Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1438.256ON1220122059410.0
YLR084C (RAX2)8.256ON1220122047970.0
Skud_12.1528.256ON1220122147660.0
Suva_10.1688.256ON1220122045870.0
NDAI0B023808.256ON1219122526040.0
NCAS0B049808.256ON1204121825420.0
TDEL0F038308.256ON1195121924300.0
ZYRO0C01804g8.256ON1209121923800.0
Kpol_392.108.256ON1226123223220.0
KAFR0B026908.256ON1210122522600.0
SAKL0H17204g8.256ON1211123122070.0
TPHA0B032508.256ON1215122921800.0
TBLA0E043908.256ON1278128220540.0
KNAG0G020008.256ON1202123719040.0
Kwal_56.235898.256ON1213124318060.0
KLTH0G13838g8.256ON1214122917640.0
CAGL0L12144g8.256ON1156118217060.0
Ecym_43158.256ON1212124717010.0
KLLA0F18975g8.256ON1200125116890.0
AGR095W8.256ON1201125116860.0
YPR184W (GDB1)7.541ON153641830.59
Smik_16.4487.541ON153641791.5
TBLA0F012404.282ON51570763.2
NDAI0H016905.546ON346152735.4
AEL345WsingletonON64591745.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.143
         (1220 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...  2293   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...  1852   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...  1840   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...  1771   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...  1007   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   983   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   940   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   921   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   899   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   875   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   854   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   844   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   795   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   738   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   700   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   684   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   661   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   659   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   655   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   654   0.0  
YPR184W Chr16 (902044..906654) [4611 bp, 1536 aa] {ON}  GDB1Glyc...    37   0.59 
Smik_16.448 Chr16 (764670..769280) [4611 bp, 1536 aa] {ON} YPR18...    35   1.5  
TBLA0F01240 Chr6 complement(309036..310583) [1548 bp, 515 aa] {O...    34   3.2  
NDAI0H01690 Chr8 (408605..409645) [1041 bp, 346 aa] {ON} Anc_5.5...    33   5.4  
AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic ho...    33   5.7  

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 2293 bits (5941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1152/1220 (94%), Positives = 1152/1220 (94%)

Query: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60
            MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS
Sbjct: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60

Query: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120
            FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG
Sbjct: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120

Query: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180
            TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL
Sbjct: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180

Query: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXX 240
            VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLI          
Sbjct: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNST 240

Query: 241  FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYE 300
            FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYE
Sbjct: 241  FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYE 300

Query: 301  VSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLL 360
            VSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLL
Sbjct: 301  VSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLL 360

Query: 361  AASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGL 420
            AASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGL
Sbjct: 361  AASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGL 420

Query: 421  ELYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPIP 480
            ELYQNTFSTYANNSLNEYGCSALV               GLTGESYIATNYIPDQNEPIP
Sbjct: 421  ELYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPIP 480

Query: 481  RVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNL 540
            RVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNL
Sbjct: 481  RVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNL 540

Query: 541  KYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQ 600
            KYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQ
Sbjct: 541  KYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQ 600

Query: 601  TPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNR 660
            TPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNR
Sbjct: 601  TPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNR 660

Query: 661  ISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVP 720
            ISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVP
Sbjct: 661  ISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVP 720

Query: 721  NYSKRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGDVLFS 780
            NYSKRVNSATNISIADNELFVFD                  FSLSLWAAGNNGNGDVLFS
Sbjct: 721  NYSKRVNSATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNGDVLFS 780

Query: 781  GTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYFS 840
            GTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYFS
Sbjct: 781  GTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYFS 840

Query: 841  NKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKVS 900
            NKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKVS
Sbjct: 841  NKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKVS 900

Query: 901  ALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSEL 960
            ALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSEL
Sbjct: 901  ALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSEL 960

Query: 961  IISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGN 1020
            IISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGN
Sbjct: 961  IISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGN 1020

Query: 1021 QKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQS 1080
            QKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQS
Sbjct: 1021 QKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQS 1080

Query: 1081 LLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNXXXXXXXXX 1140
            LLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTN         
Sbjct: 1081 LLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNPQSTSSQSP 1140

Query: 1141 XXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKP 1200
                            IDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKP
Sbjct: 1141 STSATSESKSKSEKKKIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKP 1200

Query: 1201 RIDENEMLDTVPPEKLMKFV 1220
            RIDENEMLDTVPPEKLMKFV
Sbjct: 1201 RIDENEMLDTVPPEKLMKFV 1220

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score = 1852 bits (4797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 922/1220 (75%), Positives = 1039/1220 (85%)

Query: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60
            MFVHRLWTLAF FL + SKASQL+NIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDA+S
Sbjct: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60

Query: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120
            FY+YTGQQNFTK I P T+SHGLVYYSNNTYIQLEDASDDTRIDKITPFG DSFILSGSG
Sbjct: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120

Query: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180
            TINNISVGNQILYNLSTLSM PIFNQSLG V+ VL +++S+YFGGNFSYNNGSM G+SAL
Sbjct: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180

Query: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXX 240
            +WD++S+T QLLPFGGFGENS+VNSI+KLN+DNI+FAG+FYTLDD S LI          
Sbjct: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNST 240

Query: 241  FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYE 300
             SLNAT LELGQRI LRYASWDSQGSTT AS+SLVCPN N +AWLYP TSGSLVCNLPYE
Sbjct: 241  SSLNATTLELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPYE 300

Query: 301  VSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLL 360
            VSPTKIRLYNSQ + SEI++FQILT+PSSSIMNLTYLDPLSGELKNC EFCPLYSRATLL
Sbjct: 301  VSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLL 360

Query: 361  AASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGL 420
            +ASQN SSSMDMITFID N TDVKW+SDFQDFAF NELPV+SLK +ALNSYG S+GLSGL
Sbjct: 361  SASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGL 420

Query: 421  ELYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPIP 480
            ELYQ+TFSTYAN+SLNEYGCSAL                GLTGESYIA  Y+PDQNEPIP
Sbjct: 421  ELYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPIP 480

Query: 481  RVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNL 540
            RVKFYPNIIH GHYTIN YTPGC+QDNTCS+RGIVNVT+WN QNNT+MKTY IYQNNDNL
Sbjct: 481  RVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNL 540

Query: 541  KYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQ 600
            KYDQI+SGYLDFSPEIVLEY+SGIY++NTATVVVAD+VNVITVSLD FN LS+ +N K++
Sbjct: 541  KYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKE 600

Query: 601  TPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNR 660
            T LNGI QYQKSNFT T  N+TKVGNTTLNLFPV NYPKN+SL  +IY++KL++GGVSNR
Sbjct: 601  TLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNR 660

Query: 661  ISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVP 720
            IS +DLN++FE+ SS+N+TIQGDV+GITKT QGLLI+GD+ SS+NQS V LFN SF  V 
Sbjct: 661  ISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSFENVF 720

Query: 721  NYSKRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGDVLFS 780
            N S+ VNSA NIS+A+N+  V D                  FSLSLWAAGNNG+GDVLFS
Sbjct: 721  NQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFS 780

Query: 781  GTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYFS 840
            G VSHM++ NLNGS  F NE++++ LN+  GIVPY GAYLNES +AYAYE D+LNKIYFS
Sbjct: 781  GAVSHMQYGNLNGSVRFLNENEIEPLNLEGGIVPYLGAYLNESATAYAYEVDSLNKIYFS 840

Query: 841  NKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKVS 900
            N+V PSWNWS+ IT+MLYA+NQT+L VS+ SS+TA+L+IF+LRN+T IANETLGSNA+++
Sbjct: 841  NEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTAELSIFDLRNLTMIANETLGSNARIN 900

Query: 901  ALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSEL 960
            ALVNFEKN S+LVGGDFQ+T+PNC+GLCLYNYE+K+WSTF NNTIFGE+TQLS  NSSEL
Sbjct: 901  ALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSFTNSSEL 960

Query: 961  IISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGN 1020
            IISGLF T+E+QSIRLGSFNL N TM+PLLSGSEGKLNSF VT++S+VAWNDTSLFIY N
Sbjct: 961  IISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTSLFIYRN 1020

Query: 1021 QKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQS 1080
            Q+WNITSLP + S I SVS I T+ +S+TLNKR  NN ++GSILLLNGNF + QYG LQS
Sbjct: 1021 QEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQYGYLQS 1080

Query: 1081 LLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNXXXXXXXXX 1140
            LLFDFQ WTPYFISE +N+SNYNP  FINRDVSTEFNSQ  L N+NITVT+         
Sbjct: 1081 LLFDFQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNITVTSPQSTSSQPP 1140

Query: 1141 XXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKP 1200
                            I RGFVVLIGLALALGTVSVLGI GVILAYVFKDPEGDYKPIKP
Sbjct: 1141 SSSASSESKSKSKKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIKP 1200

Query: 1201 RIDENEMLDTVPPEKLMKFV 1220
            RIDENEMLDTVPPEKLMKFV
Sbjct: 1201 RIDENEMLDTVPPEKLMKFV 1220

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 1840 bits (4766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 907/1221 (74%), Positives = 1029/1221 (84%), Gaps = 2/1221 (0%)

Query: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60
            MFVHRLWTL F FLAQASKASQLQNIKSLLDIEDNVLPNLNISQ+NSNAVQILGGVDA+S
Sbjct: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60

Query: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120
             Y+YTGQQNFTK ISPGTNS GLVYYSNNTYIQ+EDASDDTRIDKITPFG DSFILSGSG
Sbjct: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120

Query: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180
            TINN+ +GNQILYNLSTLSMAPIF+Q LG VE+VL+N TSVYFGGNFSYNNGSM GHSAL
Sbjct: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180

Query: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXX 240
            +WD++S+  QLLPFGGFGENSNVNSI+KLNDDNI+FAGKFYTLDDSS LI          
Sbjct: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNS 240

Query: 241  FSL-NATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPY 299
             SL NATKLELGQRI LRYA+WD QGSTT  SNSLVCPN N +AW+YPATSG+LVC LPY
Sbjct: 241  TSLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPY 300

Query: 300  EVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATL 359
            EVSPTK+RLYNSQD+  EI++FQILTNPS+SIMNLTYLDPLSG+LKNCDEFCPLYSRATL
Sbjct: 301  EVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATL 360

Query: 360  LAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSG 419
            L+ASQN SS MDMI+F+D NNTDVKWSSDFQDFAFANELPVT LK  A+NSYG S+GLSG
Sbjct: 361  LSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSG 420

Query: 420  LELYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPI 479
            LELYQ+TFSTYANNSLNEYGCSAL                GL GESYIAT Y+P+Q+EP 
Sbjct: 421  LELYQDTFSTYANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEPT 480

Query: 480  PRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDN 539
            PRV FYPNI+H GHY INTYTPGCVQD+TCSSRGIVNVT+WNPQN TMMKTYTIYQNNDN
Sbjct: 481  PRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDN 540

Query: 540  LKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKR 599
            LKYDQI+SGYLDFSPEI+LEY+SGI++SNTATVVVAD+VNVITV LD F+ LSE  N K 
Sbjct: 541  LKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE 600

Query: 600  QTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSN 659
              PLNG+ QYQKSNFT TTSN+TK+GNTTLN+F V+NYP N+SL  +   D+LI+GG +N
Sbjct: 601  YIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNN 660

Query: 660  RISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKV 719
             IS I LN+N E+  SE + IQGDV+G+T+T QGLLI+GDL SS+NQS+VLLFN SF  V
Sbjct: 661  HISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENV 720

Query: 720  PNYSKRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGDVLF 779
             NYS+ VNSA NIS+A+N+L VFD                  FSLSLW+AG+NGN DVLF
Sbjct: 721  FNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLF 780

Query: 780  SGTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYF 839
            SG VS M+F  LNGSA F +ED+VQALN+   +VPY  AYLNES +AYAYET+ LNKIYF
Sbjct: 781  SGAVSRMQFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYF 840

Query: 840  SNKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKV 899
            SN V+PSWNWS +ITRMLYANNQ++L V SESS+TA+L+IFNL+N T IANET+GSNAK+
Sbjct: 841  SNNVDPSWNWSTSITRMLYANNQSLLTVGSESSTTAELSIFNLKNFTMIANETMGSNAKI 900

Query: 900  SALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSE 959
            +ALVNFEKNSS+LVGG+FQ++KPNCSGLCLYNYE+KSWSTFFNNT FGE+TQLS + +S+
Sbjct: 901  NALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQ 960

Query: 960  LIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYG 1019
            L+ISGLF+T E+QS+RL SFNL N TM+PLL+G+EGK+NSFVVT+ S+VAWNDTSL IY 
Sbjct: 961  LVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYR 1020

Query: 1020 NQKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQ 1079
            +Q+WNITS+P +DS IGSVSTI+TN    TLN+RATNNA +G+ILLL+GNF++P YGNLQ
Sbjct: 1021 DQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQ 1080

Query: 1080 SLLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNXXXXXXXX 1139
             LLFDF+ W+PYF+SE SN+SN NPT FINRDVSTEFNSQI L NLN+T T         
Sbjct: 1081 GLLFDFETWSPYFVSESSNTSNRNPTIFINRDVSTEFNSQIPLSNLNVTETG-PQSASSQ 1139

Query: 1140 XXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIK 1199
                             IDRGFVVLIGLALALGTVSVLGI GVILAYVFKDPEGDYKPIK
Sbjct: 1140 FPSSSASSELKPKSKKRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKPIK 1199

