEREI-VRMIKEKACFVATDVGNEEQNYEGANSAE-----LETRF--- 249

Query: 287 VRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVR 346
                        D + +TL  E F  PE  F P +       I E   +S+S +   +R
Sbjct: 250 ----------KLPDGKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLR 299

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFG--------WE 398
             +  +IV +GG+     F  RL +E+++          S P +   +F         W 
Sbjct: 300 SSLYSSIVLSGGSTMFSGFGDRLLSEIRK---------TSEPNTKIKIFAPPERKYSTWI 350

Query: 399 VMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
             S  +  +++    VTR E+ E+    C   RF
Sbjct: 351 GGSILAGLSTFEKLWVTRAEWQEN--PQCIHSRF 382

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 63/257 (24%), Positives = 111/257 (43%), Gaps = 48/257 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D ++     I
Sbjct: 205 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAEKI 262

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F        ++V+ + +       + RRK           + +
Sbjct: 263 KQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQE-------KTRRK----------VVDI 305

Query: 307 TDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEIA        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 306 GYERFLAPEIFFNPEIASSDFLTPLPMVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 362

Query: 363 PNFAQRLAAELQ----------------RQLPTDWTCHVSVPESDCALFGWEVMSQFSST 406
            +F +RL  +L+                +    D +      + +   FG  +++Q   T
Sbjct: 363 KDFGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ---T 419

Query: 407 ASYRNARVTREEYYEHG 423
           A ++    T+++Y E+G
Sbjct: 420 AEFKGYCHTKKDYEEYG 436

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 89/453 (19%), Positives = 169/453 (37%), Gaps = 105/453 (23%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIVIDNGS  IK G S  E+P    +  +     DK       G +++ N  + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 55  VTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +  R P + G +  W+    IW Y     ++    +      H L+ +E+ M   +  + 
Sbjct: 72  LRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQNIE-----EHPLLITEAPMNPLKNREM 126

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
             QV+FE +   +++ S  A    +           SG+                     
Sbjct: 127 IAQVMFETFNLSAIYVSDPAVLSLYA----------SGRTTGC----------------- 159

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFR 234
                          V+D G      +P+  G     ++ ++D+GG    G + E L F+
Sbjct: 160 ---------------VVDCGEGYCSSVPIYDGFALPASIMRMDIGG----GDITEQLQFQ 200

Query: 235 HYNMMDETI-------LVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYV 287
                  ++       +V  IKEK  +++     D+ K +DK+       D  ++F    
Sbjct: 201 IRKSAGVSLFSSSEREIVRTIKEKVCYLAK----DAKKEEDKYL--QGTQDLISAFK--- 251

Query: 288 RNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRP 347
                       D ++I + ++ +  PE  F P+I      G+    ++S+  +   +R 
Sbjct: 252 ----------LPDGKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRK 301

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV---PESD-CALFGWEVMSQF 403
            ++ +++ +GG   L  F  R+  +L+    T  T  + +   PE    A  G  +++  
Sbjct: 302 NLLSSVILSGGTTTLKGFGDRMLHDLEAL--TKGTSKIKIIAPPERKYTAWIGGSILTGL 359

Query: 404 SSTASYRNARVTREEYYEHGSDWCTKHRFGYQN 436
           S          T ++ +   SDW       Y N
Sbjct: 360 S----------TFQKLWTKKSDWLEDSNRVYSN 382

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 91/386 (23%), Positives = 150/386 (38%), Gaps = 86/386 (22%)

Query: 10  NGSYEIKFGPSTNEKPFRAL--------NALAKDKFGTSYLSNHIKNIKDIS----SVTF 57
           +GS    FG ST+   F +L        N LA  K GT  L  +I N   I+    S   
Sbjct: 66  SGSGRQYFGNSTSATAFNSLSSGSALMSNNLA-GKRGTEDLDFYIGNEALIAAQGPSYGL 124

Query: 58  RRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQ 117
             P   GQ+  W+     W+   F  +        E + H  + +E  +  PE  +   +
Sbjct: 125 SYPIRHGQVENWDHMERFWENSIFKYLR------TEPEDHCFLLTEPPLNPPENREQVAE 178

Query: 118 VIFEEYEFDSLFKSPVAAFVPFTKSYKSKM--KAISGKDEDADIVVSKSNEADMPSNNPR 175
           + FE +    L+ +  A          SK+  ++++G                       
Sbjct: 179 IFFESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGT---------------------- 216

Query: 176 DTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRH 235
                         VIDSG   T +IPV +G     A+K + + GR +T  +++ L  R 
Sbjct: 217 --------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RE 260

Query: 236 YNMMDETI-LVNNIKEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRK 292
               D ++     IK++  +V P  V  F+ F    +   ++V+   +       + RRK
Sbjct: 261 RGEEDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFVVESQE-------KTRRK 313

Query: 293 ENSPLAEDAQTITLTDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPL 348
                      + +  E F  PE FF+PEIA        P IV+  +++    P  VR  
Sbjct: 314 ----------VVDVGCERFMAPEIFFNPEIASSDFLTPLPTIVDHTIQA---CPIDVRKG 360

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQ 374
           +  NIV +GG+    +F +RL  +L+
Sbjct: 361 LYNNIVLSGGSTMFKDFGRRLQRDLK 386

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 75/165 (45%), Gaps = 10/165 (6%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVE---- 332
           D++ S L  ++R  R  +S    +   + L  E   +PE  F P +    + GI E    
Sbjct: 585 DWRNSILHLFLRGPRPHDSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAET 644

Query: 333 AILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            +L+     P  +      M  N+  TGGN  +P   +R+  E    LP     ++++  
Sbjct: 645 ILLKKFGSQPGKLSQTSIDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININM-S 703

Query: 390 SDCALFGWEVMSQFSSTAS-YRNARVTREEYYEHGSDWCTKHRFG 433
           SD +L  W+ M+  +     Y+   ++R+EY E+G D+  +H+ G
Sbjct: 704 SDPSLDAWKGMAALAQNEEEYKRTIISRKEYEEYGPDYIKEHKLG 748

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 79/386 (20%), Positives = 146/386 (37%), Gaps = 87/386 (22%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP----FRALNALAKDKF------GTSYLSNHIKNIKDISS 54
           PIVIDNGS  IK G S  EKP    +  +     DK       G +++ N  + ++ +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGLLR 73

Query: 55  VTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           + +  P E G +  W+    IW +     ++    +      H L+ +E+ M   +  + 
Sbjct: 74  LQY--PIEHGVVEDWDSMELIWAHILNEVLQLQNIE-----EHPLLITEAPMNPLKNREV 126

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
             QV+FE +   +L+ S  A    +           SG+                     
Sbjct: 127 MAQVLFETFNLPALYVSNPAVLSLYA----------SGRTTGC----------------- 159

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFR 234
                          VID G      +P+  G     ++ ++D+GGR +T  L+  L   
Sbjct: 160 ---------------VIDCGEGYCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKS 204

