Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.1428.254ON66365130980.0
YLR083C (EMP70)8.254ON66765128220.0
Suva_10.1678.254ON68467227550.0
Skud_12.1518.254ON66465227200.0
NDAI0B023708.254ON72265625790.0
NCAS0B049708.254ON66665524990.0
KAFR0B026808.254ON66465024660.0
Suva_2.2678.254ON67266024240.0
YDR107C (TMN2)8.254ON67265924230.0
Smik_4.3538.254ON69066023790.0
KNAG0G019908.254ON66765023720.0
Skud_4.3688.254ON67266023520.0
ZYRO0C01848g8.254ON64765122960.0
Kpol_543.358.254ON65865122420.0
SAKL0H17248g8.254ON66064921910.0
TBLA0E043708.254ON67666321870.0
KLLA0F18931g8.254ON66565221830.0
CAGL0B01683g8.254ON69168021730.0
KLTH0G13882g8.254ON68767521640.0
Kwal_56.235778.254ON68367121390.0
TPHA0A018408.254ON68567920840.0
NCAS0B038908.254ON66365520770.0
TBLA0H014508.254ON67365420480.0
TDEL0F038108.254ON65665019920.0
NDAI0J014208.254ON61962218910.0
AGR097W8.254ON65365218830.0
Ecym_43178.254ON60564615050.0
NCAS0A145207.411ON6706823411e-32
YER113C (TMN3)7.411ON7067153401e-32
Smik_5.2587.411ON7067213303e-31
Skud_5.2667.411ON7077163294e-31
TDEL0C027107.411ON6786883284e-31
SAKL0F12914g7.411ON7077243269e-31
NDAI0A015107.411ON6796683205e-30
KLLA0E20835g7.411ON6766683171e-29
Suva_5.2347.411ON7067143054e-28
ZYRO0B03784g7.411ON6586362832e-25
CAGL0G03487g7.411ON7047092771e-24
Kwal_27.107467.411ON6902762271e-18
KLTH0C06226g7.411ON6942742217e-18
KNAG0C034307.411ON6802371941e-14
KAFR0K019507.411ON6642691922e-14
AGL295C7.411ON6572691771e-12
TPHA0K007307.411ON7334971734e-12
Ecym_71437.411ON6762831718e-12
TBLA0I003307.411ON7132761441e-08
Kpol_1045.287.411ON6812731153e-05
SAKL0A09812g2.545ON75142850.15
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.142
         (663 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...  1197   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...  1091   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...  1065   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...  1052   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   998   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   967   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   954   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   938   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   937   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   920   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   918   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   910   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   889   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   868   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   848   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   847   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   845   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   841   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   838   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   828   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   807   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    804   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   793   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   771   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   733   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   729   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   584   0.0  
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   135   1e-32
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   135   1e-32
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   131   3e-31
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   131   4e-31
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   130   4e-31
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   130   9e-31
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   127   5e-30
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   126   1e-29
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   122   4e-28
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   113   2e-25
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   111   1e-24
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    92   1e-18
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    90   7e-18
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...    79   1e-14
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    79   2e-14
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    73   1e-12
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    71   4e-12
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    70   8e-12
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    60   1e-08
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    49   3e-05
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    37   0.15 

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score = 1197 bits (3098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/651 (90%), Positives = 587/651 (90%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY
Sbjct: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
           NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN
Sbjct: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN 192
           KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN
Sbjct: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN 192

Query: 193 QGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETC 252
           QGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETC
Sbjct: 193 QGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETC 252

Query: 253 ETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXXX 312
           ETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQW           
Sbjct: 253 ETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVVV 312

Query: 313 XXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSG 372
                      RALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSG
Sbjct: 313 LLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSG 372

Query: 373 VQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKA 432
           VQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKA
Sbjct: 373 VQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKA 432

Query: 433 NXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA 492
           N                   NFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA
Sbjct: 433 NLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA 492

Query: 493 RKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI 552
           RKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI
Sbjct: 493 RKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI 552

Query: 553 FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILF 612
           FYM                       YHSLCLENWKWQWRGFIVGGAGCALYVFIHSILF
Sbjct: 553 FYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILF 612

Query: 613 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD
Sbjct: 613 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score = 1091 bits (2822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/651 (81%), Positives = 556/651 (85%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           VST KAFYLPGVAPTTY+END IPLLVNHLTPSM YQHKDE+GNNVSGDKENFLYSYDYY
Sbjct: 17  VSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFLYSYDYY 76

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
            +RFHFC+PEKVEKQPESLGS+IFGDRIYNSPFQL ML+EKEC SLCK  IPG+DAKFIN
Sbjct: 77  YNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGDDAKFIN 136

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN 192
           KLIKNGFFQNWLIDGLPAAR V D RTKTSFYGAGF LGFV+VTQGT  EATP  AETT+
Sbjct: 137 KLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEATPKGAETTD 196

Query: 193 QGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETC 252
           + VEL+TR+  NMV+TYE PYF NH+DI IEYHDRGEGNYRVVGVIV PVSIKRS P TC
Sbjct: 197 KDVELETRNDRNMVKTYELPYFANHFDIMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTC 256