Query: 1200 PRIDENEMLDTVPPEKLMKFV 1220
            PRIDENEMLDTVPPEKLMKFV
Sbjct: 1200 PRIDENEMLDTVPPEKLMKFV 1220

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score = 1771 bits (4587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 880/1220 (72%), Positives = 1013/1220 (83%)

Query: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60
            MFVHRLWTLA   L   SKASQLQ+IK+LLDIEDNVLP+LNISQ+N NA+QILGGVDA+S
Sbjct: 1    MFVHRLWTLALPLLTLGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS 60

Query: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120
            FY+YTGQQNFTK I   TNS GLVYYSNNTYI LE+A +DTRIDKITPFG DSFILSGSG
Sbjct: 61   FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG 120

Query: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180
            +IN + +GNQ+LYNLSTLSMA IF QSLG VE VLVNDTSVYFGGNFSYNNGSM GH AL
Sbjct: 121  SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL 180

Query: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXX 240
            VWD+ S+T QLLPFGGFGE+SNVNSI+KLNDDNI+FAGKFYTLDDSS+L           
Sbjct: 181  VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNAS 240

Query: 241  FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYE 300
             +LNAT LELGQRI LRYASWDSQGSTT  S+ LVCP+ + +AWLYP TSGSLVC LPYE
Sbjct: 241  STLNATTLELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYE 300

Query: 301  VSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLL 360
            V+PTKIRLYNS ++ ++I+LFQILTNPS SIMNLTYLDP+SGEL++CDEFCPLYSR TLL
Sbjct: 301  VAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLL 360

Query: 361  AASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGL 420
            +ASQN SSS+DMI+FID NNTDVKWSSDFQDFAFANEL VTSLK  ALNSYG+ +GLSGL
Sbjct: 361  SASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGL 420

Query: 421  ELYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPIP 480
            ELYQ+TFSTYANNSLNEYGCSAL                GLTG+SYIA +Y+P+Q +P P
Sbjct: 421  ELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTP 480

Query: 481  RVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNL 540
             V FYP+IIH GHYTINTYTPGCVQDNTCSSRGIVNVT+WNPQNNTMM+TY IYQNN+NL
Sbjct: 481  TVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNL 540

Query: 541  KYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQ 600
            KYD+I+SGYLDFSPEIV++Y+SGIY+SNTAT++VAD+VN+IT SLD+F++LSE  +VKR 
Sbjct: 541  KYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRH 600

Query: 601  TPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNR 660
            TPLNGI QYQ+SNFT TTSN TK+ NTTLNLF V+NYPKN+S+  ++Y+ KLI+GG  N 
Sbjct: 601  TPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNH 660

Query: 661  ISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVP 720
            IS ID N+N E+ SSEN+TIQGDVYG+T+T QGLLI+GD+RSSDN+STVL+FN SF  V 
Sbjct: 661  ISVIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVS 720

Query: 721  NYSKRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGDVLFS 780
            NYSK V +A NI++A+N+L VF+                  FSLSLW+AGNN N DVLFS
Sbjct: 721  NYSKAVENAINITLANNDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFS 780

Query: 781  GTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYFS 840
            G VS M+FS+L+GSA F NE  V+ALN+ +GIVPY GAYLNES  AYAY+T++L+KIYFS
Sbjct: 781  GAVSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFS 840

Query: 841  NKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKVS 900
            N V+PSWNWSN IT+M+YANNQT+LV+ SESS+TA+L+I NLRN TTIANETLGSNAK++
Sbjct: 841  NNVSPSWNWSNNITKMVYANNQTLLVIGSESSTTAELSILNLRNFTTIANETLGSNAKIN 900

Query: 901  ALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSEL 960
            A VNFEKNSS+LVGGDFQ++KPNC+GLC+YNYE+KSWSTFFNNTI GE+TQL+  N SEL
Sbjct: 901  AFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESEL 960

Query: 961  IISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGN 1020
            IISGLF T + QSIRLGSFNL N TMVPLL+GS GKLNSF VT+ S+VAWNDTSL IY +
Sbjct: 961  IISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKD 1020

Query: 1021 QKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQS 1080
            QKWN TSLP + S + SV+TI TNT S  L KRAT +A  GSILLLNGNF++PQYGNLQ 
Sbjct: 1021 QKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQG 1080

Query: 1081 LLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNXXXXXXXXX 1140
            LLFD Q WTPYF SE   +S+YNPT FINRDVS +FNSQI L N N+TVT+         
Sbjct: 1081 LLFDSQNWTPYFTSETLEASSYNPTIFINRDVSADFNSQIPLSNSNMTVTSPQSTSPLSP 1140

Query: 1141 XXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKP 1200
                            +DRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDY+PIKP
Sbjct: 1141 SSSASSEPNKKSKKKNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKP 1200

Query: 1201 RIDENEMLDTVPPEKLMKFV 1220
            RIDENEMLDTVPPEKLMKFV
Sbjct: 1201 RIDENEMLDTVPPEKLMKFV 1220

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score = 1007 bits (2604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/1225 (43%), Positives = 792/1225 (64%), Gaps = 21/1225 (1%)

Query: 7    WTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYKYTG 66
            W   FL L    +ASQL NIK++L++ +  +P LN++ +N +  Q+LG +D +SFY+Y G
Sbjct: 5    WVFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKG 64

Query: 67   QQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTINNIS 126
            QQNFT GI PG+NS+GL+YYSNNT IQLE+ S+DT I KITPFG DSFILSG+G+++  S
Sbjct: 65   QQNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYS 124

Query: 127  VGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWDAMS 186
            + NQ+LYNL+TLS+ PIFN S+ +V+T+L++D+ VYFGGNF+  NG+   HS ++WD+ S
Sbjct: 125  LTNQLLYNLTTLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTS 184

Query: 187  DTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXXFSLNAT 246
             + + L FGGFGENS +NSI+KLNDDNI+FAG+FYTLD+   LI          F  N+T
Sbjct: 185  SSTEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIF--NST 242

Query: 247  KLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYEVSPTKI 306
             +++GQ + L  ++WD+ G +T  S++ VCP+    +W+   T+GSL C LP+EV+PTKI
Sbjct: 243  TVDIGQLVPLSASTWDT-GESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKI 301

Query: 307  RLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAASQNA 366
            R+YNS +  ++++LF+ILTN +  IMNLTY+DP+S ELK+CD FCPLYS+A L  A  N 
Sbjct: 302  RIYNSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANT 361

Query: 367  SSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELYQNT 426
            +S  D I  +  N TD+KW+ +FQ+FAF N++ V+S++ +AL+SYG+++ LS  +LYQN 
Sbjct: 362  TSPSDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNA 421

Query: 427  FSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPIPRVKFYP 486
            ++ +AN++LNE  C++ +               GLTG++YI+T Y P+Q +P+P V F P
Sbjct: 422  YAVFANDTLNEPNCNS-IESSSSSSLSANDWEMGLTGQTYISTTYTPNQ-DPVPYVSFSP 479

Query: 487  NIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIF 546
             I + G Y+IN YTPGC QD+TCSSR IVNVTVW+    +++ T  IYQNN  LKYD+++
Sbjct: 480  QIKYPGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELY 539

Query: 547  SGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPLNGI 606
            SGYL  SP + +EY+SG+Y+SNT   VVADR+NV+  SL+     S   N      LNG+
Sbjct: 540  SGYLSSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGL 599

Query: 607  FQYQKSNFTGTTSNKT--KVGNTTLNLFPVNNYPKNASLLVEIYND-KLIVGGVSNRIST 663
             QYQ SNF+ ++S  T  K+ NT+LN   +  + KN S+  ++Y+D  L++G  +  I  
Sbjct: 600  LQYQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKV 659

Query: 664  IDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYS 723
            + LNEN +I+SS   ++ G+  G +    G+L YG+   S   + ++ +N +F ++PN++
Sbjct: 660  VKLNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFN 719

Query: 724  K--RVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGDVLFSG 781
            K   + +  N++I D EL V D                    LSLW++G+N N D +FSG
Sbjct: 720  KNSSITNVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSG 779

Query: 782  TVSHMEFSNLNGSASFKNEDQVQAL--NIGRGIVPYFGAYLNESVSAYAYETDALNKIYF 839
             ++ +++++LNGS +  N   V  +  N+      Y G +LN+S+S YA +TD+ +++ F
Sbjct: 780  AIALLDYTDLNGSIAIGNNFTVTNITNNVSSTNSLYTGLFLNDSLSIYASKTDSYSELLF 839

Query: 840  SNKVNPSWNWSNTITRMLYANNQTML-VVSSESSSTADLTIFNLRNMTTIANETLGSNAK 898
            SN  +  W++   I  M+Y+++QTML V SS+ +  ++L+I NL    TIANETL  N+K
Sbjct: 840  SNGYSAPWSFFEGINYMVYSSHQTMLAVASSDFNKNSELSILNLTTFETIANETLNVNSK 899

Query: 899  VSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSS 958
            ++ L+NFE NS+++VGG+F I + NCSGLCLYNY++  W TF N++I G + Q+ L N +
Sbjct: 900  INGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGT 959

Query: 959  ELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIY 1018
            +L++SGLFN +   S+ L   +L+ + +  +  G    L SF    + ++ WN   L  Y
Sbjct: 960  QLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESY 1019

Query: 1019 GNQKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNL 1078
             N  W  +++ S+ +   ++ +I       TL KR    + DG   ++NGN    +YG +
Sbjct: 1020 ENGAW--STIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADG--FIINGNIYDTEYGTI 1075

Query: 1079 QSLLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLN---ITVTNXXXX 1135
            Q+++++F+ W PY+I   +NS       F+NRD S  +NSQ  L N N   +T  +    
Sbjct: 1076 QAMIYNFKEWRPYYIISSTNSQ-IAGQIFMNRDDSALYNSQSVLQNPNNATVTTPSSTSS 1134

Query: 1136 XXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDY 1195
                                 IDRGFVVLIGLALALGTVS+LGI+G++LAY+FKD +G +
Sbjct: 1135 GTPSATHSSQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGSH 1194

Query: 1196 KPIKPRIDENEMLDTVPPEKLMKFV 1220
              + PR +E+EML+TVPPEKLMKF+
Sbjct: 1195 DALNPRTNEDEMLETVPPEKLMKFL 1219

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  983 bits (2542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1218 (45%), Positives = 786/1218 (64%), Gaps = 26/1218 (2%)

Query: 9    LAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYKYTGQQ 68
            L  L L     ASQL +++  L+I    +PNLN++ ++ N+ ++LGG+D++SFY+YTGQQ
Sbjct: 7    LGALLLIPQIYASQLSSLQENLNITHINIPNLNLTTDD-NSFELLGGIDSLSFYRYTGQQ 65

Query: 69   NFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTINNISVG 128
            NFT GI P +NS+GL YYSNNT+IQL + S D+RI++I PFG DSFILSG G++   S+ 
Sbjct: 66   NFTSGILPNSNSNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSLGGYSLS 125

Query: 129  NQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWDAMSDT 188
            NQ+L+NLS+ S+  IFNQ+L  V ++LV+ T V FGGNF+ +  S+ GHS  +W+  +++
Sbjct: 126  NQLLFNLSSFSLKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANS 185

Query: 189  AQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXXFSLNATKL 248
              LLPF GFGENS +NSI KLNDDNI+FAGKFYTLD+S++L              N + +
Sbjct: 186  TSLLPFVGFGENSLINSITKLNDDNILFAGKFYTLDNSTLLNVVNDTMR------NISDI 239

Query: 249  ELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYEVSPTKIRL 308
             LGQ I L  A+W S GS      + VCP+    AW    TSG+L CNLP++V+PTKIR+
Sbjct: 240  NLGQLIPLSAATWSSTGS-FFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFDVAPTKIRI 298

Query: 309  YNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAASQNASS 368
            YNS D  +EI+LF+I ++PS SIMNLTY+DP+ G+LK+CD FCPLY++  L +AS+N + 
Sbjct: 299  YNSPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTL 358

Query: 369  SMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELYQNTFS 428
            S +MI  ++ N +D++WS DFQ+FAF N+L  +SL+ +ALNSYG ++GLS  ++YQ+ ++
Sbjct: 359  SSEMIELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYA 418

Query: 429  TYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPIPRVKFYPNI 488
             +ANNSLNE  C++L                G+  ++Y+ T YIP Q   +P V F+P++
Sbjct: 419  IFANNSLNEPSCNSL-ESFSSSDLSNNTWTRGMDDQNYVKTTYIPHQG-VLPEVTFHPDL 476

Query: 489  IHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIFSG 548
             +SG Y+I  YTPGC QDNTCSSRGIVNVTVWN  NN+++ T  IYQNND LKYD+++SG
Sbjct: 477  KYSGQYSIELYTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSG 536

Query: 549  YLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPLNGIFQ 608
            YL++SP+I + Y SGIYS  TA  VV DR+N++  SLD  N   EI+N      LNG+FQ
Sbjct: 537  YLNYSPKITVTYHSGIYSGTTAGTVVVDRLNIMINSLDILN---EIHNSTNSLELNGLFQ 593

Query: 609  YQKSNFTGTTSNKT--KVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNRISTIDL 666
            YQ SNF+ ++ + +  +V NT++N   +  +  N SL   +YND L+VG   + +S  +L
Sbjct: 594  YQLSNFSTSSKDSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYEL 653

Query: 667  NENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYSKRV 726
            N++  I+SS  + I+G + G+     G+L+YGD  SS   S VL FN SF  + N +  +
Sbjct: 654  NKDLAIQSSSQQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPI 713

Query: 727  NSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGDVLFSGTVSHM 786
             +  NI+I D+EL VFD                  FSLSLW++G+N NGD LFSG +S +
Sbjct: 714  TNFANITIDDSELLVFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQV 773