Query: 235 HYNMM---DETILVNNIKEK-CLFVSPVSYFDSFKVKDKHALEYV--LPDFQTSFLGYVR 288
               +    E  +V  IKEK C   + +   ++  +++   L  V  LPD          
Sbjct: 205 AGVSLFSSSEREIVRTIKEKVCYLATDIKKEENTYMQESQDLTSVFKLPD---------- 254

Query: 289 NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPL 348
                        + I + ++ +  PE  F P+I      G+ +  ++S+  +   +R  
Sbjct: 255 ------------GKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTT 302

Query: 349 MVGNIVCTGGNFNLPNFAQRLAAELQ 374
           ++ +I+ +GG   L  F  R+  +L+
Sbjct: 303 LLSSIILSGGTTTLRGFGDRMLHDLE 328

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 76/165 (46%), Gaps = 10/165 (6%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEA--- 333
           D++ S L  ++R  R  +S        I +  E   +PE  F P I    + GI E    
Sbjct: 590 DWRNSVLHLFLRGPRPHDSEDPHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSET 649

Query: 334 -ILESLSMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
             L   +  P  +  +   M+ N+  TGG+  LP   +R+  E    LP      +++  
Sbjct: 650 LFLRKFNSSPRKLSSISERMLNNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINI-S 708

Query: 390 SDCALFGWEVMSQFSSTASY-RNARVTREEYYEHGSDWCTKHRFG 433
           +D +L  W+ M++ +S   Y +  +VT+++Y E+G ++  +H  G
Sbjct: 709 NDPSLDTWKGMAKLASNTDYLKKIQVTKKDYEEYGPEYMMEHNLG 753

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 93/442 (21%), Positives = 164/442 (37%), Gaps = 102/442 (23%)

Query: 17  FGPSTNEKPFRALNALA------KDKFGTS----YLSNHIKNIKDISSVTFRRPHELGQL 66
           FG ST+   F +L A A        K GT     Y+ N         S +   P   GQ+
Sbjct: 69  FGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSYSLSYPIRHGQV 128

Query: 67  TLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFD 126
             W+     W+   F  +        E + H  + +E  +  PE  +   ++ FE +   
Sbjct: 129 ENWDHMERFWENSIFKYLR------TEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 182

Query: 127 SLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKFDSDYHD 186
            L+ +  A          SK+                                  +D   
Sbjct: 183 GLYIAVQAVLALAASWTSSKV----------------------------------TDRSL 208

Query: 187 FQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETILVN 246
              VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R    +D ++   
Sbjct: 209 TGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLRT- 265

Query: 247 NIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQT--- 303
                           + ++K ++   YV PD    F  + R+  K    + E++++   
Sbjct: 266 ----------------AERIKQEYC--YVCPDIVKEFNKFDRDAGKFAQFIVENSESTKK 307

Query: 304 --ITLTDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
             + +  E F  PE FF+PEIA        P +V+   +++   P  VR  +  NIV +G
Sbjct: 308 KIVDVGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSG 364

Query: 358 GNFNLPNFAQRLAAELQ----------------RQLPTDWTCHVSVPESDCALFGWEVMS 401
           G+    +F +RL  +L+                +    D        + +   FG  +++
Sbjct: 365 GSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLA 424

Query: 402 QFSSTASYRNARVTREEYYEHG 423
           Q   TA +++   T+++Y E+G
Sbjct: 425 Q---TAEFKSYCHTKQDYEEYG 443

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 115/257 (44%), Gaps = 48/257 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 267

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F    +   ++V+ + +++       R+K           + +
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDGEKFAQFVVENQEST-------RKK----------IVDV 310

Query: 307 TDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEIA        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 311 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 367

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSV------PESDCALFGWEVMSQFSST 406
            +F +RL  +L+            L    +  V+V       + +   FG  +++Q   T
Sbjct: 368 KDFGRRLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGGSLLAQ---T 424

Query: 407 ASYRNARVTREEYYEHG 423
           A ++    T+++Y E+G
Sbjct: 425 AEFKGYCHTKKDYDEYG 441

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 113/257 (43%), Gaps = 48/257 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  +++ L  R     D ++     I
Sbjct: 210 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEQDTSLKTAERI 267

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F        ++V+   +       + R+K           + +
Sbjct: 268 KQEYCYVCPDIVKEFNKFDRDASKFAQFVVESQE-------KTRKK----------IVDV 310

Query: 307 TDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEIA        P +V+   E++   P  VR  +  NIV +GG+   
Sbjct: 311 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---ETIQACPIDVRKGLYNNIVLSGGSTMF 367

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSV------PESDCALFGWEVMSQFSST 406
            +F +RL  +++            L    +  V V       + +   FG  +++Q   T
Sbjct: 368 KDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQ---T 424

Query: 407 ASYRNARVTREEYYEHG 423
           A +++   T+++Y E+G
Sbjct: 425 AEFKSYCHTKKDYDEYG 441

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 97/439 (22%), Positives = 155/439 (35%), Gaps = 99/439 (22%)

Query: 5   PIVIDNGSYEIKFGPSTNEKP----FRALNALAKDKF-------GTSYLSNHIKNIKDIS 53
           PIVIDNG+  IK G +   KP    +  +     DK          S++ N  +  + I 
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGI- 72

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P   G +  W+    IW Y F + +  +  +L E   H ++ +E     P L+ 
Sbjct: 73  -LKLRHPMLRGVVQNWDDMETIWQYVFDDTLYLE--NLNE---HPILITE-----PPLNN 121

Query: 114 HAD-----QVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEAD 168
            A+     + +FE + F +++ S      P    Y S                       
Sbjct: 122 MANRQKMCEALFEIFGFPAVYIS----VSPVLSLYASGQTT------------------- 158

Query: 169 MPSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLT---- 224
                                 +D G      IPV  G     +VKK+D+GG  +T    
Sbjct: 159 -------------------GCAVDCGDGYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQ 199

Query: 225 -GLLKETLSFRHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSF 283
             +LK T  F + +   E  +V  IKEK                      Y+  D+    
Sbjct: 200 FSILKNTGLFMYSS--SEREIVRTIKEKVC--------------------YIATDYNLET 237

Query: 284 LGYVRNRRKENSPLA-EDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLP 342
             Y+ N  K  S     D + + ++   +T  E  F PE+       + E   +S+  + 
Sbjct: 238 EKYLFNEEKMASQFKLPDGKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVD 297

Query: 343 EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQ 402
             +R  +  NIV +GG    P F  RL  ELQ     D    +  P  +     W   S 
Sbjct: 298 SDLRLPLYSNIVLSGGTTMCPGFGSRLLKELQTLTGYDTKIRIIAP-PERKYTSWIGGSI 356