Query: 253 ETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXXX 312
           ET GSPLMLDE NDNEVYFTYSVKF ES TSWATRWDKYLHVYDPSIQW           
Sbjct: 257 ETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDPSIQWFSLINFSLVVV 316

Query: 313 XXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSG 372
                      RALKSDFARYNELNLDDDFQEDSGWKL+HGDVFR+PS+SLTLSILVGSG
Sbjct: 317 LLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSG 376

Query: 373 VQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKA 432
           VQLF MVTCSIFFAALGFLSPSSRGSLATVMF+LYALFGFVGSYTSMGIYKFF+GPYWKA
Sbjct: 377 VQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKA 436

Query: 433 NXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA 492
           N                   NFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSL+A
Sbjct: 437 NLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIA 496

Query: 493 RKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI 552
           RK+CHWDEHPTKTNQIARQIPFQPWYLKT+PATLIAG+FPFGSIAVELYFIYTSLWFNKI
Sbjct: 497 RKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKI 556

Query: 553 FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILF 612
           FYM                       YHSLCLENWKWQWRGFI+GGAGCALYVFIHSILF
Sbjct: 557 FYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGAGCALYVFIHSILF 616

Query: 613 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSM F+RKIYSSIKVD
Sbjct: 617 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD 667

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score = 1065 bits (2755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/672 (78%), Positives = 551/672 (81%), Gaps = 21/672 (3%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           VS A+AFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQH+DE+GNNVSGDKE+FLYSYDYY
Sbjct: 13  VSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYY 72

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
             +FHFCKPE VEKQPESLGSIIFGDRIYNSPF+L ML+EKECVSLCK  IPG+DAKFIN
Sbjct: 73  YDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFIN 132

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASE---------- 182
           KLIKNGFFQNWLIDGLPAAR V D RTKT FYGAGF LGFVEV Q   SE          
Sbjct: 133 KLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGE 192

Query: 183 ----------ATPNTAETTNQGVELDTRD-GHNMVQTYEHPYFTNHYDIRIEYHDRGEGN 231
                       P   +++N+G+ELD RD G NMV+T E PYF NH+DI+IEYHDRGEGN
Sbjct: 193 TEQTQAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGN 252

Query: 232 YRVVGVIVNPVSIKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKY 291
           YRVVGVIVNP+SIKRS P TCET+GSPL+LDE NDNEVYFTYSVKF ES TSWATRWDKY
Sbjct: 253 YRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDKY 312

Query: 292 LHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLS 351
           LHVYDPSIQW                      RALKSDFARYNELNLDDDFQEDSGWKL+
Sbjct: 313 LHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLN 372

Query: 352 HGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFG 411
           HGDVFR PS+SL LSILVGSGVQ+F MVTCSIFFAALGFLSPSSRGSLATVMF+LYALFG
Sbjct: 373 HGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFG 432

Query: 412 FVGSYTSMGIYKFFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLF 471
           FVGSYTSMGIYKFFDGPYWKAN                   NFFLMFVHSSGVIPASTLF
Sbjct: 433 FVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLF 492

Query: 472 FMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVF 531
           FMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKT+PATLIAG+F
Sbjct: 493 FMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGIF 552

Query: 532 PFGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQW 591
           PFGSIAVELYFIYTSLWFNKIFYM                       YHSLCLENWKWQW
Sbjct: 553 PFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCLENWKWQW 612

Query: 592 RGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMF 651
           RGF VGG GCALYVFIHSILFTKFKLGGFTTIVLY+GYSSVISLLCCLVTGSIGFISSMF
Sbjct: 613 RGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMF 672

Query: 652 FIRKIYSSIKVD 663
           FIRKIYSSIKVD
Sbjct: 673 FIRKIYSSIKVD 684

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score = 1052 bits (2720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/652 (78%), Positives = 545/652 (83%), Gaps = 1/652 (0%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           VS  KAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQH+DE+GN+VSGDKENFLYSYDYY
Sbjct: 13  VSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYY 72

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
             RFHFC+P+ VEKQPESLGS+IFGDRIYNSPF+L ML+EKECV LC  TIPGNDAKFIN
Sbjct: 73  YDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFIN 132

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN 192
           KLIKNGFFQNWLIDGLPAAR V D RTKT+FYGAGFELG VEV+QGT S+  P  AETTN
Sbjct: 133 KLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTN 192

Query: 193 QGVELDTR-DGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPET 251
           +G+EL TR + +++V+T+EHPYF NH+DI IEYHDRG G+YRVVGVIVNP+SIKRS   T
Sbjct: 193 EGLELGTRAEDYSIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGVIVNPLSIKRSITGT 252

Query: 252 CETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXX 311
           CETD SPL+LDEE DNEV FTYSVKF ES TSWATRWDKYLHVYDPSIQW          
Sbjct: 253 CETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWFSLINFSLVV 312

Query: 312 XXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGS 371
                       RALKSDFARYNELNL+DDFQEDSGWKL+HGDVFR PS SL LSILVGS
Sbjct: 313 VLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPSHSLLLSILVGS 372