Query: 787  EFSNLNGSASFKNEDQVQAL-NIGRGIVPYFGAYLNESVSAYAYETD-ALNKIYFSNKVN 844
            +F+NL+GS S  N     +L +IG    PY   +LN+SV+ Y  + D + +++ FS+   
Sbjct: 774  QFTNLSGSVSIANNLSATSLRSIGS---PYAAIFLNDSVTGYVLKNDSSTSEMIFSDGSK 830

Query: 845  PSWNWSNTITRMLYANNQTMLVVSSESSSTADLTIFNLRNMTTIANETLGSNAKVSALVN 904
              W W+  +  MLY  NQ+ML V S SS   +L+I NL +   +ANETL  N+ V  +V+
Sbjct: 831  APWRWTGYVDSMLYLTNQSMLAVGSSSSVNGELSILNLDSFKVLANETLNQNSSVKTMVH 890

Query: 905  FEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSELIISG 964
            FE+NSSILVGG+F I+   C GLCLYNY    W TF N TI G +T+L + N S+LII+G
Sbjct: 891  FERNSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLIIAG 950

Query: 965  LFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGNQKWN 1024
            +F+T+   S+ L   NL +  +V +  G +  +  F+  D+++ AWN+TSLF Y +  W 
Sbjct: 951  VFDTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNETSLFEYTSNSW- 1009

Query: 1025 ITSLP-SDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQSLLF 1083
               +P S+ +   ++ +I   T +D   K+  N+    ++L++ G      YG++Q++++
Sbjct: 1010 -VDIPISNSNSSTTIDSIGWTTTTDNNLKKRDNSETSNNVLIVKGQIYDNVYGHIQAMIY 1068

Query: 1084 DFQAWTPYF-ISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNXXXXXXXXXXX 1142
            +F+ W PY  I+ + +S+N     FI+RDVS  F+SQ+ L   N T +            
Sbjct: 1069 NFEEWIPYLSINSLVSSANQPAELFIDRDVSKLFDSQLALQVSNTTAS--ITASSSTPTP 1126

Query: 1143 XXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKPRI 1202
                          IDRGFVVLIGLALALGT++VLGIVGVILAY F+D +GDY  I PR+
Sbjct: 1127 TSSPKKKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDGDYDVITPRV 1186

Query: 1203 DENEMLDTVPPEKLMKFV 1220
            +E+EML TVPPEKLM+F+
Sbjct: 1187 NEDEMLKTVPPEKLMEFI 1204

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/1219 (41%), Positives = 748/1219 (61%), Gaps = 28/1219 (2%)

Query: 6    LWTLAFLFLAQA--SKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYK 63
            ++ L FL       S ASQL+N+K+   I +   P L+       A+Q+ GG +A++F +
Sbjct: 1    MYGLLFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFP---GEALQLFGGFNALTFPQ 57

Query: 64   YTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTIN 123
            Y GQ+NFT  I+  T+S G+VYYSN+T+I+L + S D+ ++KI PFG +SFIL GSG++ 
Sbjct: 58   YEGQENFTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLL 117

Query: 124  NISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWD 183
               +G Q+LYNLS LS+ PIF  SL DV  +L +    YFGGNFS++NGS +GHS   W+
Sbjct: 118  GYELGRQLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWN 177

Query: 184  AMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXXFSL 243
            + S+T  LLPFGGFGE S VNSI+KL+ DNI+F G+FYTLDD ++LI             
Sbjct: 178  SSSNTTSLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTN---- 233

Query: 244  NATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYEVSP 303
            ++  +E+ + + LR A+W++   ++  S++ +CPN    AW  P+TSGSL  +LPYE  P
Sbjct: 234  HSQSIEINELLPLRAATWNTDSDSSFDSSAFICPNSQKEAWSVPSTSGSLEASLPYESYP 293

Query: 304  TKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAAS 363
             K+R+YNS +  + ++LF+I+T PS+ IMNLTY+DPLSGEL NCD FCPL  + +L AA 
Sbjct: 294  KKVRIYNSPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAV 353

Query: 364  QNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELY 423
             N ++S   +  +D N TD++WS D+QDFAF N++ VT L+ +AL+SYGD++GLS  +LY
Sbjct: 354  ANGNTS--QVVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLY 411

Query: 424  QNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPIPRVK 483
            Q+T +TYANNSLNE GC +                 GL G+SY+  ++   Q E +P+V 
Sbjct: 412  QDTLTTYANNSLNEVGCES-NDIASTSALSDSEWQQGLFGQSYLVADFRTGQ-ETLPKVT 469

Query: 484  FYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYD 543
            FYP I ++G YT+N YTPGC  D TC+SR IVNVT+W+    +++ +  ++QNN+ +KYD
Sbjct: 470  FYPAINYAGQYTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYD 529

Query: 544  QIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPL 603
            Q++SG+L+ +P + LEY S I  +N + VVVADR+ VI  S+D        N      PL
Sbjct: 530  QVYSGHLETAPVLTLEYYSPISPNNPSNVVVADRLEVIVESVDILK-----NQTDETIPL 584

Query: 604  NGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNRIST 663
            NG+FQYQ SNFT +T +K  + NTTLN + V N+PKNASL   +YN+ L VGG  + ++ 
Sbjct: 585  NGMFQYQLSNFTNSTDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAA 644

Query: 664  IDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYS 723
            ++L+E+  + S+      G V GI+    G++++G    S    + L FN  FG   N  
Sbjct: 645  VELDEDLHVSSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLE 704

Query: 724  KRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGDVLFSGTV 783
              + + TN+S   +EL VF+                  F LSLW+AG N   D LFSG V
Sbjct: 705  TTLRTYTNVSFQQDELLVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAV 764

Query: 784  SHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYFSNKV 843
            +  +F  L GSAS  +   V   ++  G  PY   +LN+SV+AYAY   +++++YF N  
Sbjct: 765  TKNQFPGLYGSASIYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGK 824

Query: 844  NPSWNWSNTITRMLYANNQTMLVVSSESSSTAD-LTIFNLRNMTTIANETLGSNAKVSAL 902
               W W  TI  M Y+ N T+L + ++ S+    L++FNL +   +AN T+  N  +S++
Sbjct: 825  EGPWTWFGTINSMRYSKNSTILAIGTDGSTDEPILSLFNLTSFDVLANTTISENGTISSM 884

Query: 903  VNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSELII 962
            V F++NSS+LVGGD+ I+  +CSGLCLYNY+ K W+ F NN+I G +T++ L+ S +L+I
Sbjct: 885  VFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLI 944

Query: 963  SGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGNQK 1022
            SG  N     S+ L SFN++N+ + PL+  S G + SF+  DN ++ WN+TSL  Y +  
Sbjct: 945  SGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDGD 1004

Query: 1023 WNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQSLL 1082
            W       + SLI  V  I+  T+   L+KR T ++   +IL+   N+   +Y   Q+ +
Sbjct: 1005 WQNLEF-DNSSLISIVDVIAVKTEP-ALDKRQTFSSTFDAILVAGQNYA--EYP--QASI 1058

Query: 1083 FDFQAWTPYFISEISNSSN-YNPTFFINRDVSTEFNSQITLPNLNITVTNXXXXXXXXXX 1141
            ++FQ W PY+++  ++  +    TFF N+D S  ++SQ  L +     T           
Sbjct: 1059 YNFQRWLPYYVANKADDEDPSRTTFFTNQDDSQLYDSQ-NLLSDPTRTTTSSSSSTTSSS 1117

Query: 1142 XXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKPR 1201
                           I+RGFVVLIGLALALGTV ++GI GV+LA VF    G Y+ + PR
Sbjct: 1118 QTSPSKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQVDPR 1176

Query: 1202 IDENEMLDTVPPEKLMKFV 1220
             DE+EM+DTVPPEKL+KF+
Sbjct: 1177 ADESEMIDTVPPEKLLKFL 1195

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1219 (41%), Positives = 746/1219 (61%), Gaps = 23/1219 (1%)

Query: 9    LAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYKYTGQQ 68
            L+F FL   +  SQL +++ LL+  +  +P L+++ + + A+++LG    ++FYKYTGQ+
Sbjct: 7    LSFYFLLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQE 66

Query: 69   NFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTINNISVG 128
            NFT  ++  T+SHGL+YYSN+T++QL + S+DT I +I P G+DSFILSGSG I+  ++ 
Sbjct: 67   NFTSPLNSSTDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQ 126

Query: 129  NQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWDAMSDT 188
             Q+ YNL+ LS  PIF + L +V ++LV+   VYFGGNF+++NGS  GHS ++W++  ++
Sbjct: 127  RQLHYNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNS 186

Query: 189  AQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXXFSLNATKL 248
              LLPF GFG+NS VNSI++L+ DNI+FAG FY LDD  +L              N T +
Sbjct: 187  TSLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDV 246

Query: 249  ELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYEVSPTKIRL 308
            ELG  I L+ A+W S  S+   ++  +CP+    +WL   TSGSL C+LP E +P KIR+
Sbjct: 247  ELGLAIPLQNANWTSS-SSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRI 305

Query: 309  YNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAASQNASS 368
            YNS    +E++LF+IL  P+  I+NL+Y+DP  GEL+ CD FCPLY+R  L  AS N+SS
Sbjct: 306  YNSPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSS 365

Query: 369  SMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELYQNTFS 428
              +M TF D N TD+KW  DFQ+FAF N +P++S++ +AL+SYG ++GLS  + +Q+  S
Sbjct: 366  VENMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRAS 425

Query: 429  TYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPIPRVKFYPNI 488
             YANNSLN+  C  +                GL G++Y++T+Y+ DQ   IPRV F+P I
Sbjct: 426  IYANNSLNQPACGKM-QSYSNATISNNDWRQGLNGQTYLSTSYVEDQGN-IPRVTFHPQI 483

Query: 489  IHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIFSG 548
             + G+Y+I  YTPGC+ D TC+ R IVNVT+W+  +N  + +  IY+NN+ LKYD+++ G
Sbjct: 484  QYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDG 543

Query: 549  YLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPLNGIFQ 608
            +L  SP++ LEY S IY +N  +VVVAD +++   S D F         K+   LNGIFQ
Sbjct: 544  HLKSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFEKH------KKDITLNGIFQ 597

Query: 609  YQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIY-NDKLIVGGVSNRISTIDLN 667
            YQ SNFT   + K  +GNT+L++FP++ +  N+SL   +Y ND L++    ++ + I L+
Sbjct: 598  YQISNFTKNIT-KESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLD 656

Query: 668  ENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYSKRVN 727
            +N+ + SS++  +   V GI     GL+++GD  SS  Q   L FN SF      ++ V 
Sbjct: 657  KNWSVDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVE 716

Query: 728  SATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGDVLFSGTVSHME 787
              TNI +   EL VFD                  FSLS+W+AG N NGD++FSG VS  +
Sbjct: 717  RFTNIDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDND 776

Query: 788  FSNLNGSAS-FKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIYFSNKVNPS 846
            + NL G  S F+N   V + NI   I PY GAYLN++++AYAY+  + ++I FSN     
Sbjct: 777  YENLQGPVSLFQNGSAVSS-NIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGDEGP 835

Query: 847  WNWSNTITRMLYANNQTMLVVSS-ESSSTADLTIFNLRNMTTIANETLGSNAKVSALVNF 905
            W W+N+I  M+Y N   +L + +  S S   L++ NL     +ANETL   A+V++++ F
Sbjct: 836  WRWTNSIETMIYRNRDALLALGTSSSPSLPQLSVLNLTTSEVLANETLDKGAEVNSMILF 895

Query: 906  EKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANSSELIISGL 965
             KNS++L+GG+F  +  +C+GLCLYNY+ K WSTF N++I G+VTQ+ L NSSEL+I+G 
Sbjct: 896  GKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELLIAGS 955

Query: 966  FNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGNQKWNI 1025
                    + L S N+    M  LL G EG L SFVV+++ LV WNDTSL  Y N  W  
Sbjct: 956  LRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNTSWRH 1015

Query: 1026 TSLPSDDSLIGSVSTISTNTKSDTLNKRA---TNNAHDGSILLLNGNFTMPQYGNLQSLL 1082
             S  S+ +    +  I   +   +L KRA   +N+  DG  LL+ GN    Q  + Q+ +
Sbjct: 1016 IS-TSNSTSFTKLQDIHQVSLEHSLEKRANSSSNSNLDG--LLVYGN-DKTQGDSYQASI 1071

Query: 1083 FDFQAWTPYFIS-EISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNXXXXXXXXXX 1141
            +D+ +WTP FI+   S +SN  P  F+N+DVS  F S+  LPN     T+          
Sbjct: 1072 YDYYSWTPLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPN-PTNHTSSRSSSSSSSA 1130

Query: 1142 XXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPIKPR 1201
                           +DRG+VVLIGLALA+GTV V+G+ G+++AY+F +  G Y+ + P 
Sbjct: 1131 VTSNSGDKKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIAYMFGEDIGGYEFLSPP 1190

Query: 1202 IDENEMLDTVPPEKLMKFV 1220
             +  +  +T PP K  KF+
Sbjct: 1191 AEGTKAAETAPPAKSSKFL 1209

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1232 (41%), Positives = 755/1232 (61%), Gaps = 24/1232 (1%)

Query: 3    VHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFY 62
            + RL +L  + ++QAS   QL N+K  L I    +P +N   N +N +QIL  ++ ++FY
Sbjct: 5    IVRLISLGIIGVSQAS---QLTNVKDSLGINTVNIPQINFG-NTNNEIQILSNIEGLTFY 60