Query: 403 FSSTASYRNARVTREEYYE 421
            S  +++    VT+  + E
Sbjct: 357 LSGLSTFSKIWVTKSMWEE 375

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 108/254 (42%), Gaps = 42/254 (16%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R    +D ++     I
Sbjct: 217 VIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLL--RERGEVDTSLRTAERI 274

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F    +   +YV           V N+ K         + + +
Sbjct: 275 KQEYCYVCPDIVKEFNKFDRDAEKFAQYV-----------VENQDKTRQ------KVVDI 317

Query: 307 TDELFTIPETFFHPEIAQITKPGIVEAIL-ESLSMLPEIVRPLMVGNIVCTGGNFNLPNF 365
             E F  PE FF+PEIA       +  +L +++   P  VR  +  NIV +GG+    +F
Sbjct: 318 GYERFLAPEIFFNPEIASSDFLTPLPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDF 377

Query: 366 AQRLAAELQ----------------RQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASY 409
            +RL  +L+                R    D        + +   FG  +++Q   T  +
Sbjct: 378 GRRLQRDLKSIVNNRIAETERLSGARSTGVDVQVISHRKQRNAVWFGGSLLAQ---TPEF 434

Query: 410 RNARVTREEYYEHG 423
           +    T+++Y E+G
Sbjct: 435 KGYCHTKKDYEEYG 448

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 116/257 (45%), Gaps = 48/257 (18%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R    +D ++     I
Sbjct: 211 VIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLL--RERGEVDTSLRTAERI 268

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F   D+ A ++        F+  V N+ K         + + +
Sbjct: 269 KQEYCYVCPDIVKEFNKF---DRDATKFA------QFI--VENKEKTQK------KVVDV 311

Query: 307 TDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEIA        P +V+   +++   P  VR  +  NIV +GG+   
Sbjct: 312 GYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 368

Query: 363 PNFAQRLAAELQ----------RQLPTDWTCHVSVP------ESDCALFGWEVMSQFSST 406
            +F +RL  +L+            L    +  V V       + +   FG  +++Q   T
Sbjct: 369 KDFGRRLQRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVWFGGSLLAQ---T 425

Query: 407 ASYRNARVTREEYYEHG 423
           A +++   T+++Y E+G
Sbjct: 426 AEFKSYCHTKKDYEEYG 442

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 98/449 (21%), Positives = 176/449 (39%), Gaps = 102/449 (22%)

Query: 10  NGSYEIKFGPSTNEKPFRALNA---LAKD---KFGTSYLSNHIKNIKDISS----VTFRR 59
           N S    FG ST+   F  LN    L+ +   K GT  L  +I N   ++S     +   
Sbjct: 68  NSSATPYFGNSTSATSFNNLNKNMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSYSLSY 127

Query: 60  PHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVI 119
           P   GQ+  W+     W+   F  +        E + H  + +E  +  PE  +   ++ 
Sbjct: 128 PIRHGQVENWDHMERFWENSIFKYLR------TEPEDHFFLLTEPPLNPPENREQIAEIF 181

Query: 120 FEEYEFDSLFKSPVAAFVPFTKSYKSKM--KAISGKDEDADIVVSKSNEADMPSNNPRDT 177
           FE +    L+ +  A          SK+  ++++G                         
Sbjct: 182 FESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGT------------------------ 217

Query: 178 QKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYN 237
                       VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R   
Sbjct: 218 ------------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERG 263

Query: 238 MMDETI-LVNNIKEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKEN 294
            +D ++     IK++  +V P  V  F+ F        ++++ + +       + R+K  
Sbjct: 264 EVDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDGSKFAQFIVENQE-------QTRKK-- 314

Query: 295 SPLAEDAQTITLTDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMV 350
                    + +  E F  PE FF+PEIA        P +V+  +++    P  VR  + 
Sbjct: 315 --------VVDVGYERFLAPEIFFNPEIASSDFLTPLPTVVDHTIQA---CPIDVRKGLY 363

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQ----------RQLPTDWTCHVSV------PESDCAL 394
            NIV +GG+    +F +RL  +L+           +L    +  V V       + +   
Sbjct: 364 NNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSERLSGTKSTGVDVQVISHRKQRNAVW 423

Query: 395 FGWEVMSQFSSTASYRNARVTREEYYEHG 423
           FG  +++Q   TA +++   T+++Y E+G
Sbjct: 424 FGGSLLAQ---TAEFKSYCHTKKDYEEYG 449

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/388 (19%), Positives = 154/388 (39%), Gaps = 91/388 (23%)

Query: 5   PIVIDNGSYEIKFGPSTNEKPFRAL-----------NALAKDKFGTSYLSNHIKNIKDIS 53
           P+VIDNGS  IK G S  E+P +AL             + +   G +++ N+ + ++ + 
Sbjct: 14  PVVIDNGSGIIKAGFSGEERP-KALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL- 71

Query: 54  SVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +  R P + G +  W+    IW Y     ++     L+    H L+ +E+ M   +  +
Sbjct: 72  -LKLRYPIKHGVVEDWDSMELIWSYVLNEVLQ-----LQNIGEHPLLITEAPMNPLKNRE 125

Query: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173
              QV+FE ++  +L+ S  A    +           SG+                    
Sbjct: 126 QMAQVLFETFDVSALYVSNPAVLSLYA----------SGRTTGC---------------- 159

Query: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233
                           V+D G      +P+  G     ++ ++D+GG  +T    E L F
Sbjct: 160 ----------------VVDCGEGYCSTVPIYDGFALPASMMRMDIGGADIT----EQLQF 199

Query: 234 RHYNMMDETI-------LVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGY 286
           +       ++       +V  +KEK  +++      + K +++  L+    D  ++F   
Sbjct: 200 QLRKSAGVSLFSSSEREIVRTMKEKVCYLAK-----NIKKEEEKYLQGT-QDLISTF--- 250

Query: 287 VRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVR 346
                    P   D + I + ++ +  PE  F P+I  +   G+ +  ++S+  +   +R
Sbjct: 251 -------KLP---DGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLR 300

Query: 347 PLMVGNIVCTGGNFNLPNFAQRLAAELQ 374
             ++ +I+ +GG   L  F  R+  +L+
Sbjct: 301 KPLLSSIILSGGTTTLKGFGDRMLWDLE 328

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/254 (23%), Positives = 114/254 (44%), Gaps = 42/254 (16%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D ++     I
Sbjct: 216 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADTSLRTAERI 273

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F  + +   ++++ +         +++ K+        + + +
Sbjct: 274 KQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN---------QDKTKQ--------KVVDI 316

Query: 307 TDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEIA        P +V+  +++    P  VR  +  NIV +GG+   
Sbjct: 317 GYERFLAPEIFFNPEIASSDFLTPLPTVVDHTIQA---CPIDVRKGLYNNIVLSGGSTMF 373