Query: 372 GVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWK 431
           GVQLF MVTCSIFFAALGFLSPSSRGSLATVMF+LYALFGFVGSYTSMGIYKFF+GPYWK
Sbjct: 373 GVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWK 432

Query: 432 ANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLV 491
           AN                   NFFLM VHSSGVIPA TLFFMVFLWFLFSIPLSF GSL+
Sbjct: 433 ANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLI 492

Query: 492 ARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNK 551
           ARKKC WDEHPTKTNQIARQIPFQPWYLKT+PATLIAG+FPFGSIAVELYFIYTSLWFNK
Sbjct: 493 ARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNK 552

Query: 552 IFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSIL 611
           IFYM                       YHSLCLENWKWQWRGFIVGG GCALYVFIHSIL
Sbjct: 553 IFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGVGCALYVFIHSIL 612

Query: 612 FTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           FTKFKLGGF TIVLYVGYS VISLLCCLVTGSIGFISSMFF+R+IYSSIKVD
Sbjct: 613 FTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/656 (72%), Positives = 528/656 (80%), Gaps = 5/656 (0%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           +S  +AFYLPGVAPTTY  +DEIPLLVNHLTPSMY+QHK+E+G  +  DKE FLYSYDYY
Sbjct: 67  LSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFLYSYDYY 126

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
             RFHFC+PE +EKQPESLGSIIFGDRIYNSPFQ+ ML++K CVSLCK TIPG DAKFIN
Sbjct: 127 YDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPGKDAKFIN 186

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAE--- 189
           KLIKNGFFQNWLIDGLPAAR V D RTKT FYG GFELGFV+V QGT +    NT     
Sbjct: 187 KLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGTTTGDNANTVAKKP 246

Query: 190 TTNQGVELDTRDGHN--MVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRS 247
           TTN+G+ELDTRD  N  M++ +E PYF NH+DI++EYHDRGE NYRVVGVIVNPVSIKRS
Sbjct: 247 TTNEGLELDTRDAKNVQMLKNFELPYFANHFDIQVEYHDRGENNYRVVGVIVNPVSIKRS 306

Query: 248 DPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXX 307
            P TCET G+PLML E+ DN+VYFTYSVKF+ SET WATRWDKYLH+YDP+IQW      
Sbjct: 307 TPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHIYDPAIQWFSLINF 366

Query: 308 XXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSI 367
                           +ALKSDFARYNELNLDDDFQE++GWKL HGDVFR P RSL LS+
Sbjct: 367 SVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGDVFRIPHRSLLLSV 426

Query: 368 LVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDG 427
           LVGSGVQLF M+ CSIFFAALGFLSPSSRGSLATVMF+LYALFGFVGSYTSMG+YKFF G
Sbjct: 427 LVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGVYKFFGG 486

Query: 428 PYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFA 487
           PYWK N                   N FL+FVHSSGVIPA TLFFM+ LWF+FSIPL+ A
Sbjct: 487 PYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMILLWFVFSIPLALA 546

Query: 488 GSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSL 547
           GSL+A KKC+WDEHPTKTNQIARQIPFQPWYLKT PATLIAG+FPFGSIAVELYFIY+SL
Sbjct: 547 GSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFGSIAVELYFIYSSL 606

Query: 548 WFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFI 607
           WFNKIFYM                       YHSLCLENW WQWRGFI+GG GCA+YVFI
Sbjct: 607 WFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGFIIGGVGCAIYVFI 666

Query: 608 HSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           HSILFTKFKLGGFTTIVLYVGYS++ISLL C+VTG+IGF+SSMFFIRKIYSSIKV+
Sbjct: 667 HSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIRKIYSSIKVE 722

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  967 bits (2499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/655 (70%), Positives = 517/655 (78%), Gaps = 6/655 (0%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           +S  +AFYLPGVAPTTY E DEIPLLVNHLTPS+Y+Q  D  G   S +KE+FLYS+DYY
Sbjct: 14  LSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDYY 71

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
             R HFCKPE +EKQPESLGSIIFGDRIYNSPF+LKMLEEK CVSLCK TIPG DAKFIN
Sbjct: 72  FDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFIN 131

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNT--AET 190
           KLIKNGFFQNWLIDGLPAA  V D++TK+ FYG GFELGFVE  Q    +A   T   +T
Sbjct: 132 KLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQT 191

Query: 191 TNQGVELDTRDGHN--MVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSD 248
           TN+G+EL+TR+  N  MV+  E  YF NHYDI++EYHDRGEG YRVVGVIVNPVSIKRS 
Sbjct: 192 TNEGLELETREAKNVQMVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRST 251

Query: 249 PETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXX 308
           P TCET G PL+L E+ DN+VYFTYSVKFV SET WATRWDKYLH YDP+IQW       
Sbjct: 252 PGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFSLVNFS 311

Query: 309 XXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSIL 368
                          +ALKSDFARYNE NL+DDFQED+GWKL HGDVFR P +S+ LS+L
Sbjct: 312 IIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMLLSVL 371