Query: 63   KYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTI 122
            +Y GQQNFT  I   +N+HGL+YYSN+T I+L + SD+T+ID+I P  +D+FILSGSGT+
Sbjct: 61   QYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTL 120

Query: 123  NNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVW 182
                + NQ+LYNLS LS+ P+FN  L +++++LV+   VYFGGNFSY + +   +S + W
Sbjct: 121  GGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISW 180

Query: 183  DAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVL---IXXXXXXXXX 239
            + ++    +LPF GFG+NS VNSILKL++DN++F G F TLDD S+L   I         
Sbjct: 181  NKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNST 240

Query: 240  XFSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPY 299
              S   T LEL Q+ISL+YASW S G    +S   +CPN    AW    T+G + CNL +
Sbjct: 241  SSSSTETNLELEQQISLKYASWASLGDLK-SSTQFICPNGQNEAWSSAGTTGEITCNLAF 299

Query: 300  EVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATL 359
            E S +KIR++NS     +IA F+I+T PS+ IMNLTYLDPL+ E+K CD FCPLYS   L
Sbjct: 300  EASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNAL 359

Query: 360  LAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSG 419
             A+S+NA++S     FI+GN T++ WS+D+Q+FAF N++PVT+L++IAL SYGD++GLSG
Sbjct: 360  QASSENATTSASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSG 419

Query: 420  LELYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPI 479
             +LYQN++S +ANNSLNE  C +                 GL  +SYIAT Y P  ++P 
Sbjct: 420  FQLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPG-DDPS 478

Query: 480  PRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDN 539
            P V FYP+I   G+YT+N YTPGC  D TCS RGIVNVT+W+   N ++ T  IYQNN+ 
Sbjct: 479  PLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNE 538

Query: 540  LKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKR 599
            +KYDQ+F G+LD++P++ LEY SGI   N+  VVVAD V+++ ++++    +  + +   
Sbjct: 539  MKYDQLFEGFLDYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTE 598

Query: 600  Q--TPLNGIFQYQ-KSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGG 656
            +   PLNG+FQYQ  +  +   ++  KV NT+LNLFPV+ +  + SL    YN+ L++GG
Sbjct: 599  ELKVPLNGMFQYQLSNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGG 658

Query: 657  VSNRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESF 716
                +  + L+    I+S+      G+V G      G++++G+   S+   + L +N +F
Sbjct: 659  SIAGVYALSLSNYTNIRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTF 718

Query: 717  GKVPNYSKRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGD 776
                N +  + + +N++  ++E+  F+                   SLS+W+AG+N  GD
Sbjct: 719  DSFGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGD 778

Query: 777  VLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNK 836
             LFSG ++  EF NLN SA        Q+L +  GI PY G YLN+S++AY Y++ + + 
Sbjct: 779  TLFSGLITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSN 838

Query: 837  IYFSNKVNPSWNWSNTITRMLYANNQTMLVVSSESS--STADLTIFNLRNMTTIANETLG 894
            I FSN +  +WN   +++   Y++N+TM V SS S+  S A+L + N   M  + NET  
Sbjct: 839  ILFSNGLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFD 898

Query: 895  SNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSL 954
             N+ ++++V+F +NSS+LVGGDF     NCS LCL N     WS+F +N   G +T L  
Sbjct: 899  VNSSINSIVSFGRNSSLLVGGDFTAPNTNCSNLCLLNLGNNQWSSF-SNKFDGTITGLEF 957

Query: 955  ANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTS 1014
            AN S L+ISG +       I LG  +LNN     LLS S+ K+NSF   + ++VAW+ ++
Sbjct: 958  ANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDSST 1016

Query: 1015 LFIYGNQKWNITSLPSDDSL--IGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTM 1072
            ++ Y    W+   +P+ +S   I +V  +S    S + N  + N   +  ++L+ G    
Sbjct: 1017 IYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDE--LILVFGELYS 1074

Query: 1073 PQYGNLQSLLFDFQAWTPYFISEISNSSNYNP-TFFINRDVSTEFNSQITLPNLNITVTN 1131
              YG +Q++ +DFQ W PY+I++  +S N +  + F+N+D+S  + SQ+ L N N T++ 
Sbjct: 1075 EDYGFVQAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNSTISI 1134

Query: 1132 XXXXXXXXXXXXXXXXXXXXX---XXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVF 1188
                                        I RG+VVLIGLALA+GTV++LGI GV +AY+F
Sbjct: 1135 SSTSSSSATTRSSSTSSTSLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIF 1194

Query: 1189 KDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
             D +G+Y  IKPRIDE+EMLDTVPPEKLMKF+
Sbjct: 1195 SDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1225 (41%), Positives = 752/1225 (61%), Gaps = 20/1225 (1%)

Query: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60
            M  H     +       S ASQL  +++ L I+    P L  S NN +++Q+LG  DA+S
Sbjct: 1    MRTHHKLIKSLSLFTTLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALS 60

Query: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120
             Y YTGQQNF+  I+P TNS+GLVYYSNNT IQL    DDTRI+ I P G DSFILSGSG
Sbjct: 61   LYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSG 120

Query: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180
            ++N  S+ NQ+ YNLS+LS+ PIFN +L  VE++LV++  VYFGGNF+++NG+  GHS  
Sbjct: 121  SLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVA 180

Query: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXX 240
            VW+  S++  LLPF GFGENS++N+IL+LNDDNI+FAG+FYTLDD+S+L           
Sbjct: 181  VWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLDDASLLTSNTSNA---- 236

Query: 241  FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYE 300
             + N   LEL   + L  A+W S  S   AS S +C N + +AW    T+G+L C+LPY+
Sbjct: 237  -TTNIYDLELSPLLPLNEATWSSDVSDFDAS-SFICVNPDSDAWFVSGTTGTLACSLPYD 294

Query: 301  VSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLL 360
             + TKIR+YNS D+ ++I+ F+++++PS SIMN+TY+DP +G L++CD +CPL SR TL 
Sbjct: 295  SALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLS 354

Query: 361  AASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGL 420
            +AS  A+S  +M   +  N T +KWS+++Q+F F N +  T L+ +ALNSYG ++ L+G 
Sbjct: 355  SASD-AASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGY 413

Query: 421  ELYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPIP 480
             LYQ+ ++ +ANNSLN   C++                 G +G++Y+ T Y  + ++PIP
Sbjct: 414  SLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYT-EGDDPIP 472

Query: 481  RVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNL 540
            +V F  N+ +SG Y IN YTPGC  D TCS+RG+VNVTV++  +++++ T  IYQNN+ L
Sbjct: 473  QVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEAL 532

Query: 541  KYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQ 600
            KYD++FSGYL  S  IVLEY+SGI S +T T VVADR N+   SLD    +S   N    
Sbjct: 533  KYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKN-GST 591

Query: 601  TPLNGIFQYQ-KSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSN 659
              LNG+FQYQ  +  +   S+  KVG T LN +P++ +  N+SL    Y++ L+VGG   
Sbjct: 592  VALNGLFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQ 651

Query: 660  RISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKV 719
             +  ++ + +    +S+N  ++G    +    +G+ +YG+   S      + +N SF   
Sbjct: 652  SVYALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPF 711

Query: 720  PNY-SKRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGDVL 778
              Y +  +++  N++  ++E+ VF+                   SLSLW+AG N NGD+L
Sbjct: 712  TQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLL 771

Query: 779  FSGTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNKIY 838
            F+G  S M +S  N S +    + VQ LN    I PY G Y+N S  AY Y+ D   ++Y
Sbjct: 772  FNGASSQMSYSFNNESINIGANNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVY 831

Query: 839  FSNKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTAD--LTIFNLRNMTTIANE-TLGS 895
            F+N   PSW W N +   +Y++NQ++L+  + SS  +   LT+ N      IANE     
Sbjct: 832  FTNGSQPSWQWPNDVVAAIYSDNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSSQ 891

Query: 896  NAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLA 955
             +++S +VNF  N++ ++GG+F +   NC GLCL+NY   +WS+F + +I G V  + L 
Sbjct: 892  QSQISGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLF 951

Query: 956  NSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSL 1015
            N SELI+SGLF+T+   SI + S NL N  +  L SG      SF V D  +VAWN+T+L
Sbjct: 952  NESELIVSGLFSTKNISSITMASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTAL 1011

Query: 1016 FIYGNQKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQY 1075
             IY +  W +  + + +S    V  ++  T +  L+KR T+++     +L++G      Y
Sbjct: 1012 SIYEDNVWTVERISNINS-SSVVDNLNYVTLASALSKRDTSSSD---AILVSGQLYDNSY 1067

Query: 1076 GNLQSLLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITVTNXXXX 1135
            G++Q++++DF +W PY +  I++ S+ +   FI+RD+S+  N+Q+ L   + TV+N    
Sbjct: 1068 GHIQAMVYDFSSWVPYLL--INSESDSSINAFIDRDMSSFTNTQVALLTNSGTVSNSSSS 1125

Query: 1136 XXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDY 1195
                                 IDRGFVVL+GLALALGTV+VLGI GVI+AYVF+D  G Y
Sbjct: 1126 TTSPGASASATSIPNKTHKRKIDRGFVVLLGLALALGTVAVLGIAGVIMAYVFRDDNGAY 1185

Query: 1196 KPIKPRIDENEMLDTVPPEKLMKFV 1220
            +PI PRIDENEM++TVPPEKLMK++
Sbjct: 1186 EPINPRIDENEMIETVPPEKLMKYI 1210

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1231 (39%), Positives = 725/1231 (58%), Gaps = 57/1231 (4%)

Query: 14   LAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYKYTGQQNFTKG 73
            L Q    SQL ++K  L+I+D  +P +++S + ++ + +LG  + ++FY+YTGQ+NFT  
Sbjct: 14   LCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGS 73

Query: 74   ISPGTNSHGLVYYSNNTYIQLEDASDD---TRIDKITPFGDDSFILSGSGTI-NNISVGN 129
            I+       L+YYSN T+I+L+  SD+     I+ I PFGDDSFILSG+GT+    ++  
Sbjct: 74   ITE--TEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQ 131

Query: 130  QILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWDAMSDTA 189
            Q+LYNLS+L    IFNQS+  V  +L +D  VYFGG F Y  G+  GHS ++W++ ++  
Sbjct: 132  QLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEI 191

Query: 190  QLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXXFSLNATKLE 249
            QLLPF GFG +S VNSIL+L++DNIVFAGKF TLDD+++L            S NAT +E
Sbjct: 192  QLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNS----SKNATDIE 247

Query: 250  LGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATS-GSLVCNLPYEVSPTKIRL 308
              Q I L++A W SQGS  L  +SL+CP+D+ + W    T+ G    +L  ++ P+K+R+
Sbjct: 248  FDQLIPLKHAGWSSQGS--LEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRI 305

Query: 309  YNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAASQNASS 368
            YN+ D+  +++LF+I+T+P++ IMNLTYLDP +GEL  CD +CPL S   L  A  N + 
Sbjct: 306  YNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTI 365

Query: 369  SMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELYQNTFS 428
            S D + +I  NNT++KW+S +Q+FAF NE+ V SL  +AL+SYG S+GL G E+YQN + 
Sbjct: 366  SSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYP 425

Query: 429  TYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPIPRVKFYPNI 488
            T+AN++LN+  C  +                G    SYI + Y  D    +P V FYPNI
Sbjct: 426  TFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTY--DGTGDLPSVNFYPNI 483

Query: 489  IHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIFSG 548
             ++G YT+N  TPGC  D +CSSRGIVNVTVW+  N+T++ T  IYQNN++ KYD ++SG
Sbjct: 484  TYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSG 543

Query: 549  YLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPLNGIFQ 608
            YL+ +P+I L++   I + ++ +++VADRV+VI  S+D     S+I        LNG+FQ
Sbjct: 544  YLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQ----SKIGLKTINETLNGLFQ 599

Query: 609  YQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNRISTIDLNE 668
            YQ SNFT  +++  K+GNTT+N + + N P N+ L    YN+ L+V G  N I+ + LN+
Sbjct: 600  YQISNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLND 659

Query: 669  NFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYSKRVNS 728
            +  I S +     G   GI     GLL  GD   S  Q + L +N +F    N    +  
Sbjct: 660  DLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNITR 719

Query: 729  ATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGDVLFSGTVSHMEF 788
              NI+I D+EL VF+                  F+LSLW+AG+N   D +  G VS  ++
Sbjct: 720  FNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQY 779

Query: 789  SNLNGSASFKNEDQVQALNIGR--GIVPYFGAYLNESVSAYAYET--DALNKIYFSNKVN 844
            + LNG+    + + +  + +    G   Y   Y+N+S +AYAY +  D+ + +  + + N
Sbjct: 780  TELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIA-RGN 838

Query: 845  PSWN----WSNTITRMLYANNQTMLVVSSESSST--ADLTIFNLRNMTTIANETLGSNAK 898
             S +    WS+ +  M+Y  + ++L V + +  T    L++FN+ N   I  E LG+ + 
Sbjct: 839  RSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFNISNSKMIGEENLGAKSS 898

Query: 899  VSALVNFEKNSSILVGGDFQITKPN--CSGLCLYNYETKSWSTFFNNTIFGEVTQLSLAN 956
            V+A+V F KNSS+LVGGDF I K +  CSGLCLYNY    WS F+NN+I G +T L   N
Sbjct: 899  VNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFN 958

Query: 957  SSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNS---LVAWNDT 1013
             ++L+ISG   T     I L   N+ +  +  L  GS   + SFV  D++   L+  +D 
Sbjct: 959  GTQLLISGNLYTENETGINLAKLNMASNEVTILRHGST-MVQSFVTFDHTTDELITQSDN 1017