Query: 363 PNFAQRLAAELQ-----RQLPTDWTCHVSVPESDCALFG--------WEVMSQFSSTASY 409
            +F++RL  +++     R +  +    V     D  +          W   S  + TA +
Sbjct: 374 KDFSRRLQRDIKSIVNSRIIQNEAVTGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEF 433

Query: 410 RNARVTREEYYEHG 423
           ++   T+++Y E+G
Sbjct: 434 KSYCHTKKDYEEYG 447

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 88/192 (45%), Gaps = 29/192 (15%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D T+     I
Sbjct: 201 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLRTAERI 258

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V    V  F+ F    +   ++++ + +       + RRK           I +
Sbjct: 259 KQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSE-------KTRRK----------VIDV 301

Query: 307 TDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEIA        P IV+   +++   P  VR  +  NIV +GG+   
Sbjct: 302 GYERFLAPEIFFNPEIASSDFLTPLPTIVD---QTIQACPIDVRKGLYNNIVLSGGSTMF 358

Query: 363 PNFAQRLAAELQ 374
            +F +RL  +L+
Sbjct: 359 KDFGRRLQRDLK 370

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 95/442 (21%), Positives = 167/442 (37%), Gaps = 102/442 (23%)

Query: 17  FGPSTNEKPFRALNALA------KDKFGTS----YLSNHIKNIKDISSVTFRRPHELGQL 66
           FG ST+   F +L + A        K GT     Y+ N         S +   P   GQ+
Sbjct: 64  FGNSTSATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSYSLSYPIRHGQV 123

Query: 67  TLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFD 126
             W+     W+   F  +        E + H  + +E  +  PE  +   ++ FE +   
Sbjct: 124 ENWDHMERFWENSIFKYLR------TEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 177

Query: 127 SLFKSPVAAFVPFTKSYKSKM--KAISGKDEDADIVVSKSNEADMPSNNPRDTQKFDSDY 184
            L+ +  A          SK+  ++++G                                
Sbjct: 178 GLYIAVQAVLALAASWTSSKVVDRSLTGT------------------------------- 206

Query: 185 HDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI- 243
                VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R     D T+ 
Sbjct: 207 -----VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEEDTTLR 259

Query: 244 LVNNIKEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDA 301
               IK++  +V    V  F+ F    +   ++++ + +       + +RK         
Sbjct: 260 TAERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSE-------KTKRK--------- 303

Query: 302 QTITLTDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357
             I +  E F  PE FF+PEIA        P +V+   +++   P  VR  +  NIV +G
Sbjct: 304 -VIDVGYERFLAPEIFFNPEIASSDFLTPLPTVVD---QTIQACPIDVRKGLYNNIVLSG 359

Query: 358 GNFNLPNFAQRLAAELQ----------RQLPTDWTCHVSVP------ESDCALFGWEVMS 401
           G+    +F +RL  +L+            L    +  V V       + +   FG  +++
Sbjct: 360 GSTMFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLA 419

Query: 402 QFSSTASYRNARVTREEYYEHG 423
           Q   TA +++   T+++Y E G
Sbjct: 420 Q---TAEFKSYCHTKQDYEEIG 438

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 114/258 (44%), Gaps = 50/258 (19%)

Query: 190 VIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI-LVNNI 248
           VIDSG   T +IPV +G     A+K + + GR +T  ++  L  R    +D ++     I
Sbjct: 214 VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEVDTSLKTAERI 271

Query: 249 KEKCLFVSP--VSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQTITL 306
           K++  +V P  V  F+ F   D+   ++      + F+  + N+ K    +      + +
Sbjct: 272 KQEYCYVCPDIVKEFNKF---DRDVGKF------SQFI--IENQGKTQKKI------VDV 314

Query: 307 TDELFTIPETFFHPEIAQ----ITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362
             E F  PE FF+PEIA        P IV+  +++    P  VR  +  NIV +GG+   
Sbjct: 315 GYERFLAPEIFFNPEIASSDFLTPLPTIVDHTIQA---CPIDVRKGLYSNIVLSGGSTMF 371

Query: 363 PNFAQRLAAELQRQLPTDWTCHVSV-----------------PESDCALFGWEVMSQFSS 405
            +F +RL  +L R +  D      +                  + +   FG  +++Q   
Sbjct: 372 KDFGRRLQRDL-RSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAQ--- 427

Query: 406 TASYRNARVTREEYYEHG 423
           TA +++   T+ +Y E+G
Sbjct: 428 TAEFKSYCHTKRDYEEYG 445

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 73/167 (43%), Gaps = 14/167 (8%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIA---QITKPGIVEA 333
           D++ S L  ++R  R  +         + +  E   +PE  F P +    Q   P + E 
Sbjct: 579 DWRNSVLHLFLRGPRPHDGESIHHQHQMHMNIERIRVPEVLFQPNMGGEDQAGIPELCET 638

Query: 334 ILESLSMLPEIVRPL------MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV 387
           +L  L       R L      M  N+  TGGN  LP   +R+  E    LP+     +  
Sbjct: 639 LL--LRKFGSTQRQLSDVSTSMAQNVWITGGNAKLPGLRERIVKEFSEFLPSGSPFSIRK 696

Query: 388 PESDCALFGWEVMSQFS-STASYRNARVTREEYYEHGSDWCTKHRFG 433
            + D +L  W  M++ + +T  +++  +T++EY E+G ++  +H  G
Sbjct: 697 SQ-DPSLDAWRGMAKLAQNTEDFKHGYITKQEYLEYGPEYIKEHNLG 742

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 67/158 (42%), Gaps = 9/158 (5%)

Query: 283 FLGYVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEA----ILESL 338
           F  ++R  R  +S    +   + +  E   +PE  F P +    + GI E     I +  
Sbjct: 591 FHLFLRGPRPHDSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKF 650

Query: 339 SMLPEIVRPL---MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALF 395
              P  +      M  N+   GGN  +P    R+  E    LP+D   +V++ E+   L 
Sbjct: 651 GSTPRNLSQQSLDMAKNVWLVGGNAQVPGLKSRVVKEFTEFLPSDTKINVNISEA-PTLD 709

Query: 396 GWEVMSQFSSTAS-YRNARVTREEYYEHGSDWCTKHRF 432
            W  M + ++T   Y+   VT EEY E G D+  +H+ 
Sbjct: 710 VWNGMYRLANTEEDYQRTIVTSEEYDECGVDYLKEHKL 747

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 75/165 (45%), Gaps = 10/165 (6%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILE 336
           D++ S L  ++R  R  +S    +   + L  E   +PE  F P I    + GI E    
Sbjct: 582 DWRNSVLHLFLRGPRPHDSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCET 641

Query: 337 SLS-MLPEIVRPL------MVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPE 389
            LS       R L      M  NI  TGG+  LP   +R+  E    LP      V + +
Sbjct: 642 ILSNKFGSKPRELSETSLGMAKNIWLTGGHSKLPGLRERIVKEFTGFLPVGTKLGVKMSK 701