Query: 369 VGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGP 428
           VGSGVQLF M++CSIFFAALGFLSPSSRGSLATVMF+LYALFGFVGSYTSM +YKFF GP
Sbjct: 372 VGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGP 431

Query: 429 YWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAG 488
           YWK N                   NFFLMF HSSGV+PA TLFFM+ LWF+FSIPL+FAG
Sbjct: 432 YWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAG 491

Query: 489 SLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLW 548
           SL+A KKC WDEHPTKTNQIARQIPFQPWYLKT PAT+IAG+FPFGSIAVELYFIYTSLW
Sbjct: 492 SLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLW 551

Query: 549 FNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIH 608
           FNKIFYM                       YHSLCLENW+WQWRGFIVGG GCA+YVF+H
Sbjct: 552 FNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVGGVGCAIYVFVH 611

Query: 609 SILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           SILFTKFKLGGF TIVLYVGYS++ISLL C+VTG+IGF+SS+ F+RKIYS+IKVD
Sbjct: 612 SILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/650 (70%), Positives = 511/650 (78%), Gaps = 2/650 (0%)

Query: 16  AKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSR 75
            +AFYLPGVAPTTY E DEIPLLVNHL+PSMY+QHK++EG +VS DK  +LYSYDYY  R
Sbjct: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDR 74

Query: 76  FHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLI 135
           FHFC+PEK+EKQPESLGSI+FGDRIYNSPFQL MLEEK+C SLCK TIPGNDAKFINKLI
Sbjct: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134

Query: 136 KNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGV 195
           KNGFFQNWLIDGLPAA    D RT T FYG+GFELG V+V Q              NQG 
Sbjct: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGA 194

Query: 196 ELDTRDGHNM--VQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCE 253
           ELD RD  N+  ++  E  YF NHYDIRIEYHDRG G+YRVVGVIVNPVSI+RS P +CE
Sbjct: 195 ELDARDAKNVKTIKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCE 254

Query: 254 TDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXXXX 313
           + G PL L E+ DN+VYFTYSV FV SETSWATRWDKYLHVYDP+IQW            
Sbjct: 255 STGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIVLL 314

Query: 314 XXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGV 373
                     +ALK+DFARYNE NLDD+FQED+GWKL HGDVFR P +S+ LS+LVGSGV
Sbjct: 315 LSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGSGV 374

Query: 374 QLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKAN 433
           QLF M++ +IFFAALGFLSPSSRG L TVMFMLYALFGFVGSYTSMG+YKFF GPYWKAN
Sbjct: 375 QLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 434

Query: 434 XXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVAR 493
                              NFFLM+VHSSGVIPA TLFFMV LWF+FSIP +FAGSLVA 
Sbjct: 435 MVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVAN 494

Query: 494 KKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIF 553
           KKC+W+EHPTKT QIARQIPFQPWYLKT+PAT IAG+FPFGSIAVE+YFIYTSLW+NKIF
Sbjct: 495 KKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIF 554

Query: 554 YMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFT 613
           YM                       YHSLCLENW WQWR FIVGG GCA+YVFIHSILFT
Sbjct: 555 YMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFT 614

Query: 614 KFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           KFKLGGFTT+VLY+GYSS+ISLLCC+VTGSIGF+SSMFF+RKI+SSIKVD
Sbjct: 615 KFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  938 bits (2424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/660 (67%), Positives = 508/660 (76%), Gaps = 9/660 (1%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           ++ AKAF LPGV+PTTY+ NDEIPLLVN LTPS+Y+QHKDE G +VS DKE+FLYSYDYY
Sbjct: 13  IALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYY 72

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
           N +FHFCKPE VEKQPESLGS+IFGDRIYNSPFQLKMLE+KECV+LCK TIPG DAKFIN
Sbjct: 73  NDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFIN 132

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNT----- 187
            LIKNGFFQNWL+DGLPAARNV D RTKT++YG GFELGF +V Q    +  P+T     
Sbjct: 133 TLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELD 192

Query: 188 AETTNQGVELDTRDGH----NMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVS 243
           +E +  G  LD RD      N+VQT E  +F NH++I++EYHDRG GNYRVVGV VNP+S
Sbjct: 193 SEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLS 252

Query: 244 IKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXX 303
           I+RS P  C T G PL L E+ DN+VYFTYSVKF+ S+T WATRWDKYLHVYDP IQW  
Sbjct: 253 IERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFS 312

Query: 304 XXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSL 363
                               RA++SDFARYNELNLD++F ED+GWKL HGDVFR P +S+
Sbjct: 313 LINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSM 372

Query: 364 TLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYK 423
            LS+LVGSG+QLF M+ CSIFFAALG +SP+SRGSL TVMF+LYALFGFVGSYTSMG+YK
Sbjct: 373 VLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYK 432

Query: 424 FFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIP 483
           FF GPYWKAN                   NFFL+F HSSGVIPA TLFF++FLWF  SIP
Sbjct: 433 FFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIP 492

Query: 484 LSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFI 543
           LSFAGS +A K+C WDEHPTKTNQIARQ P QPWYL+T+ ATLIAG+F FGSIAVELYFI
Sbjct: 493 LSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFI 552