Query: 1014 SLFIYGNQKW-NITSLPSDDSLIGSVSTI---STNTKSDTLNKRATNNAHDGSILLLNGN 1069
             +  Y N +W N+TS   +DSL      I    T++K D  N+           LL+NG+
Sbjct: 1018 EISYYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTSSKRDVSNRA----------LLVNGD 1067

Query: 1070 FTMPQYGNLQSLLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNITV 1129
                 YG++ ++L+DF+ W PYFI +  N+   +   F+N+D+S+ + +Q  L   N + 
Sbjct: 1068 LKHSTYGSVSAMLYDFEDWMPYFIVDGENAGRAS-NIFMNKDLSSLYTTQTILQGSNTST 1126

Query: 1130 TNXXXXXXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFK 1189
            +                          IDRGFVVLIGLALA+GTV+VLG  G I+AY F 
Sbjct: 1127 S------TTSSNMPSETSDKNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFA 1180

Query: 1190 DPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
              +G Y+P+KPR+DE +M+DTVPPEKLMKFV
Sbjct: 1181 GNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1229 (39%), Positives = 724/1229 (58%), Gaps = 28/1229 (2%)

Query: 3    VHRLWTLAFLF-LAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISF 61
            +  +  L  LF LA  + AS L NI  LL+I++  LPNLN + N SN++Q+LG V+ + F
Sbjct: 4    ISTIVRLVVLFSLANNATASSLSNILKLLNIQEFELPNLNFN-NTSNSIQLLGDVENLQF 62

Query: 62   YKYTGQQNFTKGISPGTNS-HGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120
            Y Y GQQNFT   + G +S + L+YYS++  IQLE  S+DT I KI P GDDSF+LSGSG
Sbjct: 63   YHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSG 122

Query: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180
             +N  ++G Q+LYNL+TLS+ PIF+Q LG++ ++LV++  VYFGG F+Y   S    S +
Sbjct: 123  HLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVI 182

Query: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXX-- 238
             W+  SD    LPF GFG +S VNSILKLNDDNI+F G F TL +SS+L           
Sbjct: 183  SWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNF 242

Query: 239  XXFSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLP 298
               + N++ ++L Q+ISL+YA+WD+ G+     N+ VC   +  AW+    SG+L  N P
Sbjct: 243  TNSTENSSTIQLEQQISLKYATWDA-GTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFP 301

Query: 299  YEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRAT 358
              VSP+KIR+YN+  A   ++LF+I+T+PS+ IMNLTY+DPL+G+LK CD FCPL + + 
Sbjct: 302  NTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSG 361

Query: 359  LLAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLS 418
            L  AS N++S      FI+ N T V WS  +Q+FAF N + V++L LIA +SYG    LS
Sbjct: 362  LETASSNSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALS 421

Query: 419  GLELYQNTFSTYANNSLNEYGC-SALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNE 477
            G+EL+Q++ + YANN+LN+ GC +                  GL  +SYIA NY  D + 
Sbjct: 422  GIELFQDSHTAYANNTLNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSD-SS 480

Query: 478  PIPRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNN 537
            P+P V+FYPNI   G ++I  YTPGC+ D TC SR IVNVTV +P + T++ T  IYQNN
Sbjct: 481  PLPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNN 540

Query: 538  DNLKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNV 597
            + +KYD+IF+G L  SPEI L + S I     + ++VADRV++    ++  + L + N  
Sbjct: 541  NEMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLK 600

Query: 598  KRQTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGV 657
                 LNG+FQYQ SNFT  T  KTKVGN +++   ++ +P + SL+   +N+ + + G 
Sbjct: 601  STSLKLNGLFQYQLSNFTSDT--KTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGS 658

Query: 658  SNRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLR-SSDNQSTVLLFNESF 716
            ++ I  + LN + E++++      G+   I    QGLL +G    SS N    L FN +F
Sbjct: 659  TSNIVQLQLNSDLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTF 718

Query: 717  GKVPNYSKRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGD 776
                     V +  N +   +EL  F+                  F+ S+ A G N N D
Sbjct: 719  SSFSQLGDNVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNND 778

Query: 777  VLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNK 836
             L  G +   E+SN N          +++L     IVPY   +LN++ + YAY+    +K
Sbjct: 779  TLLLGNIVRSEYSNFNEPLKLYGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGENSK 838

Query: 837  IYFSNKVNPSWNWSNTITRMLYANNQTMLVVSS-ESSSTADLTIFNLRNMTTIANETLGS 895
            I + N +  S ++S T+ ++ ++NN ++L  ++  ++ ++ L I N+ +  ++A+E L +
Sbjct: 839  IIYGNNMTTSLDFSGTLNKLSFSNNSSLLFANAITNNGSSSLVISNISDGMSLASENLNN 898

Query: 896  NAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLA 955
               ++++++F  N++ILV G+F +   +C G+CLYNY TK WS F N+TI G + ++ L 
Sbjct: 899  YGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEMQLW 958

Query: 956  NSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTSL 1015
            NS +++ISGLF+ + + SI L S ++  + +  L   S+ +++SF+    S+  W++ ++
Sbjct: 959  NSDQILISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSNDTI 1018

Query: 1016 FIYGNQKWNITSLPSDDS-LIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQ 1074
              Y ++KWN  S P+  S  I SV  +S + ++ T N           IL   G F    
Sbjct: 1019 MEYKSEKWNEISFPNTTSKYIESVEAVSIDLQNSTSNVSK--------ILFAYGEFNSTL 1070

Query: 1075 YGNLQSLLFDFQAWTPYFISEISN-SSNYNP--TFFINRDVSTEFNSQITLPNLNITVTN 1131
            YG L ++LF    W PYF   I+N   N +P  T F NRD+S+ FNS+ +LP  NIT   
Sbjct: 1071 YGRLNAMLFRAGDWKPYF--SINNFQVNEDPAITLFENRDLSSLFNSKNSLP-ANITSAE 1127

Query: 1132 XXXXXXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDP 1191
                                     IDRGFVVLI LALA+GTV++LG+ GV +AY+F+D 
Sbjct: 1128 TSSRSTVSSATATTVVNKIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIFRD- 1186

Query: 1192 EGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
            E  Y+ IKPRID  EMLDTVPPEKLMKF+
Sbjct: 1187 EQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1282 (37%), Positives = 720/1282 (56%), Gaps = 83/1282 (6%)

Query: 9    LAFLFLAQASK---ASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQIL--GGVDAISFYK 63
            L  L L+ A     A+QL ++K +L+IE+   P  N+  + + ++Q+L   G D ++F  
Sbjct: 9    LGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVH 68

Query: 64   YTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTIN 123
            Y GQQNFT+ I   + +H L+YYSN+TYI+L D    TRI  I P+G D+FILSG+G++N
Sbjct: 69   YNGQQNFTQPIISSSQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLN 127

Query: 124  NISVGNQILYNLSTLSMAPIF-NQSLGDVETVLVN-DTS-VYFGGNFSYN-NGSMIGHSA 179
               + NQ++YNL+ LS+ PIF N+ + +V T+  + DT+ VYFGGNFSY    S I +  
Sbjct: 128  GFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGL 187

Query: 180  LVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVL-----IXXXX 234
            ++WD+ S+      FGGFG NS +N+ILKLN ++++F+G+FYTLDD S+L     I    
Sbjct: 188  IIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPN 247

Query: 235  XXXXXXFSLNATKLELGQRISLRYASWDSQGSTT-LASNSLVCPNDNGNAWLYPATSGSL 293
                     N +  EL QRI L +  + +  +   +  N L+CP     AW   + +GSL
Sbjct: 248  NTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSKAGSL 307

Query: 294  VCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPL 353
               LP+ + P+KIR++NS D   E+A F+I     +SIM+L YLDPL G+LK C EFCPL
Sbjct: 308  QITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPL 367

Query: 354  YSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGD 413
            Y+R  L   + N +    +IT +D N TD+KWS+ +Q+FAF N+  +T+L+  AL+SYG 
Sbjct: 368  YNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGS 427

Query: 414  SIGLSGLELYQNTFSTYANNSLNEYGC-------------SAL--VXXXXXXXXXXXXXX 458
             +GLSGL L+Q+  + +AN S N+  C             +AL  V              
Sbjct: 428  RVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWY 487

Query: 459  XGLTGESYIATNYIPDQNEPIPRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVT 518
              L    Y+A  Y+   ++ IP V FYPN++++G+YT++  TPGC  DN+C SRGIVNVT
Sbjct: 488  TPLPNSDYLACTYL-SSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVT 546

Query: 519  VWNPQNNTMMKTYTIYQNNDNLKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRV 578
            +WN  ++++++T  IYQ N+N K+DQIF+GYLD   +I + + SG+YS+     +VADR+
Sbjct: 547  MWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRI 606

Query: 579  NVITVSLDTFNALS----EINNVKRQTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPV 634
            N+I  SLD     S    +I NV     LNG+FQY + N     +      N+T+N +  
Sbjct: 607  NLIINSLDFVTTTSSNEIDIYNVT----LNGLFQYPEYN--SVNNLNENYTNSTINQYAY 660

Query: 635  NNYPKNASLLVEIYN-DKLIVGGVSNRISTIDLNENFEIKSSENRTIQ-GDVYGITKTGQ 692
            +NYP N SL+   Y+ D L+VGG  N++    + +N +  S +N       V GI     
Sbjct: 661  SNYPANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSD 720

Query: 693  GLLIYGDLRSSDNQSTVLLF-NESFGKVPNYSKRVNSATNISIADN-ELFVFDXXXXXXX 750
            GL+ YGD+  S      + F N  FG + N++  + S +NIS+  + E+  F+       
Sbjct: 721  GLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQ 780

Query: 751  XXXXXXXXXXXFSLSLWAAGNNGNGDVLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGR 810
                       F LSLW+AG N   D++FSG VS  E  NL G  S    +Q++ LN+G 
Sbjct: 781  SNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKELNLGN 840

Query: 811  GIVPYFGAYLNESVSAYAY--ETDALNKIYFSNKVNPSWNWSNTITRMLYANNQTMLVVS 868
             I PY   +LN+S + YAY      LN++  SN    SW+W N I+ M +  N+++L V 
Sbjct: 841  NIYPYSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNESLLSVG 900

Query: 869  --SESSSTADLTIFNLRNMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSG 926
              S+       +I NL +   IANETL  N+++S+L+ F KNSS+LVGG+F  +   CSG
Sbjct: 901  TISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSDYQCSG 960

Query: 927  LCLYNYETKSWSTFFNNTIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTM 986
            LCL+NYETK+WSTF NNT+ G V++L L N+S ++ISG  +T +  +I L   NLN + +
Sbjct: 961  LCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNLNTYNV 1020

Query: 987  VPLLSGSEGKLNSFVVTDNSLVAWNDTSLFIYGNQKWNITSLPSDDSLIG----SVSTIS 1042
              LL  +   L SF  T N + AWN ++LF Y N+ W+   LP+    +     S+  I+
Sbjct: 1021 SILLQNT--NLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISIFDIT 1078

Query: 1043 TNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFISEISNSSNY 1102
                S  L KRA     D +I++  G F     G +Q+L +    W PYF   ++N+ + 
Sbjct: 1079 NKNSSSILEKRA---LRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMDT 1135

Query: 1103 NPT--FFINRDVSTEFNSQITLPNLNITVTNX----------------------XXXXXX 1138
            + +   F N+D+S++  S   L N N  +++                             
Sbjct: 1136 SNSINIFPNKDISSKIISDFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQ 1195

Query: 1139 XXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYKPI 1198
                              I RGFVVLIGLAL+L TV++LGI G++L+++F+D  GDY+ +
Sbjct: 1196 PSSSIIPIIGKQQNKKHKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESL 1255

Query: 1199 KPRIDENEMLDTVPPEKLMKFV 1220
            KPR  E+EM D VPPEKLM FV
Sbjct: 1256 KPRTTEHEMFDAVPPEKLMPFV 1277

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/1237 (36%), Positives = 709/1237 (57%), Gaps = 67/1237 (5%)

Query: 3    VHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFY 62
            V+ LW     F    ++AS L+N++ +L+  +  +P  ++  N +N  QIL  ++ ISFY
Sbjct: 6    VYCLW-----FAVAITRASNLENVRRILNATEVTVPTFDVG-NKNNQFQILDDINGISFY 59

Query: 63   KYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDA-SDDTRIDKITPFGDDSFILSGSGT 121
            +Y GQQNFT   +  T+   L+YYSN T++ L D+ + + +I  I P GDDSFILSG G 
Sbjct: 60   EYLGQQNFTTDANV-TDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGM 118

Query: 122  INNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALV 181
            INN+S+ +Q+++N++ LS+  IF+  L  +E V V+   VYF GNF++NN +     A++
Sbjct: 119  INNVSLASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFNNNT----GAIM 174

Query: 182  WDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXXF 241
            WD+   +  LLPF GFG  +N+NSILKLNDDNI+FAG F T+ +SS+L+           
Sbjct: 175  WDSRDRSINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVR- 233

Query: 242  SLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPYEV 301
              N T L L   + L+Y+ W + G   L S+ L+CP+ + ++W   AT+G   C LP+++
Sbjct: 234  --NTTSLLLNPSVPLQYSQWKTNGE--LDSSQLICPDPSKDSWSVSATTGDFTCELPFQI 289

Query: 302  SPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLA 361
            +P+KIR+YNS D  S+++LF+ LT P+ SIMNLTYLDPLSG + +CD FCPLYS+ T+L 
Sbjct: 290  TPSKIRIYNSPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSK-TVLQ 348