Query: 390 SDCALFGWEVMSQFSST-ASYRNARVTREEYYEHGSDWCTKHRFG 433
            + +L  W  M + +   A Y+++ +++++Y E+G+++  +H+ G
Sbjct: 702 -NPSLDAWYGMRKLAQNEADYKDSIISKKDYEEYGAEYIKEHKLG 745

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 50/106 (47%), Gaps = 1/106 (0%)

Query: 328 PGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVS 386
           PGIV+ I  S+      +R  +  NIV TGG   +P F+ RL  EL ++LP   +    +
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTT 454

Query: 387 VPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
               +     W   S  SS  ++    V ++EY E G+D   K RF
Sbjct: 455 GQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + I  S+      +R  +  N+V TGG  +LP    R++AEL R LP   +    S 
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 388 PESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
              +    GW   S  +S  ++    V ++EY E G+D   K RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 70/357 (19%), Positives = 125/357 (35%), Gaps = 82/357 (22%)

Query: 2   ETAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTF-RRP 60
           E   +VID GS+    G S  + P     A+    +G  Y       +    S+   R+ 
Sbjct: 13  EITAVVIDPGSFTTNIGYSGTDCP----QAILPSCYG-KYTEGEKDELFSEQSIGLPRKD 67

Query: 61  HEL------GQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +E+      G++  WE     WD+   + + F+        G   + +E      E  K 
Sbjct: 68  YEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFE-----TNSGMPALLTEPIWNSEENRKK 122

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
           + +V+ E  +F + +  P A  V F     +                             
Sbjct: 123 SLEVLLESMDFSACYLVPTATAVSFAMGRPTC---------------------------- 154

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFR 234
                         LV+D G + T + PV+ G+   K+  +  + G  L  L++  L+ R
Sbjct: 155 --------------LVVDIGHDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPR 200

Query: 235 HYNMMDETILVNNI-KEKCL----------FVSPVSYFDSFKVKDKHALEYVLPDFQTSF 283
               + +      +  E+            FV+   +F  F    K  +  V P   + F
Sbjct: 201 KVIPLFQVAQRRPVFMERKFDYEIHPSLQKFVNERQFFQEF----KETMLQVAPTSISKF 256

Query: 284 LGYVR--NRRKENSPLAED-----AQTITLTDELFTIPETFFHPEIAQITKPGIVEA 333
              +   ++R   +P  E+      Q +   ++LFT P+    PE   I+K G+VE 
Sbjct: 257 KSEIETTSKRSIEAPWGEELVYDSLQRLEFAEQLFT-PDLSQFPEDWPISKDGVVET 312

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           GIV+ I +S+      +R  +  N+V TGG   +P  + R+  EL + LP   +    S 
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 388 PESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
              +    GW   S  +S  ++    V REEY E G +   K RF
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 60/146 (41%), Gaps = 21/146 (14%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETILVNNI 248
           LV+D G + + + PV+ G+   K+  +  V G++L  L+ + L  R         +   +
Sbjct: 156 LVVDIGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREI-----VPIFQVL 210

Query: 249 KEKCLFVSPVSYFD------------SFKVKDKHALEYVLPDFQTSFLGYV--RNRRKEN 294
           K+K  FV     FD             F  + K  L ++ P   +SF   +  + +R   
Sbjct: 211 KKKPDFVKRTLSFDVNESVINFANERQFFQEFKETLLHIAPKSLSSFKDELATQTKRSLE 270

Query: 295 SPLAEDAQTITLTDELFTIPETFFHP 320
           +P  E  + I   D  ++  E  F P
Sbjct: 271 APWGE--ELIFDADTRYSFAEQLFRP 294

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 1/106 (0%)

Query: 328 PGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVS 386
           PGIV+ I  S++     +R  +  N+V TGG   +P  + R+  EL ++LP   +    +
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 387 VPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
               +     W   S  SS  ++    V ++EY E G+D     RF
Sbjct: 457 GQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + I  S+      +R  +  N+V TGG+ ++P    R+ AEL + LP   +    S 
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSG 434

Query: 388 PESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
              +     W   S  +S  ++    V ++EY E G+D   K RF
Sbjct: 435 QAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 72/358 (20%), Positives = 133/358 (37%), Gaps = 85/358 (23%)

Query: 2   ETAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIK-NIKDISSVTF-RR 59
           E   I+ID GS+    G S  + P     A+    +G  Y+++  K ++ +  S+   R+
Sbjct: 13  EITAIIIDPGSFNTNIGYSGTDCP----QAILPSCYG-QYINDEEKPSLFNEQSIGLPRK 67

Query: 60  PHEL------GQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
            +E+      G++  W+     W++   + + F+       KG   + +E      +  K
Sbjct: 68  DYEIKEIVRSGEVVDWDKAQEQWEWAIKSVLLFES-----NKGLPALLTEPIWNSEDNRK 122

Query: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173
            + +V+ E  +F++ + +P A  V F     +                            
Sbjct: 123 KSLEVLLEGMDFEACYLTPTATAVSFAMGRPT---------------------------- 154

Query: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233
                          LV+D G + T + PV+ G+   K+  +  + G  L  L++ +L  
Sbjct: 155 --------------CLVVDIGHDITSVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKP 200

Query: 234 RHYNMMDETILVN----------NIKEKCL-FVSPVSYFDSFKVKDKHALEYVLPDFQTS 282
           R    + +                I    L FV+   +F  F    K  +  V P   T 
Sbjct: 201 REILPLFQVAKKRPEFVKRSFDYEIHPSLLNFVNERQFFQEF----KETMLQVAPTSLTK 256

Query: 283 FLGYVR--NRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQ------ITKPGIVE 332
           F   +   ++R   +P  ED   +  ++  F I E  F PE A+      I+K G+VE
Sbjct: 257 FKSELEQLSKRSIEAPWGED--LVFDSETRFNIAEQLFRPETAKFPEDWPISKDGVVE 312

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 54/125 (43%), Gaps = 2/125 (1%)

Query: 309 ELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQR 368
           E   +P+     +I  I  PGI + +  +++     +R  +  N++ TGG   +P  A R
Sbjct: 472 ENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADR 530

Query: 369 LAAELQRQLPT-DWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWC 427
           L  EL ++LP   +    S    +     W   S  +S  ++    V + EY E G D  
Sbjct: 531 LMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPDRL 590

Query: 428 TKHRF 432
            K RF
Sbjct: 591 LKDRF 595

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 9/109 (8%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-----DWTC 383
           G+ + +  +++     +R  +  N+V TGG+ ++P    RL  EL ++LP        + 
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSG 435

Query: 384 HVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
           H+   +S   L G    S  SS  ++    V R+EY E G++   K RF
Sbjct: 436 HLRERQSRAWLGG----SILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 57/143 (39%), Gaps = 11/143 (7%)