Query: 544 YTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCAL 603
           Y+SLWFNKIFYM                       YHSLCLENW WQWR FI+GG GC++
Sbjct: 553 YSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWRSFIIGGLGCSV 612

Query: 604 YVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           Y+FIH+ILFTKFKLGGF T+VLYVGYS +IS LCC+VTG+IGF SSM FIRKIYS IKV+
Sbjct: 613 YMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  937 bits (2423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/659 (67%), Positives = 508/659 (77%), Gaps = 9/659 (1%)

Query: 14  STAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYN 73
           +  K F LPG++PTTY   DEIPLLVN LTPS+Y+QH+DEEGN+VSGDKE+FLYSYDYYN
Sbjct: 14  TLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYN 73

Query: 74  SRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINK 133
            RFHFC+PE VEKQPESLGS+IFGDRIYNSPFQL MLEEKECV+LCK TIPG DAKFIN 
Sbjct: 74  KRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINT 133

Query: 134 LIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPN-----TA 188
           LIK+GFFQNWL+DGLPAAR   D RTKT++YG GFELGF +V Q    +A P+     T+
Sbjct: 134 LIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTS 193

Query: 189 ETTNQGVELDTRDGH----NMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSI 244
           E +N+ V LD R       N+V+T E PYF NH+DI +E+HDRG  NYRVVGVIVNPVSI
Sbjct: 194 EASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI 253

Query: 245 KRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXX 304
           +RS P  C T G PL+LDE+ DNEVYFTYSVKFV S+T WATRWDKYLH+YDP IQW   
Sbjct: 254 ERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSL 313

Query: 305 XXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLT 364
                              RALKSD ARYNELNLD++F EDSGWKL HGDVFR PS+S+ 
Sbjct: 314 INFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSML 373

Query: 365 LSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKF 424
           LSILVGSG+QLF MV CSIFFAA+G +SP SRGSL TVMF+LYALFGFVGSY SMG+YKF
Sbjct: 374 LSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKF 433

Query: 425 FDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPL 484
           F GPYWKAN                   NFFL+F HSSGVIPA +LFF++ LWFL S+PL
Sbjct: 434 FRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPL 493

Query: 485 SFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIY 544
           SFAGS+VA K+C+WDEHPTKTNQIARQIP+QPWYL+T  ATLIAG+F FGSIAVELYFIY
Sbjct: 494 SFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIY 553

Query: 545 TSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALY 604
           +SLWFNKIFYM                       Y+SLCLENW WQWR FI+GG GC++Y
Sbjct: 554 SSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFIIGGLGCSIY 613

Query: 605 VFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
            FIHSILFTKFKLGG  T+VLY+GYS +IS LCC+VTG+IGF SSMFFIRKIYS+IKV+
Sbjct: 614 TFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/660 (65%), Positives = 506/660 (76%), Gaps = 9/660 (1%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           +   KAF LPG++PTTY +NDEIPLLVN LTPS+Y+QH+DE G ++S DKE++LYSYDYY
Sbjct: 31  IGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYLYSYDYY 90

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
           N RFHFC+PE VE+QPESLGSIIFGDRIYNSPFQL+MLE KECV+LC+ TIPG DAKFIN
Sbjct: 91  NERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGKDAKFIN 150

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNT----- 187
           KLIK+GFFQNWL+DGLPAAR V D RTKT++YG GFELG   V      +  P+T     
Sbjct: 151 KLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKVIPSTMEELD 210

Query: 188 AETTNQGVELDTRDGH----NMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVS 243
           +ET+N G  LD R+      N+V+T E PYF NH+DI +E+HDRG+ NYRVVGV VNP+S
Sbjct: 211 SETSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDNYRVVGVTVNPMS 270

Query: 244 IKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXX 303
           I+RS P++C     PL+LDEE DNE+YFTYSVKFV S+T WATRWDKYLH+YDP IQW  
Sbjct: 271 IERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFS 330

Query: 304 XXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSL 363
                               RAL SD +RYNELNLD++F EDSGWKL HGDVFR P++S+
Sbjct: 331 LINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGDVFRTPTKSM 390

Query: 364 TLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYK 423
            LS+LVGSGVQLF M+ CSIF AALG +SP SRGSL TVMF+ YALFGFVGSYTSMG+YK
Sbjct: 391 LLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVGSYTSMGVYK 450

Query: 424 FFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIP 483
           FF GPYWKAN                   NFFL+F HSSGVIPASTLFF++FLWF  SIP
Sbjct: 451 FFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFIIFLWFAVSIP 510

Query: 484 LSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFI 543
           LSFAGS++A K C+WDEHPTKTNQIARQ+P+QPWYL+T+ ATLIAG+F FGSIAVELYFI
Sbjct: 511 LSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFGSIAVELYFI 570

Query: 544 YTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCAL 603
           Y+SLWFNKIFYM                       YHSLCLENW+WQWR FI+GG GC++
Sbjct: 571 YSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSFIIGGLGCSV 630

Query: 604 YVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           Y+FIHSILFTKFKLGGF TIVLY GYS +IS LCC+VTG+IGF S M FIRKIYS++K++
Sbjct: 631 YMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIRKIYSAVKIE 690