Query: 362  ASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLE 421
            +  + ++  + +  I+ N+T+++W+ ++Q+FA  + +  TSL+  AL SYG+++GL+G +
Sbjct: 349  SQWDNTAEANTVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQ 408

Query: 422  LYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLT--GESYIATNYIPDQNEPI 479
            +YQ +FS + NNS N   C+                    T  GE Y+   Y P++N P+
Sbjct: 409  IYQASFSAFGNNSFNTPNCNNNDKDSNNTFTSSSLSPNNWTSVGE-YLTVGYTPNEN-PV 466

Query: 480  PRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDN 539
            P+V +  +I HSG Y+IN +TPGC  DNTCS+RGIVN T+++   N M+ T  IYQNND 
Sbjct: 467  PKVTYKIDIQHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDE 526

Query: 540  LKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKR 599
            +KYD ++SG L+ S EI + Y SG+Y+SNT T +VADRV++  +S+D    LS    V +
Sbjct: 527  IKYDTLYSGQLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMD----LSHRTEVSK 582

Query: 600  QTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLV-EIYNDKLIVGGVS 658
               LNG+FQYQ SNFT   S   K+ NT+LN F +NN+  + SL    + N  +++ G  
Sbjct: 583  -LALNGLFQYQISNFTND-SIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTE 640

Query: 659  NRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGK 718
              + +I+LN +  +++S       +         GL++       D Q  V LF ++F  
Sbjct: 641  GNMFSINLNTDLSVQNSTRLISTENFTTFQPYSNGLVML------DGQGNVSLFKDNFKN 694

Query: 719  VPNYSKRVNSAT---NISIADNELFVFDX-XXXXXXXXXXXXXXXXXFSLSLWAAGNNGN 774
            + N +   + AT   NI++  +EL VF+                   F+L++ +AG N  
Sbjct: 695  L-NTTMDGSLATDVANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSI 753

Query: 775  GDVLFSGTVSHMEFSNLNGSASFKNE--DQVQALNIGRGIVPYFGAYLNESVSAYAYETD 832
             D +F G V   +++  N SA    +  D ++ +++    VP  G +LN+  + Y Y+  
Sbjct: 754  NDTIFLGKVVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKES 813

Query: 833  ALNKIYFSNKVNPS-WNWSNTITRMLYANNQTMLVVS--SESSSTADLTIFNLRNMTTIA 889
              +K+Y +N  + S   W      ++Y  N T+L+V   ++++ ++ L++ NL +   I 
Sbjct: 814  NKSKLYITNSNSTSGLEWYGEPETVVYDKNDTLLMVGYYNDNTFSSTLSLTNLTSFDVIK 873

Query: 890  NETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEV 949
             E L   + +S+L+ F KN ++LV GDF+ +  NCS LCLYNY++  W +  NN++ G V
Sbjct: 874  EENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSV 933

Query: 950  TQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLN--SFVVTDNSL 1007
              L L  +  +++ G     +   + +   NL+N  +  L+   +  +N  S +V+++ +
Sbjct: 934  AALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRI 993

Query: 1008 VAWNDTSLFIYGNQKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLN 1067
            VAWNDT LF +    W   S+P  DS   S+S++        ++   T++A     LLL 
Sbjct: 994  VAWNDTVLFSFDGNSWTRVSVPGTDSSATSISSV------QFISMEGTDDA-----LLLL 1042

Query: 1068 GNFTMPQYGNLQSLLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFNSQITLPNLNI 1127
            G F   ++G+++S++++F+ W PY +  +          F+NRD+S    +QI L N   
Sbjct: 1043 GEFRHSEFGDIKSIVYNFRDWIPYLL-YVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTR 1101

Query: 1128 TVTNXXXXXXXXXXXX-------XXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIV 1180
             +TN                                +DRGFVVLIGLALAL TVSV+G+ 
Sbjct: 1102 VLTNQSFASSTSSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALALATVSVMGVA 1161

Query: 1181 GVILAYVFKDPEGD-YKPIKPRIDENEMLDTVPPEKL 1216
            GV+LAY+F+D  GD Y+ + PR+DEN M++T+PPEKL
Sbjct: 1162 GVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1243 (33%), Positives = 684/1243 (55%), Gaps = 53/1243 (4%)

Query: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60
            M        +FL +A+    + L  I+S L +++  +P+L++S +N+  +Q+LG    ++
Sbjct: 1    MLTKSWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLN 60

Query: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLED---ASDDTRIDKITPFGDDSFILS 117
            +Y+YTGQ NFT GIS       L+Y+SN T ++L     +++   +D + P  DDSFILS
Sbjct: 61   YYRYTGQDNFT-GISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILS 119

Query: 118  GSGTINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGH 177
            G+G I+   + +Q+++NLS LS   IFNQSL  V  + VN    YFGG+F +       H
Sbjct: 120  GTGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTH 179

Query: 178  SALVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXX 237
              +VWD + +  + LPFGG G++SNVNSIL L+D+NI+FAG F T+D+ S L        
Sbjct: 180  GLIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSAL-------- 231

Query: 238  XXXFSLNAT---KLELGQRISLRYASWDSQGSTTLASNSLVCPNDNG-NAWLYPATSGSL 293
                 +N+T     EL  +I L+ A W S GS  L  + LVCP+++  +AWL   T+G  
Sbjct: 232  NSTLGINSTSDSAPELSHKIPLKTAKWTSDGS--LQKDDLVCPSNSATSAWLGTGTTGQF 289

Query: 294  VCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPL 353
              ++ + + P+K+RL+N++    E++LF+++T PS+ IMNLTYLDP SGEL+ CD +CPL
Sbjct: 290  ELSIAHTIRPSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPL 349

Query: 354  YSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGD 413
             S   L AA   A+S+ D + F++ N T V+WS  +QDFAF N +PVTS+  +AL+SYG 
Sbjct: 350  LSTQNLTAAKSKAAST-DQVEFLN-NQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGS 407

Query: 414  SIGLSGLELYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIP 473
            S+G++G ELY++ FS YAN+S N   CS+                 G + E Y+ T  + 
Sbjct: 408  SVGVNGFELYEDDFSVYANDSFNVPDCSS-TSNYSKASLSASQWDQGSSDEDYVYT--LV 464

Query: 474  DQNEPIPRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTI 533
            + ++  P V FYP I++SG YTIN  TPGC+ D +C SR +VN ++W+  N T++ + TI
Sbjct: 465  ENSQEAPSVTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITI 524

Query: 534  YQNNDNLKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSE 593
            YQNND  KYD ++SGYL+   ++VLEY   I ++  + ++VA +++V T   D+    S 
Sbjct: 525  YQNNDYEKYDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDS----SV 580

Query: 594  INNVKRQTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLI 653
              +  +   LNG+  Y  SN +    N     +T L  + V+N+ KN++  V+ + + ++
Sbjct: 581  FTDKYKTGKLNGLLHYSLSNSSSYLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIM 640

Query: 654  VGGVSNRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFN 713
            +   S ++S +++++ F++++     +  +V G+    +GL + G    S   +    +N
Sbjct: 641  LFASSGKVSKLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTKGAK--FYN 698

Query: 714  ESFGKVPNYSKRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNG 773
             SF  +P     V + TN ++   EL                       +L+  +AG N 
Sbjct: 699  GSFFDIPLSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNN 758

Query: 774  NGDVLFSGTVSHMEFSNLNGSASFKNEDQVQA-LNIGRGIVPYFGAYLNESVSAYA-YET 831
             G+ +F G+++  E+++LNGS    +  Q  + L   +G + Y   Y++ S + YA Y+ 
Sbjct: 759  LGETVFYGSLTRNEYTDLNGSFFISSNSQSSSRLRGSQGRIWYDATYIDNSTTGYAFYDP 818

Query: 832  DALNKIY-------FSNKVNPSWNWSNTITRMLYANNQTMLVVSSE-SSSTADLTIFNLR 883
             + N  Y        + + + S+ W+N +  MLY+ N ++L +  +  + +  L + NL 
Sbjct: 819  SSTNGSYGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSPQLLLTNLT 878

Query: 884  NMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNN 943
                 A     +N  +++L+ F++N+S+LVGGDF  ++ NCSGLCL++YE K WS FF+N
Sbjct: 879  TGEDTATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDN 938

Query: 944  TIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVT 1003
             I G +  + + N S L++ G F+  + + + L S +L + +   L  G+E  L+ F+  
Sbjct: 939  MINGSIHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILD-FIFV 997

Query: 1004 D---NSLVAWNDTSLFIYGNQKWNITSLPSDD-SLIGSVSTISTNTKSDTLNKRATNNAH 1059
            D   ++LVA +   LF   N  W   S   DD S+ G +S            +    N+ 
Sbjct: 998  DGKVDNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNS- 1056

Query: 1060 DGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFISEISNSSN--YNPTFFINRDVSTEFN 1117
                LL+ G+     YG + + L+DF  W PYF +  + S++       + N+D+S+ FN
Sbjct: 1057 ----LLITGDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFN 1112

Query: 1118 SQITLPNLNITVTNXXXXXXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVL 1177
             Q  L +      N                         I RGFVVLIGLALA+GT++V+
Sbjct: 1113 YQGVLQSSR--GGNSSSVPSGTSSPTSSSPSQLGAKKNKIARGFVVLIGLALAMGTLAVM 1170

Query: 1178 GIVGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
            G++G+ L + F      Y+ ++PR DE+EM+DTVPPEKLM+F+
Sbjct: 1171 GVIGIALTFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1229 (34%), Positives = 682/1229 (55%), Gaps = 46/1229 (3%)

Query: 12   LFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFYKYTGQQNFT 71
            L LA+    S L  ++S L +E   +PNL++S++ +N VQ+LG    I+  KY+GQ+NFT
Sbjct: 12   LALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDINILKYSGQKNFT 71

Query: 72   KGISPGTNSHGLVYYSNNTYIQLEDASDDTRI---DKITPFGDDSFILSGSGTINNISVG 128
              +S G   + L+YYSN T++++  +SD + +   D I PF DD+FILSG+G+I+   + 
Sbjct: 72   GEVS-GNPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSGAGSISGHQLS 130

Query: 129  NQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVWDAMSDT 188
             Q+L+NLS+L    IF Q L  V T+  N   V+FGG+F Y   +   HS LVWD++ D 
Sbjct: 131  RQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHSLLVWDSIKDG 190

Query: 189  AQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXXFSLNATKL 248
             ++LPFGGFG+NS VNSIL L++ NI+FAG F  +D++  L              N +  
Sbjct: 191  VEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNINVSNTS-----NTSVP 245

Query: 249  ELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYP-ATSGSLVCNLPYEVSPTKIR 307
            ELG +ISL+ A+W S G  TL  +++ CP+     WL   +T G     +P E  P+K+R
Sbjct: 246  ELGHQISLQSAAWVSDG--TLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETRPSKLR 303

Query: 308  LYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATLLAASQNAS 367
            ++N++D+  +++LF+I+T PS+ IMNLTYLDP +GEL +CD +CPL S   L   S + S
Sbjct: 304  VFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDIS-SKS 362

Query: 368  SSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSGLELYQNTF 427
               D + + + N T ++WS  FQDFAF N +PV+ L  IAL+SYG S+GL+G+ELY++ +
Sbjct: 363  YPGDQVQYFE-NRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELYESAY 421

Query: 428  STYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPIPRVKFYPN 487
            S YANN+LN   C+                  G +  +Y++T+     +E  P V FYP+
Sbjct: 422  SVYANNTLNAPNCAQGSATSNALLSNSSAWDSGSSEGNYLSTSV--QDSETNPFVIFYPS 479

Query: 488  IIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDNLKYDQIFS 547
            II+ G YTI+  TPGC++D++C +RGI+N T+ + QNNT++ +  IYQNND  K+D ++S
Sbjct: 480  IIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTLYS 539

Query: 548  GYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKRQTPLNGIF 607
            G+LD   ++ LE+   I S     V+VA +   I V+++ F+     NN      +NG+ 
Sbjct: 540  GFLDSEVKVTLEFDGAINSGTEVPVMVASK---IVVNIEDFDQSVFENNTS--GFINGLL 594

Query: 608  QYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSNRISTIDLN 667
             Y  SN +   S       T L  + V+  PK++++   ++ D L++      ++ + L 
Sbjct: 595  HYSTSNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLA 654

Query: 668  ENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESFGKVPNYSKRVN 727
             N  I+     TI  D+  I++   GL+I G    S ++     FN +F  +  ++  V 
Sbjct: 655  NNLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGS-SEPAARGFNGTFFNLTEFNSTVR 713

Query: 728  SATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNGDVLFSGTVSHME 787
            + +N+++   E+ +FD                   +L + +AG N   D LF G V   +
Sbjct: 714  TFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQND 773

Query: 788  FSNLNGS--ASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYA-YETDALNKIYFSNKVN 844
            ++NLNGS   S  +E+  Q      G +PY  A+++ S +AYA Y  D  +  +  + +N
Sbjct: 774  YTNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYNPDNTSNSFGVSVMN 833

Query: 845  PSWN------WSNTITRMLYANNQTMLVVSSESSST-ADLTIFNLRNMTTIANETLGSNA 897
             S +      WS  +  M  + N ++L +  +   T + L + N  +  ++A+    S  
Sbjct: 834  DSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHTDSQLLVTNSSSGESLASYKWDSEI 893

Query: 898  KVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSLANS 957
             +++++ F +N+S+LVGG F++    CSGLCL+NY+ K WS F NN+I G + ++ + N+
Sbjct: 894  SLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVINRMEIFNN 953