Query: 2   ETAPIVIDNGSYEIKFGPSTNEKPFRALNA-----LAKDKFGTSYLSNHIKNIKDISSVT 56
           E + +VID GSY    G S  + P   + +      A  K G    ++    I       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFM-IMPRPDFE 71

Query: 57  FRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            +R  E G +  WE     W +   + ++F+ F     KG     +E+     E  K + 
Sbjct: 72  IKRILENGCVVDWEAAQEQWAWAIRDELKFESF-----KGTPAFLTEAIWNPEENRKKSL 126

Query: 117 QVIFEEYEFDSLFKSPVAAFVPF 139
           +V+ E  EF++ + +P A    F
Sbjct: 127 EVLLEGMEFEACYIAPTATCTSF 149

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-----DWTCHVSVPESDCALFGWEV 399
           +R  +  NIV TGG  ++P F+ RL +EL ++LP        T H+   +    L G   
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRERQYQAWLGG--- 447

Query: 400 MSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
            S  +S  S+    V ++EY E G D     RF
Sbjct: 448 -SILTSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 66/147 (44%), Gaps = 16/147 (10%)

Query: 293 ENSPLAED-AQTITLTDELFTIP-ETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMV 350
           E +P  ED A T   T+E    P E     E+A     GI + +  S++     +R  + 
Sbjct: 345 EETPSGEDQASTSETTNEHGKRPMEDSESSELA-----GISDLVHSSITSADVDLRATLA 399

Query: 351 GNIVCTGGNFNLPNFAQRLAAELQRQLPT-----DWTCHVSVPESDCALFGWEVMSQFSS 405
            NIV TGG+ ++P F+ RL  EL ++LP        T H+   +    L G    S  +S
Sbjct: 400 HNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTGHLRERQYQSWLGG----SILTS 455

Query: 406 TASYRNARVTREEYYEHGSDWCTKHRF 432
             S+    V + EY E G++     RF
Sbjct: 456 LGSFHQLWVGKREYEEVGAERLLNDRF 482

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + I  S+      +R  +  N+V TGG  ++P    R+ AEL + LP   +    S 
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSG 451

Query: 388 PESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
              +     W   S  SS  ++    V ++EY E G+    K RF
Sbjct: 452 HLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 90/242 (37%), Gaps = 55/242 (22%)

Query: 2   ETAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKN-IKDISSVTFRRP 60
           E   IVID GSY    G S ++ P   + +       T+   N  K  +    S+   RP
Sbjct: 11  EITSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARP 70

Query: 61  H-------ELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSK 113
                   E G++  W+     WD+   N +    F LK   G  ++ +E      E  K
Sbjct: 71  DYEIKRIVENGEIADWDTAQEQWDWVLKNEL----F-LKSNSGIPVLLTEPIWNSVENRK 125

Query: 114 HADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNN 173
            + +V+ E  +F++ + SPV+  V F                           A  P+  
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFA--------------------------AGRPNC- 158

Query: 174 PRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSF 233
                          LV+D G + T + PV+ G+   K+  +  + GR++  L++  L  
Sbjct: 159 ---------------LVVDIGHDTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKP 203

Query: 234 RH 235
           R 
Sbjct: 204 RE 205

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 47/109 (43%), Gaps = 9/109 (8%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-----DWTC 383
           GI + +  S+      +R  +  N+V TGG   +P    RL  EL ++LP        T 
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTG 469

Query: 384 HVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
           H+   +    L G    S  +S  ++    V +EEY E G+D     RF
Sbjct: 470 HLREKQYQAWLGG----SILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 50/113 (44%), Gaps = 1/113 (0%)

Query: 321 EIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTD 380
           EI + +  G+ + +  S+      +R  +  N+V TGG   +P  + RL AEL  +LP  
Sbjct: 372 EITKGSLLGVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPAL 431

Query: 381 WTCHVSVPESDCALF-GWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
               ++   +    +  W   S  +S  ++    V +EEY + G D     RF
Sbjct: 432 KFRMITTGHTRERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 9/93 (9%)

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-----DWTCHVSVPESDCALFGWEV 399
           +R  +  N+V TGG+ ++   A RL  EL ++LP        + H+   +S   L G   
Sbjct: 392 LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALKFRILTSGHLRERQSRAWLGG--- 448

Query: 400 MSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
            S  SS  ++    V R+EY E G++   K RF
Sbjct: 449 -SILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 37.0 bits (84), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 46/239 (19%), Positives = 83/239 (34%), Gaps = 53/239 (22%)

Query: 2   ETAPIVIDNGSYEIKFGPSTNEKPFRALNA-----LAKDKFGTSYLSNHIKNIKDISSVT 56
           E + +VID GSY    G S  + P   + +        +K G    ++    +       
Sbjct: 13  EISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKKSFNDQFMGMAR-PDFE 71

Query: 57  FRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHAD 116
            +R  E G +  WE     W +   + ++F  F     KG     +E+     E  K + 
Sbjct: 72  IKRILEDGCVVDWEAAQEQWTWAIRDELKFGSF-----KGTPAFLTEAIWNSEENRKKSL 126

Query: 117 QVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRD 176
           +V+ E  EF++ + +P A  V F     +                               
Sbjct: 127 EVLLEGMEFEACYIAPTATCVSFAMGRPT------------------------------- 155

Query: 177 TQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRH 235
                       LV+D G +   + PV+ G+   K+  +  + G+ L  L+++ L  R 
Sbjct: 156 -----------CLVVDIGHDVASVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 49/106 (46%), Gaps = 1/106 (0%)

Query: 328 PGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV 387
           PGIV+ I  S+S     +R  +  N+V TGG+  +P  + R+  EL  + P      ++ 
Sbjct: 387 PGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLAT 446

Query: 388 PES-DCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
            +S +     W   S  SS  ++    + ++EY E GS+     R 
Sbjct: 447 GQSIERQYQSWLGGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRL 492

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 65/151 (43%), Gaps = 14/151 (9%)

Query: 278 DFQTSFLG-YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVE---A 333
           D++ S L  ++R  R  +S        + L  E   +PE  F P +    + GI+E    
Sbjct: 582 DWRNSTLHLFLRGPRPHDSEDIHQQHQMHLNVERIRVPEILFQPSMGGQDQAGIIELCET 641

Query: 334 IL------ESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSV 387
           IL      E   + P  +   M  N+  TGGN  LP   +R+  E    LP     +V  
Sbjct: 642 ILTKKFGSEQRKLSPTAL--AMANNLWITGGNSKLPGMKERIVKEFTGFLPVGTAFNVK- 698

Query: 388 PESDCALFGWEVMSQFS-STASYRNARVTRE 417
              + +L  W  M++ + ++  Y+N  ++++
Sbjct: 699 QSYNPSLDAWNGMAKLTLNSEDYKNTIISKK 729