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  918 bits (2372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/650 (68%), Positives = 506/650 (77%), Gaps = 3/650 (0%)

Query: 16  AKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSR 75
             AFYLPGVAPTTYK NDEIPLLVNHL+PSMY+QH+ E+G N+ GDK  +LYSYDYY  R
Sbjct: 19  VNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYDR 78

Query: 76  FHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLI 135
           FHFC+PEK+ K+PESLGSIIFGDRIYNSP+Q+KMLEEK CV LC   IPG DA+FINKLI
Sbjct: 79  FHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLI 138

Query: 136 KNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGV 195
           KNGFFQNWLIDGLPAAR V DK T + FYG GFELG VEV Q  A +A  +  E  +   
Sbjct: 139 KNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVA-QAKTHPKEDDSGSA 197

Query: 196 ELDTRDGHN--MVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCE 253
           +L TRD  N  M++  E PYF NH+DI +EYHDRGEGN RVVGV V+P+SIKRS P TC+
Sbjct: 198 KLSTRDAKNVQMLKNVELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQ 257

Query: 254 TDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXXXX 313
           T G PLMLDE+NDNEVYFTYSV+FV S+T WATRWDKYLH YDP+IQW            
Sbjct: 258 TSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWFSLVNFSIVVVL 317

Query: 314 XXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGV 373
                     +AL+SDFARYNELNLD++FQEDSGWKL+HGDVFR PS+S+ LSILVGSG+
Sbjct: 318 LSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSGI 377

Query: 374 QLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKAN 433
           QLF M++ SIFFAALGFLSPSSRGSL TVMFMLYALFGFVGSYTSMG+YKFF GPYWKAN
Sbjct: 378 QLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 437

Query: 434 XXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVAR 493
                              N FL+  HSSG IPA TLFF+V LWF+ S+P + AGSL+A 
Sbjct: 438 MILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAH 497

Query: 494 KKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIF 553
           KKC WDEHPTKTNQ+ARQ+PFQPWYLKTV AT IAG+FPFGSIAVELYFIYTSLW+NKIF
Sbjct: 498 KKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKIF 557

Query: 554 YMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFT 613
           YM                       YHSL LENW+WQWR FIVGG GCA+Y+F+HSILFT
Sbjct: 558 YMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILFT 617

Query: 614 KFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           K KLGGF TIVLYVGYS+VISLLCCLVTGSIGF+SSMFF+R+IYSSIKV+
Sbjct: 618 KLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/660 (64%), Positives = 500/660 (75%), Gaps = 9/660 (1%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           +  AKAF LPG++PTTY  NDEIPLLVN LTPS+Y+QH+DE GN++S DKE+FLYSYDYY
Sbjct: 13  IPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYY 72

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
           N RFHFC+PE VEKQPESLGS+IFGDRIYNSPFQL+MLEEKECV+LCK TIPG DA+FIN
Sbjct: 73  NERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFIN 132

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAE--- 189
           +LI +GFFQNWL+DGLPAAR+V D RTKT++YG GFELGF +V Q    E  PNT E   
Sbjct: 133 RLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEAD 192

Query: 190 --TTNQGVELDTRDGHNM----VQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVS 243
              +N G  L  R   N+    V+T E PYF NH++I +E+H+RG  +YR+VGV VNPVS
Sbjct: 193 MDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVS 252

Query: 244 IKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXX 303
           I+RS P +C     PL L E+ DNEVYFTYSVKFV S T WATRWDKYLH+YDP IQW  
Sbjct: 253 IERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFS 312

Query: 304 XXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSL 363
                               RALKSD  RYNELNL+++F ED+GWKLSHGDVFR P +S+
Sbjct: 313 LIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSM 372

Query: 364 TLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYK 423
            LS+LVGSG+QLF M+ CSIFFAA G +SP SRGSL TVMF+LYALFGFVGSYTSMG+YK
Sbjct: 373 LLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYK 432

Query: 424 FFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIP 483
           FF GPYWKAN                   N FL+F HSSGVIPA +LFF++FLWF+ SIP
Sbjct: 433 FFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIP 492

Query: 484 LSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFI 543
           LSF GS++A K+C W+EHPTKTNQIARQIP QPWYL+T  AT++AG+F FGSIAVELYFI
Sbjct: 493 LSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFI 552

Query: 544 YTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCAL 603
           Y+SLWFNKIFYM                       YHSLCLENW WQWR FI+GG GC++
Sbjct: 553 YSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQWRSFIIGGLGCSI 612

Query: 604 YVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           Y+FIHSILFTKFKLGGF T+VLY+GYS ++S+LCC+VTG+IGF SSM FIRKIY ++KV+
Sbjct: 613 YMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/651 (66%), Positives = 491/651 (75%), Gaps = 18/651 (2%)

Query: 14  STAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYN 73
           S  KAFYLPGVAPTTY  NDEI LLVNHLTPSM +QH+DE+GN V GDKE++LYSYDYY 
Sbjct: 14  SLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLYSYDYYY 73