Query: 958  SELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTD---NSLVAWNDTS 1014
            S L+I+G F   E   + L S  L + +   L  G+   LN FV  D   N++VA++DTS
Sbjct: 954  SNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGNI-TLNGFVSMDGSSNNVVAFSDTS 1012

Query: 1015 LFIYGNQKW-NITSLPSDDSLIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMP 1073
            L    + KW  I++  +++S    +         DT  K+  +++    +LL+ G+    
Sbjct: 1013 LLQLESGKWQQISTNFTENSKFKGLDVFPLK---DTTRKQKRDSS--SKVLLITGSLQHA 1067

Query: 1074 QYGNLQSLLFDFQAWTPYFISEISNSSNYNPT--FFINRDVSTEFNSQITLPNLNITVTN 1131
            ++G++ +  +D   WTP+  S  + SS+   T   F+NRD+S   + +  L       +N
Sbjct: 1068 KFGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQ--GTFSSN 1125

Query: 1132 XXXXXXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDP 1191
                                     IDRGF+VLI LALALGT++VLG++GVI +Y F D 
Sbjct: 1126 TSSGTSGTPSPSGSSPSNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYFFGDS 1185

Query: 1192 EGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
               Y+  KPR DENEM+DTVPPEKLM+F+
Sbjct: 1186 GDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1182 (34%), Positives = 649/1182 (54%), Gaps = 32/1182 (2%)

Query: 40   LNISQNNSNAVQILGGVDAISFYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASD 99
            LN S + +N +Q+LG ++  ++Y Y GQQNFT   S   N   L+YYSNNT ++L+    
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTA-SSSQNELELIYYSNNTLLRLDAVPT 60

Query: 100  DTRIDKITPFGDDSFILSGSGTINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDT 159
            D  +  I PF DD FILSG GTI+ I +  QIL NL+ LS  PIF + LG V+++ V++ 
Sbjct: 61   DVEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNE 120

Query: 160  SVYFGGNFSYNNGSMIGHSALVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGK 219
             VYFGG+ +YNN  + G S + W++ ++++ LLPFGGFG NS VNSI++L ++N++F G+
Sbjct: 121  VVYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQ 180

Query: 220  FYTLDDSSVLIXXXXXXXXXXFSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPND 279
            F  L+++S +           FS++    E+GQ+ISLR A+W++  ++ L  ++ +CPN 
Sbjct: 181  FAKLENNSFV---SKTNRTRNFSISMEDSEVGQQISLRQATWNA--NSNLDVDAFICPNS 235

Query: 280  NGNAWLYPATSGSLVCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDP 339
            +  AW    + G + CN P  ++ +KIR+YN+    ++I+LF+++  P + I+NLTYLDP
Sbjct: 236  DQQAWYSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDP 295

Query: 340  LSGELKNCDEFCPLYSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELP 399
            +S ++K+C E CPL++R TLL A  N +   D+I FI+ N+T++KW+  +Q+FAF N+LP
Sbjct: 296  ISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLP 355

Query: 400  VTSLKLIALNSYGDSIGLSGLELYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXX 459
            +TSL+ +A NSY  ++GLSG ++YQ++F  + NNS NE  C +                 
Sbjct: 356  ITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFT 415

Query: 460  GLTGESYIATNYIPDQNEPIPRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTV 519
                 SY+A +YIP+Q    P + ++  I   G Y +N  TPGC +DNTCS+RGIVNVT 
Sbjct: 416  VANDNSYLANSYIPNQGTK-PSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTT 474

Query: 520  WNPQNNTMMKTYTIYQNNDNLKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVN 579
            ++  N  ++ +  IYQNN+NLKYDQIF+G L+ S  + +EY SGI ++NT T  V   V 
Sbjct: 475  FDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGI-NTNTGTATVVVGVV 533

Query: 580  VITVSLDTFNALSEINNVKRQTPLNGIFQYQKSNFTGTTSNKT-KVGNTTLNLFPVNNYP 638
             +     +   +S+  +  R   LNGIF+Y  SNFT      T K+  T L+ F V+N+ 
Sbjct: 534  DVVRVSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFN 593

Query: 639  KNASLLVEIYNDKLIVGGVSNRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYG 698
            K AS+     N  L +G  +  +  ++      + S+EN  + G + G+    +GL+I+G
Sbjct: 594  KGASIFAVDQNQNLYLGSTNGSVYELNSLNGSSVPSTENN-LSGLINGMYSVEEGLVIFG 652

Query: 699  DLRSSDNQSTVLLFNESFGKVPNYS-KRVNSATNISIADNELFVFDXXXXXXXXXXXXXX 757
             +     +   ++ N+S   +   +   + ++ N ++  + L VFD              
Sbjct: 653  SIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFE 712

Query: 758  XXXXFSLSLWAAGNNGNGDVLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFG 817
                 +L L  AG N N D+L  G + +   +  N S    +       ++         
Sbjct: 713  NTSYRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGA 772

Query: 818  AYLNESVSAYAYETDALNKIYFSNKVNPSWNWSNTITRMLYANNQTMLVVSSESSSTADL 877
             YLN++ + Y+  +  +N    S+K    W W +T+  + Y+N Q +L    E+S+ + +
Sbjct: 773  IYLNDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQLLGAIQENSNKSQI 832

Query: 878  TIFNLRNMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSW 937
             + +L +   I +    +  K++A+VNF  N++ LVGGDF ++ P C GLCLYNY   +W
Sbjct: 833  VLIDLFSSQVINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCLYNYNNSNW 892

Query: 938  STFFNNTIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKL 997
            S+F NN+I G ++Q+   N +++++SG     +   I L S NL +     LL  +   L
Sbjct: 893  SSFLNNSITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVL 951

Query: 998  NSFVVTDNSLVAWNDTSLFIYGNQKWNITSLPSDDSLIGSVSTISTNTKSDTLNKRATNN 1057
            + F++  N +V WN T +FI    +W+  ++  D +             + T+N+     
Sbjct: 952  DDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDGT-------------NATINRIENFG 998

Query: 1058 AHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFISEISNSSNYNPTFFINRDVSTEFN 1117
            A     L++ G F   +YG + ++++DF +W PYF  ++  S    P FF +RD S+  N
Sbjct: 999  ADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVV-SQTATPLFFADRDQSSYGN 1057

Query: 1118 SQITLPNLNITVTNXXXXXXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGTVSVL 1177
            ++  +P+  I  +                          I RGFVVLIGLALAL T+ VL
Sbjct: 1058 TRHVVPDHIIVSS-----SHSSSAPSSSSSHKTNEKPYKIRRGFVVLIGLALALATLIVL 1112

Query: 1178 GIVGVILAYVFKDP-EGDYKPIKPRIDENEMLDTVPPEKLMK 1218
            GI GV++A +F     GDY  IK    +N     + PEKL++
Sbjct: 1113 GITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIR 1154

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/1247 (36%), Positives = 686/1247 (55%), Gaps = 62/1247 (4%)

Query: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60
            M++H+   L   F+A  ++ SQ+  + +  +I     P+L++S   ++ + I        
Sbjct: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60

Query: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120
            +Y Y GQQ FT       NS  L+YYSNNTY+QL +  D   I KI P+GDDSFILSG G
Sbjct: 61   YYTYKGQQIFTGLADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRG 118

Query: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180
                  + +Q++YNLS+  +  I  + L  V  +L +   VYFGG F+YN+G++ GHS +
Sbjct: 119  VFEGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVV 178

Query: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXX 240
             WDA   ++ LLPF GFG+ S VN+I+KL+D NI+F GKF T+D++++L           
Sbjct: 179  KWDATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALL---PHRNVSSS 235

Query: 241  FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYP-ATSGSLVCNLPY 299
            F  N+T +E     SLR++S    G  TL S++ VCP  + ++W  P +T G L   +  
Sbjct: 236  FLSNSTNIETNALASLRFSSLVHDG--TLNSSAFVCPEGSADSWTIPHSTMGELTIRVIN 293

Query: 300  EVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATL 359
            +++P+KIR+YNS+D+ +++ LF+I+T+PS SIMN+TY+DP++G L  CD +CPL   + L
Sbjct: 294  QMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVL 353

Query: 360  LAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSG 419
               ++N++SS+ M  F + NN  VKW++ +Q+FAF N +P+  L  IA++S+G ++GL G
Sbjct: 354  SNLAENSTSSV-MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLG 412

Query: 420  LELYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPI 479
            +EL+Q  + TY NN+LN+  C +                 GL  +SY+AT++   +    
Sbjct: 413  IELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGK---- 468

Query: 480  PRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDN 539
            P V   P+I + G YT+N  TPGC+ DNTC+ RGIVNVT+   QN T +    IYQNN+N
Sbjct: 469  PSVTLTPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTI-RAQNGTHLMNRWIYQNNEN 527

Query: 540  LKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKR 599
            LKYD +F GYLD SP +VLE+I  I  +    V+VADRV  I   +D+   L   N    
Sbjct: 528  LKYDPLFRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSI---IDSIEDLEMKNGTSN 584

Query: 600  QTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVS- 658
               LNG+FQY  SNFT T  + T VG+T ++ +PV N P ++SL  +IYND L +G  S 
Sbjct: 585  SNLLNGLFQYAASNFTNTNLS-TLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSI 643

Query: 659  ---NRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNES 715
                +IS    + N  I   +    +G V GI     GL +      + N ++ L FN S
Sbjct: 644  DGLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQT-NMASSLSFNGS 702

Query: 716  FGKVPNYSKRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGNG 775
               +   +    S  N++I  +E+ VFD                    LSL +AG N   
Sbjct: 703  ISTIFRSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLED 762

Query: 776  DVLFSGTVSHMEFSNLNGSASF---KNEDQVQAL-NIGRGIVPYFGAYLNESVSAYAYET 831
            D++ +G V   +    NG+ +     NE     L ++  GI+ Y G ++N+S SAYAY +
Sbjct: 763  DLILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGII-YRGLFINDSSSAYAYYS 821

Query: 832  DALNK----IYFSNKVNPSWNWSN--TITRMLYANNQTMLVV--SSESSSTADLTIFNLR 883
             +L      I    +  P +  ++  T+  MLY  +  +L V  S  S   A L I +L 
Sbjct: 822  KSLGSSKGGIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLS 881

Query: 884  NMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNN 943
                   ET      ++ +V F +N ++LVGG F  T+  C  LCLYNY T +W+ F + 
Sbjct: 882  ADFAPIKETFEIGEVINTMVLFGRNYTLLVGGTF--TRNGCRDLCLYNYATNNWTRFMDG 939

Query: 944  TIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSE-GKLNSFVV 1002
             I G++ QL   + + L+++GL  + + + ++L   +L+N  ++  L G+  G     + 
Sbjct: 940  NITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLT 999

Query: 1003 TDNS---LVAWNDTSLFIYGNQKW-NITSLPSDDSLIGSVSTISTN-TKSDTLNKRATNN 1057
              NS   L+A +   +F + + +W NI+   S  + I  ++ +ST+ ++ +++ KR   +
Sbjct: 1000 VGNSSSELIAHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKR---D 1056

Query: 1058 AHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFIS--EISNSSNYNP--TFFINRDVS 1113
                 ++++NGNF+ P YG++ ++ +DF  W PY+ S    SNS    P    F+N+DVS
Sbjct: 1057 RVGNELVVINGNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVS 1116

Query: 1114 TEFNSQITLPNLNITVTNXXXXXXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLALALGT 1173
               +SQI L N N                              + + FVVLI LALAL T
Sbjct: 1117 FTSSSQIYLSNDN----------DNDDTPAASEPATHEKHTKKLAKIFVVLIALALALAT 1166

Query: 1174 VSVLGIVGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
            V+VLG+VGV+ AY+F D    Y+P+KPRI+E EML TVPPEKLMKF+
Sbjct: 1167 VAVLGVVGVLFAYLFGDHNA-YEPLKPRINEAEMLKTVPPEKLMKFI 1212

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/1251 (34%), Positives = 681/1251 (54%), Gaps = 82/1251 (6%)

Query: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60
            MF         L LA   + SQL NI+ LL+I     PN +     S  +  +   + ++
Sbjct: 1    MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELT 55

Query: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120
               YTGQQNFT       N   L+YYSN+T+++L + S +T +  I P  +DSFILSG+G
Sbjct: 56   VISYTGQQNFTVQ----ANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTG 111

Query: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180
             IN +++  QIL NL++L+ +PIF  ++ +V  +L  + +V F GNFS +  +  GH A+
Sbjct: 112  QINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAV 171

Query: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXXXXX 240
            +WD +++T +L PF GFGENS VNS++KLN DNI+FAG F  + ++S+L           
Sbjct: 172  LWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSH 231

Query: 241  FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAW-LYPATSGSLVCNLPY 299
              L  T L+  Q + L+ +S   +    + S+ L+CP+   N W    A   +L  +L  
Sbjct: 232  EDL--TSLQFDQSVPLKLSSITGEN---VQSDILLCPSGGQNGWSASEAVQSTLQFDLKN 286

Query: 300  EVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATL 359
            E+ P+K+R+YNS +  SEI+LF+I+T PS+ IMNLTYLDP SGELK CD +CPL S   L
Sbjct: 287  EIHPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDL 346

Query: 360  LAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSG 419
               SQN++++   +  I+ N+T++KWS  +Q+FAF N++PVT L+ +AL SYG +  L  
Sbjct: 347  TQISQNSTAAPKSVG-INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHS 405