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 63/290 (21%), Positives = 107/290 (36%), Gaps = 69/290 (23%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETL----------------- 231
           LV+D G +   + P++ G     AV +    G FL   + E L                 
Sbjct: 141 LVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLDYQVAENLKNSLPIEPAGEDSKVPE 200

Query: 232 SFRHYNMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRR 291
           SF+++        +++ K   L VSP    +   ++D  A  +   D +  FL      +
Sbjct: 201 SFKYWE--SSRTWIHDFKATMLQVSPSKIQELEGMQDTMAFSHNPLDNKKYFL-----YK 253

Query: 292 KENSPLAEDAQTITLTD-ELFTIPETFFHPEIAQ---ITKPGIVEAILESL--------- 338
           K N       +T+TL   E + + E  F P++A      K G+ E +++++         
Sbjct: 254 KGN-------KTLTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVKKAGAAVTT 306

Query: 339 -----------------------SMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375
                                  +  PE +   ++ NIV TG    +P   QR+  EL  
Sbjct: 307 SNSGPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSY 366

Query: 376 QLPTDWTCHVSVPES-DCALFGWEVMSQFSSTASYRNAR-VTREEYYEHG 423
           Q P       + P   D  L  W+     S+  S+     +TR+EY  +G
Sbjct: 367 QFPQYKLSSFANPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANG 416

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 3/113 (2%)

Query: 321 EIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT- 379
           +I +IT  G+ + +  S+      +R  +  N+V TGG  ++P  + RL  EL + LP+ 
Sbjct: 378 DIKEIT--GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSL 435

Query: 380 DWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
            +    +    +     W   S  +S  ++    V ++EY E G D     RF
Sbjct: 436 KFRILTTGHTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 47/237 (19%), Positives = 88/237 (37%), Gaps = 58/237 (24%)

Query: 2   ETAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTF-RRP 60
           E + +VID GSY    G S ++ P   L ++    +G S      K I    S+   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKSTSDKDSKTIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W +   N +  D        G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALKNELYLDS-----NSGIPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
           + +V+ E  +F++ + +P +  V F                           A  P+   
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA--------------------------AGRPNC-- 155

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETL 231
                         LV+D G +   + P++ G+   K+ ++  + G+F+  L+K+ +
Sbjct: 156 --------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 65/146 (44%), Gaps = 9/146 (6%)

Query: 296 PLAEDAQ---TITLTDELFTIPETFFHP--EIAQITK---PGIVEAILESLSMLPEIVRP 347
           P AED     T TL +   T+ E    P  +I++ TK    G+ + +  ++      +R 
Sbjct: 351 PKAEDTSATTTETLDNISDTVNENGKRPVDDISEPTKNDIAGLADLVYSAIIKSDVDLRA 410

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPESDCALF-GWEVMSQFSST 406
            +  N+V TGG+ ++P  + RL  EL R+LP      +S   +    +  W   S  +S 
Sbjct: 411 SLAHNVVLTGGSSSIPGLSDRLILELNRRLPALKFRILSTGHTKERQYQAWLGGSILTSL 470

Query: 407 ASYRNARVTREEYYEHGSDWCTKHRF 432
            ++    V + EY E G +     RF
Sbjct: 471 GTFHQLWVGKNEYNEVGVERLLMDRF 496

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 78/211 (36%), Gaps = 26/211 (12%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDE------- 241
           L++D G     + PV+ G     A+ +    G FL   + + LS +      E       
Sbjct: 94  LIVDLGAAKATVTPVIDGTVVQAAIGRSRFAGDFLDLQVGKLLSEKDDKQNGEESHEPTP 153

Query: 242 -------TILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNR---- 290
                     + + K   L V+P    D     D  AL+ +   +  +FL Y R +    
Sbjct: 154 LELWRNSRTWIQDFKSYMLQVAPSKLQD----LDSAALDMMGLSYVKNFL-YRRQKTISL 208

Query: 291 -RKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESL--SMLPEIVRP 347
            +KE   LAE     +   + F   E         + K G   A   S   +  PE +  
Sbjct: 209 MQKECCALAEGLFQPSYVSQQFASSEGLSEIVAKAVKKAGASTATNSSATNATTPEQIHA 268

Query: 348 LMVGNIVCTGGNFNLPNFAQRLAAELQRQLP 378
            ++ NIV TG +  +P   QR+  +L  Q P
Sbjct: 269 ALLTNIVITGSSSLIPGLEQRIVNDLSYQFP 299

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-----DWTCHVSVPESDCALFGWEV 399
           +R  +  N+V TGG  ++P  + RL  EL + LP+       T H+   +    L G   
Sbjct: 399 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHIRERQYQSWLGG--- 455

Query: 400 MSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
            S  +S  ++    V ++EY E G +     RF
Sbjct: 456 -SILTSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 45/237 (18%), Positives = 88/237 (37%), Gaps = 58/237 (24%)

Query: 2   ETAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTF-RRP 60
           E + +VID GSY    G S ++ P   L ++    +G      + K +    S+   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKLTADENSKKMFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W +   N +  D        G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALRNELYLDS-----NSGIPALLTEPVWNSMENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
           + +V+ E  +F++ + +P +  V F                           A  P+   
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA--------------------------AGRPNC-- 155

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETL 231
                         LV+D G +   + P++ G+   K+ ++  + G+F+  L+++ L
Sbjct: 156 --------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + +  S+      +R  +  N+  TGG   +P  + RL  EL  +LP   +    + 
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 388 PESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
            + +     W   S  +S  ++    V R+EY E G+D     RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 88/237 (37%), Gaps = 58/237 (24%)

Query: 2   ETAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTF-RRP 60
           E + +VID GSY    G S ++ P   L ++    +G        KNI    S+   R+ 
Sbjct: 13  EISAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W +   N +      L    G   + +E      E  K 
Sbjct: 69  YELKPIVKDGLVIDWDTAQEQWQWALKNELY-----LNSNSGTPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
           + +V+ E  +F++ + +P +  V F                           A  P+   
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA--------------------------AGRPNC-- 155

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETL 231
                         LV+D G +   + P++ G+   K+ ++  + G+F+  L+K+ L
Sbjct: 156 --------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 39/89 (43%), Gaps = 1/89 (1%)

Query: 345 VRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSVPESDCALFGWEVMSQF 403
           +R  +  N+V TGG   +P  + RL  EL + LP+  +    +    +     W   S  
Sbjct: 400 LRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTGHTMERQYQSWLGGSIL 459

Query: 404 SSTASYRNARVTREEYYEHGSDWCTKHRF 432
           +S  ++    V ++EY E G +     RF
Sbjct: 460 TSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 46/105 (43%), Gaps = 1/105 (0%)

Query: 329 GIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPT-DWTCHVSV 387
           G+ + +  S+      +R  +  N+V TGG  ++P  + RL  EL + LP+  +    + 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 388 PESDCALFGWEVMSQFSSTASYRNARVTREEYYEHGSDWCTKHRF 432
              +     W   S  +S  ++    V ++EY E G +     RF
Sbjct: 444 HTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 47/237 (19%), Positives = 87/237 (36%), Gaps = 58/237 (24%)