Query: 74  SRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINK 133
           S+FHFCKPE V +QP SLGS+IFGDRI+NSPF+L MLEEKECV LC   IPG DAKF+NK
Sbjct: 74  SKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNK 133

Query: 134 LIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQ 193
           LIKNGF QNWLIDGLPA R + D RT ++FYG GF+LGFV+VT+G +             
Sbjct: 134 LIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFS------------- 180

Query: 194 GVELDTRDGH-NMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETC 252
               D+ D    +++T E PY  NHYDI IEYHDRG  NYRVVGV V+PVSIKRS  ++C
Sbjct: 181 ----DSNDEEKKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSC 236

Query: 253 ETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXXX 312
           + +   L L E  +NEV+FTYSVKF++S+T WATRWDKYLHVYDP+IQW           
Sbjct: 237 QYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSVIVV 296

Query: 313 XXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSG 372
                      RALK+D +RYNE NLD++F EDSGWKLSHGDVFR P RSL LSILVGSG
Sbjct: 297 ALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILVGSG 356

Query: 373 VQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKA 432
           VQLF M+ CSI FAALGFLSPSSRGSL TVMF+LYALFGFVGSYTSM IYKFF GP WK 
Sbjct: 357 VQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKV 416

Query: 433 NXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA 492
           N                   NFFL+FV SSG IPA TLF ++ LWF+FSIPLSFAGSL+A
Sbjct: 417 NLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIA 476

Query: 493 RKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI 552
            K+C  D HPTKTNQIARQIP QPWYLKT+P +LIAGVFPF SIAVELYFIYTSLWFNKI
Sbjct: 477 HKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKI 536

Query: 553 FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILF 612
           FYM                       YHSLCLENWKWQWR FI+GG GCA+YVFIHSILF
Sbjct: 537 FYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILF 596

Query: 613 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           TKFKLGGFTT+VLY+GYS +IS+LCC+VTGSIGFISSMFFIRKIYSS+KVD
Sbjct: 597 TKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/651 (64%), Positives = 483/651 (74%), Gaps = 6/651 (0%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           ++   AFYLPGVAPTTY + DEIPLLVNHLTPS+ +QHKD++GN++ G+KE+FLYS+DYY
Sbjct: 14  LALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYY 73

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
             + HFCKPE VEKQPESLGSI+FGDRIYNSPF +KMLE +EC SLCK TIP +DAKFIN
Sbjct: 74  FPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFIN 133

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN 192
           KLIKNGFFQNWLIDGLPAAR + D +TK+ FYG GF LG V V Q     A   +++   
Sbjct: 134 KLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLA---SSKLNL 190

Query: 193 QGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETC 252
           +    + ++ +NMV   E P+  NHYDI +EYHDRGEGNYRVVGV V+P   K S  + C
Sbjct: 191 ENPAREAKNVNNMVHNVEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDP---KSSTGDIC 247

Query: 253 ETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXXX 312
                 L+L E  DNEV F+YSV+F+ SET WATRWDKYLHVYDP+IQW           
Sbjct: 248 TKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFSVVVI 307

Query: 313 XXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSG 372
                      RALKSDFARY E NLDD FQ+DSGWKL HGDVFR P +S+ LSILVGSG
Sbjct: 308 LLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSG 367

Query: 373 VQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKA 432
            QLF MV  SIFFAA+G LSPSSRGSL + MF+LYALFGF GSY SMG+YKFF+GPYWKA
Sbjct: 368 TQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKA 427

Query: 433 NXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA 492
           N                   NFFL+F  SSG IP + L F++ LWF+ SIPLS AGSL+A
Sbjct: 428 NMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIA 487

Query: 493 RKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI 552
            KKC+W EHPTKTN+IARQIPFQPWYLKTVPATLIAG+FPFGSIAVELYFIY+SLWFNKI
Sbjct: 488 NKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKI 547

Query: 553 FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILF 612
           FYM                       Y+SL LENW+WQWR FIVGG GCA Y+F+HSI+F
Sbjct: 548 FYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSFIVGGVGCAFYIFVHSIIF 607

Query: 613 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           TKFKLGGFTTIVLYVGYS +IS LC +VTG+IGFISSM F++KIYSS+KVD
Sbjct: 608 TKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/649 (63%), Positives = 474/649 (73%), Gaps = 2/649 (0%)

Query: 16  AKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSR 75
           A AFYLPGVAPTTY + DEIPLLVNHLTPS Y+QH D+EG+ +SGDKE FLYSYDYY  +
Sbjct: 13  ASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDK 72

Query: 76  FHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLI 135
           FHFC+PE + KQPESLGSIIFGDRIYNSPF+L MLE K CV LCK  IP +DAKFINKLI
Sbjct: 73  FHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLI 132

Query: 136 KNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN-QG 194
           +NGFF NWL+DGLPAAR + D RT + FYG GFELGFV+V        T   +E+   + 
Sbjct: 133 RNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEI 192

Query: 195 VELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCET 254
            + D        +  E  YF NH+DI+IEYHDRGE NYRVVGV V P SIKR   ++C+T
Sbjct: 193 ADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDT 252