Query: 420  LELYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYIPDQNEPI 479
            +E+++  F  YANNS NE  C ++                    ++YI+TN     ++ I
Sbjct: 406  IEIFETEFMVYANNSYNEPNCESVTEYSKAELSSDNWYTTD-ESDTYISTNI----DDNI 460

Query: 480  PRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDN 539
            P V F+PNI + G YT N YTPGC+QDN+CS RGIVNVT+ +   N ++ +  IYQ N+ 
Sbjct: 461  PYVTFHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNE 520

Query: 540  LKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKR 599
             K+D +++G L  +PEI++ +   I  S+  +V+V DR+ VIT  +DT +    I++   
Sbjct: 521  DKFDPLYTGSLGSAPEIIVTWDKAIGESD--SVMVVDRLGVITEYIDTIS----ISSNDT 574

Query: 600  QTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSN 659
               LNG+FQY  +N T +  +     N T N + + N+P +A+L     N+ +++GG  N
Sbjct: 575  TFHLNGLFQYNTANVTASIFST----NDTFNDYALYNFPLDANLYAASLNNDILIGGNFN 630

Query: 660  RISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLR-SSDNQSTVLLFN----E 714
             I+ ++LN+   I SS+     G   GI +   GLL+ G  +  +D++  +L ++     
Sbjct: 631  GIAKVELNDEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFN 690

Query: 715  SFGKVPNYSKRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAGNNGN 774
            SFG++     R+    N +I  +EL +FD                  F ++  +AG N  
Sbjct: 691  SFGQLDEPIDRI---VNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSG 747

Query: 775  GDVLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGR---GIVPYFGAYLNESVSAYAYE- 830
             D L  G+        LNG AS  ++ QV +  +      + PY  AY+N++ +AYA + 
Sbjct: 748  NDSLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQE 807

Query: 831  --TDALNKIYFSNKVNPSWN-----WSNTITRMLYANNQTMLVV---SSESSSTADL--T 878
              TD +         N S +     WS  I   LY N   +L +    S SSS  D+  +
Sbjct: 808  GSTDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFS 867

Query: 879  IFNLRNMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWS 938
            I NL     +A     +N +V+++V+F  N+SILVGG ++I   NC+ LCLYNY+TK W+
Sbjct: 868  ILNLTGYENVARVNFSTNERVNSMVSFSSNNSILVGGSYEID--NCNDLCLYNYQTKEWT 925

Query: 939  TFFNNTIFGEVTQLSLANSSE-LIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKL 997
            +F N++I G++ Q+  A+  + L++ GL  T    +I+L S  + +     + SG+E  L
Sbjct: 926  SFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLL 985

Query: 998  NSFVVTDNS---LVAWNDTSLFIYGNQKW-NITSLPSDDSLIGSVSTISTNTKSDTLNKR 1053
             SFV  D+S   ++A  ++ +    +  W +     ++DS++     +     S T +K+
Sbjct: 986  -SFVPIDDSTDNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVL-----SGTESKK 1039

Query: 1054 ATNNAHDGSILLLNGNFTMPQYGNLQSLLFD--FQAWTPYFISEISNSSNYNP--TFFIN 1109
                +H   I+LL G     ++GNL S+++D   Q W PYF+          P  +FF N
Sbjct: 1040 RDEGSH---IVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQN 1096

Query: 1110 RDVSTEFNSQITLPNLNITVTNXXXXXXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLAL 1169
             +     +SQ  L       +N                         IDRGF+VLIGLAL
Sbjct: 1097 VNDLYLSSSQTVLQ------SNNSDTSASSTPTPSTTSSSHSTKDKKIDRGFIVLIGLAL 1150

Query: 1170 ALGTVSVLGIVGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
            AL TV+V+G++G ++ Y F +  G Y+ +KPRI+++EMLDTVPPEKLMKF+
Sbjct: 1151 ALATVAVIGLIGALICYFFINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/1251 (33%), Positives = 658/1251 (52%), Gaps = 81/1251 (6%)

Query: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60
            M +H     A   L    + S L+++    DI+    P L++S   +  + +     A  
Sbjct: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60

Query: 61   FYKYTGQQNFTKGISPGTNSH---GLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILS 117
            +Y Y GQQ FT     G   H    L+YYS  TY+QL    DDT + +I PFG DSFILS
Sbjct: 61   YYNYKGQQLFT-----GQEQHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILS 115

Query: 118  GSGTINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGH 177
            G+G + +  + +Q++YNLSTL +  I  QSL  V  +LV+   VYFGG F+Y++G+  GH
Sbjct: 116  GTGKLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGH 175

Query: 178  SALVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLIXXXXXXX 237
            SA+ W+A S T  LLPFGGFG  S+VN+ILKL+   ++F G+F  L+ +S          
Sbjct: 176  SAVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLAS 235

Query: 238  XXXFSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPAT-----SGS 292
                 LN T +E     SLRY++  S G   L     +CP  N ++W  P +      G 
Sbjct: 236  TEKPQLNVTTIETNALTSLRYSTITSDGH--LDKGKFICPTSNDDSWFVPHSGDGPARGE 293

Query: 293  LVCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCP 352
            L   + + + P+KIR+YNS+  G+EI LF+I+T+PS SIMN+TY+DP +GEL  CD +CP
Sbjct: 294  LNIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCP 353

Query: 353  LYSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYG 412
            L  R+ L + +   S   D+   ++     +KW+ D+Q+FAF N++ +  +K IAL+SYG
Sbjct: 354  LMPRSNLTSKAAE-SGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYG 412

Query: 413  DSIGLSGLELYQNTFSTYANNSLNEYGCSALVXXXXXXXXXXXXXXXGLTGESYIATNYI 472
            +++GL G+EL+Q  +  Y N++LN+  C                   G T  SY++ N +
Sbjct: 413  NNVGLVGVELFQTEYDAYVNSTLNQPNCGE--QQLSPFSTTANIWHQGATDASYLSANVV 470

Query: 473  PDQNEPIPRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYT 532
                E  P V   P I HSG YT+N YTPGC  D TC  RGIVNVT+      T+M  + 
Sbjct: 471  ----ESNPMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLMTRW- 525

Query: 533  IYQNNDNLKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALS 592
            IYQNN  LKYD +++G+LD +P + +E++S I S+    ++VADRV+ I   +D+ + L 
Sbjct: 526  IYQNNYRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAI---IDSLDGLD 582

Query: 593  EINNVKRQTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKL 652
            +I +  R+  LNG+FQY     T   S+        +N  P  + P+  SL+ ++Y+ KL
Sbjct: 583  DIRH-PREKSLNGLFQY-----TPAGSSLDNGIQKYINKDPQTDMPEGVSLVGQVYDGKL 636

Query: 653  IVGGVS-NRISTI-DLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVL 710
            I+G  S   I+ +     ++       + + G + GI+   +GL+  G    S   S+ L
Sbjct: 637  ILGVKSTGHIAVVTPKGTDWNDVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSAL 696

Query: 711  LFNESFGKVPNYSKRVNSATNISIADNELFVFDXXXXXXXXXXXXXXXXXXFSLSLWAAG 770
             ++ +FG   + +   +S  N++I  +EL +F+                  F LS  +A 
Sbjct: 697  HYDGNFGSFFDLNSETSSIINMTIDGSELLLFNNKFIYNTSTSQMLTSSM-FQLSALSAA 755

Query: 771  NNGNGDVLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGR--GIVPYFGAYLNESVSAYA 828
             N N D+LF+G+++ ++  + +G+ +   E  +         G   + G YLN++ +AYA
Sbjct: 756  ANSNNDLLFTGSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYA 815

Query: 829  YETDALNKIYFSNKV---NPS--WNWSN---TITRMLYANNQTMLVVSSES--SSTADLT 878
            Y + + N    +  V    P   +N SN   T+  M+Y      LV+S+     +   L 
Sbjct: 816  YYSVSPNSSVATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALI 875

Query: 879  IFNLRNMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWS 938
            +++LR +  +A E L    +++++V F +++++LVGG F+  K  C  LCLYN+  +SWS
Sbjct: 876  LYDLRTLQEVAREKLNPGERINSIVLFGEDNTLLVGGSFE--KDGCHDLCLYNFVKRSWS 933

Query: 939  TFFNNTIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLN 998
             F +  I GE+ QL   N+  LI  G    +   +I   +F+L    +V       G+  
Sbjct: 934  AFASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAF 993

Query: 999  SFVVT----DNSLVAWNDTSLFIYGNQKWN-ITSLPSDDSLIGSVSTISTNTKSDTLNKR 1053
            + V+T     +  VA +   ++ Y   +W  +T L      I  +S +  N    + NKR
Sbjct: 994  NSVLTIGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPR-SQNKR 1052

Query: 1054 ATNNAHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFISEISNSSNY----NPTFFIN 1109
               N     +++++G     +YG + ++ ++F+ W PY+ +  S++           F+N
Sbjct: 1053 ---NRVGNELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLN 1109

Query: 1110 RDVSTEFNSQITLPNLNITVTNXXXXXXXXXXXXXXXXXXXXXXXXXIDRGFVVLIGLAL 1169
            +D+S +  +  +LP L + V++                         + +G+VVLI L L
Sbjct: 1110 QDISRQ--TTTSLP-LEVVVSDSPPTAEPKRK---------------LAKGYVVLIALGL 1151

Query: 1170 ALGTVSVLGIVGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220
            AL T+++LGI+GVILAY F D    Y+P+KPRI+E+EML TVPPEKLMKF+
Sbjct: 1152 ALATIALLGIIGVILAYAFGD-HNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201

>YPR184W Chr16 (902044..906654) [4611 bp, 1536 aa] {ON}
           GDB1Glycogen debranching enzyme containing
           glucanotranferase and alpha-1,6-amyloglucosidase
           activities, required for glycogen degradation;
           phosphorylated in mitochondria; activity is inhibited by
           Igd1p
          Length = 1536

 Score = 36.6 bits (83), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 467 IATNYIPDQNEPIPRVKFYPNIIHSGHYT-----INTYTPG 502
           + TN  PD N P  R KFY  IIHS  +      +N Y PG
Sbjct: 62  VWTNCPPDHNTPFKRDKFYKKIIHSSFHEDDCIDLNVYAPG 102

>Smik_16.448 Chr16 (764670..769280) [4611 bp, 1536 aa] {ON} YPR184W
           (REAL)
          Length = 1536

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 467 IATNYIPDQNEPIPRVKFYPNIIHSGHYT-----INTYTPG 502
           + TN  PD N P  R KFY  +IHS  +      +N Y PG
Sbjct: 62  VWTNCPPDHNTPFKRDKFYKRMIHSSFHEDDCIDLNIYAPG 102

>TBLA0F01240 Chr6 complement(309036..310583) [1548 bp, 515 aa] {ON}
            Anc_4.282 YKL184W
          Length = 515

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 1034 LIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFI 1093
             + +  T++TN     + KR  NN +  S++ +N       YGNL  +LFD Q  TP  +
Sbjct: 374  FVSTALTLATNV----IAKRRPNNDNTSSMIYVNDGV----YGNLNCILFDHQVPTPKIL 425

Query: 1094 SEISNSSNYN 1103
               SNS +YN
Sbjct: 426  FH-SNSYHYN 434

>NDAI0H01690 Chr8 (408605..409645) [1041 bp, 346 aa] {ON} Anc_5.546
           YML015C
          Length = 346

 Score = 32.7 bits (73), Expect = 5.4,   Method: Composition-based stats.
 Identities = 33/152 (21%), Positives = 70/152 (46%), Gaps = 9/152 (5%)

Query: 573 VVADRVNVITVSLDTFNALSEINNVKRQTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLF 632
           V+++  + ++  L +F     +N+   QT L    + Q++N      N+ K  +T     
Sbjct: 37  VLSEDQDYVSWKLKSFRTGGTMNSF-LQTNLQHQREQQQANNVKEKENRVKKPSTKNQ-- 93

Query: 633 PVNNYPKNASLLVEIYNDKLIVGGVSNRISTIDLNENFEIKSS---ENRTIQGDVYGITK 689
            +NN PKN   + +IY          NRI  +D +E F++  +   E++T + +V+  T 
Sbjct: 94  -INNVPKNVKFIRDIYETIQAEEIKQNRIKELDHDEQFKLLVTNLDEDQTNRFEVFHRTS 152

Query: 690 TGQGLL--IYGDLRSSDNQSTVLLFNESFGKV 719
             +  +  + G + +      + +F ++ GK+
Sbjct: 153 LNKSQVKKLAGTVTNQSINDNIRVFLQAIGKI 184

>AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic homolog
            of Saccharomyces cerevisiae YIL014W (MNT3)
          Length = 645

 Score = 33.1 bits (74), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 40/91 (43%), Gaps = 6/91 (6%)

Query: 1029 PSDDSLIGSVSTISTNTKSDTLNKRATNNAH---DGSILLLNGNFTMPQYGNLQSLLFDF 1085
            P   ++IG    +S + + D     +   AH   DGSIL +NG     ++  ++    DF
Sbjct: 492  PRPPAIIGVPQLVSNHGQVDEYKICSAQIAHMDDDGSILWVNGGLKNCKFDAVER---DF 548

Query: 1086 QAWTPYFISEISNSSNYNPTFFINRDVSTEF 1116
            + +T YF  +  N  N    + +  D+   F
Sbjct: 549  EDYTEYFSKKYINKENLQKFYDLEVDMQMAF 579

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 133,322,579
Number of extensions: 6220229
Number of successful extensions: 21212
Number of sequences better than 10.0: 119
Number of HSP's gapped: 21675
Number of HSP's successfully gapped: 126
Length of query: 1220
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1099
Effective length of database: 39,606,813
Effective search space: 43527887487
Effective search space used: 43527887487
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)