Query: 2   ETAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTF-RRP 60
           E + +VID GSY    G S ++ P   L ++    +G        K I    S+   R+ 
Sbjct: 13  EVSAVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKD 68

Query: 61  HEL------GQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKH 114
           +EL      G +  W+     W +   N +      L    G   + +E      E  K 
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALQNELY-----LNSNSGIPALLTEPVWNSTENRKK 123

Query: 115 ADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNP 174
           + +V+ E  +F++ + +P +  V F                           A  P+   
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFA--------------------------AGRPNC-- 155

Query: 175 RDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETL 231
                         LV+D G +   + P++ G+   K+ ++  + G+F+  L+K+ L
Sbjct: 156 --------------LVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 85/216 (39%), Gaps = 32/216 (14%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETILVNNI 248
           LV+D G   + + P++ G     AV +    G FL   + E L+       +E    NN 
Sbjct: 138 LVVDVGAAKSTVTPIIDGTVVQTAVARSKFAGDFLDMQVNELLTKIAPIKDEEEGDPNNR 197

Query: 249 KEKCLFV--SPVSYFDSFKVKDKHALEYVLPDFQTSFLG-----YVRNRRKENSPLAEDA 301
           K+  L +  +  ++   FK          L D  ++ L      Y++N       L +  
Sbjct: 198 KDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQDLDSAALDMMGLTYIKNF------LLQKQ 251

Query: 302 QTITLTD-ELFTIPETFFHPE-IAQ--ITKPGIVEAILESLS---------------MLP 342
           +TI+LT  +   + E  F P  ++Q  +   G+ E + +S+                  P
Sbjct: 252 KTISLTQKQCCELAEGLFQPRSVSQQFVAAEGLSEIVAKSVKKAGASTATSSSATNVTTP 311

Query: 343 EIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLP 378
           E     ++ NI+ TG +  +    QR+  +L  Q P
Sbjct: 312 EQTHAALLTNILITGSSSLISGLEQRIVNDLSYQFP 347

>YNR023W Chr14 (670418..672118) [1701 bp, 566 aa] {ON}  SNF1273 kDa
           subunit of the SWI/SNF chromatin remodeling complex
           involved in transcriptional regulation; homolog of Rsc6p
           subunit of the RSC chromatin remodeling complex;
           deletion mutants are temperature-sensitive
          Length = 566

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 67  TLWELESCIWDYCFFNPIEFDGFDLK 92
           T  +LES  W Y   NP++FDG D+K
Sbjct: 259 TTPKLESVKWQYDPNNPVDFDGLDIK 284

>KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {ON}
           similar to uniprot|Q75BT7 Ashbya gossypii ACR184C
           ACR184Cp and weakly similar to uniprot|Q12406
           Saccharomyces cerevisiae YPR034W ARP7 Actin-related
           protein involved in transcriptional regulation subunit
           of the chromatin remodeling Snf/Swi complex
          Length = 438

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 59/141 (41%), Gaps = 22/141 (15%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLT-----GLLKETLSFRHYNMMDETI 243
           +V+D G +   +  V+ G+ + +  K+  +GG FL        LK+          D T 
Sbjct: 146 IVVDIGHSGVKVDVVIDGVLFKQYRKENKIGGAFLNWQICDQYLKQDSGKSTKIWRDATE 205

Query: 244 LVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLP-DFQTSFLGYVRNRRKENSPLAEDAQ 302
            + N K   L VSP+    ++ V   H    V P D   +FL               D +
Sbjct: 206 WLPNFKNSMLQVSPIELDANYDVA-PHYQHMVSPMDLTKNFL--------------LDKK 250

Query: 303 TITLTD-ELFTIPETFFHPEI 322
           T+T T+ +L+TI E  F P I
Sbjct: 251 TLTFTNKQLYTIGELLFKPVI 271

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 59/145 (40%), Gaps = 10/145 (6%)

Query: 189 LVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFL----TGLLKETL-SFRHYNMMDETI 243
           LVID G   T + P++ G      V K   GG FL      LL+E L S  H    +   
Sbjct: 148 LVIDVGARGTTVTPIVDGTVVRSGVMKSRFGGDFLDYQVAKLLEEPLGSSSHEAWYNSAT 207

Query: 244 LVNNIKEKCLFV--SPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRN--RRKENSPLAE 299
            +   K   L V    +S  + +        +        ++  Y+ N   +K N  L +
Sbjct: 208 WIREFKSTMLQVCDKNLSELERYHRDQLLLQQQQQQQLGGAYHNYMTNPLTQKRNFLLKK 267

Query: 300 DAQTITL-TDELFTIPETFFHPEIA 323
           + +T+TL   + + + E  F P++A
Sbjct: 268 NNKTVTLELRDCYRVCEYLFQPQLA 292

>Suva_8.423 Chr8 (763701..764351) [651 bp, 216 aa] {ON} YOR367W
           (REAL)
          Length = 216

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 2/74 (2%)

Query: 289 NRRKENSPLAED--AQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVR 346
            R K+  P++ D  A   +L ++L  + ++ F PE  Q  K  + E++L   +   ++++
Sbjct: 9   GRTKKYLPMSYDKKADVTSLDEDLRQLRQSKFSPEAVQHIKKWVFESVLAEAAPPDDLLQ 68

Query: 347 PLMVGNIVCTGGNF 360
            L  G ++C   N 
Sbjct: 69  CLKDGTVLCKLANI 82

>KNAG0K01750 Chr11 (366717..367961) [1245 bp, 414 aa] {ON} Anc_3.158
           YDL033C
          Length = 414

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 10/62 (16%)

Query: 37  FGTSYLSNHIKNIKDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKG 96
           F   YL N   NI  +   T       G+ T+W     +W Y     I   G  + +GKG
Sbjct: 238 FLREYLPNEPGNIITLDPAT-------GEKTVWGRHDGLWSYTVGQKI---GIPMPQGKG 287

Query: 97  HH 98
           HH
Sbjct: 288 HH 289

>KNAG0I02650 Chr9 complement(513892..520167) [6276 bp, 2091 aa] {ON}
           Anc_6.373 YCR093W
          Length = 2091

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%)

Query: 247 NIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSP 296
           ++ EK LF+      D+F  K +   + + P++ T F GY+ N+R +  P
Sbjct: 786 DVTEKVLFIVNNLTMDNFDEKIQGLKQALTPNYATWFSGYLVNQRAKTEP 835

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,430,249
Number of extensions: 2294846
Number of successful extensions: 6692
Number of sequences better than 10.0: 156
Number of HSP's gapped: 6623
Number of HSP's successfully gapped: 232
Length of query: 438
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 325
Effective length of database: 40,524,141
Effective search space: 13170345825
Effective search space used: 13170345825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)