Query: 255 DGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXX 314
           +G PL+L E+ DN V+FTYSV FV S+T WATRWDKYLHVYDP IQW             
Sbjct: 253 EGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVILL 312

Query: 315 XXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGVQ 374
                    RALK+D +RYNELNLDD+FQE++GWKL HGDVFR P R++ LS+LVGSG Q
Sbjct: 313 SSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQ 372

Query: 375 LFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKANX 434
           LF M   +I FA LG LSPSSRGSL TVMF+LYALFG  GSYTSM +YKFF+G  WK N 
Sbjct: 373 LFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNM 432

Query: 435 XXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARK 494
                             N FL+FVHSSG IP  T+  +V LWF+FSIPLS AGS+++RK
Sbjct: 433 ILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRK 492

Query: 495 KCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIFY 554
           K  WD  PT TNQIARQIPFQPWYLKTVPA+LIAG FPFGSI VELYFIY+SLWFNKIFY
Sbjct: 493 KSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFY 551

Query: 555 MXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFTK 614
           M                       Y+SLC+ENWKWQWRGF +GGAGCA YVF+H+ILFTK
Sbjct: 552 MFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILFTK 611

Query: 615 FKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           FKLGG TT+VLY+GYS VIS LCCL+TG++GF+SS++F+RKIY SIKVD
Sbjct: 612 FKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/663 (60%), Positives = 486/663 (73%), Gaps = 13/663 (1%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           +S    FYLPGVAPTTY E D IPLLVNHLTPSM+++HKD +GN +S DKENFLYSYDYY
Sbjct: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74

Query: 73  NSRFHFCKP--EKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKF 130
            S+ HFCKP   +++KQPESLGSI+FGDRIYNSPF+LKML ++ C  LC   IPG+DAKF
Sbjct: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134

Query: 131 INKLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQ---GTASEATPNT 187
           IN LIK+GF QNWLIDGLPAAR + D+ TK+SFYG+GFELG VE+ Q      S  TP  
Sbjct: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194

Query: 188 -------AETTNQGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVN 240
                  ++  ++    + R    +V + E  YF NH+DI IEYHDRG   YR+VGV VN
Sbjct: 195 PIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVN 254

Query: 241 PVSIKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQ 300
           P+S+KR D   C+T+   L L E +D +V FTYSV F +S+T WATRWDKYLH+YDP+IQ
Sbjct: 255 PISMKR-DSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQ 313

Query: 301 WXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPS 360
           W                      +ALK+DF RYNE NL+D F EDSGWKL+HGDVFR P+
Sbjct: 314 WFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPT 373

Query: 361 RSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMG 420
           +S+ LSI VGSG QLFFM++  +  AALGFLSPS+RGSL T+MF+LYA+FGFVGSYTSMG
Sbjct: 374 KSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMG 433

Query: 421 IYKFFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLF 480
           +Y+FF+GPYWKAN                   N FL+FVHSS V+P  TL  MV LW + 
Sbjct: 434 VYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVL 493

Query: 481 SIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVEL 540
           S+PLSFAGSL++ K+C W +HPTKTN++ RQIPFQPWYLKTVPATLI G+FPFGSIAVEL
Sbjct: 494 SLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVEL 553

Query: 541 YFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAG 600
           YFIY+SLWFNKIFYM                       YHSLCLENW+WQWR FI+GG G
Sbjct: 554 YFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIG 613

Query: 601 CALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSI 660
           C++Y+FIHSILFT+FKLGGF TIVLYVGYS++I++LC +VTG+IGFIS+MFF++KIYSSI
Sbjct: 614 CSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSI 673

Query: 661 KVD 663
           KV+
Sbjct: 674 KVE 676

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/652 (61%), Positives = 482/652 (73%), Gaps = 10/652 (1%)

Query: 16  AKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSR 75
            +AFYLPGVAPTTY E D++PLLVNHLTPS +Y+H D + ++ +GDKE FLYSYDYY  +
Sbjct: 20  VEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGDKEGFLYSYDYYYKK 78

Query: 76  FHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLI 135
           FHFC+P +++KQPESLGSIIFGDRIYNSPF+L++L+  EC SLCK  IPG DAKFINKLI
Sbjct: 79  FHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKLI 138

Query: 136 KNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGV 195
            NGFFQNW+IDGLPAAR + D +T   FYG GFELG V+V     S+  P+T    ++ +
Sbjct: 139 LNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDV----LSDYEPDTRSLHDE-L 193

Query: 196 ELDTRDGHNMV----QTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPET 251
           EL      N++    +  E PYF NHYDI+IEYHDRGE NYR+VGV VNP SIKR  P++
Sbjct: 194 ELQLNAKKNVLSPGDKVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDS 253

Query: 252 CETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXX 311
           CE+ G  L+L E  DNEVYFTYSVKF++S+T WATRWDKYLHVYDP IQW          
Sbjct: 254 CESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIV 313

Query: 312 XXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGS 371
                        ALK+D ARYNELNLD DF+E++GWKL HGDVFR+P+++L LS+LVGS
Sbjct: 314 VLLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGS 373

Query: 372 GVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWK 431
           G QL  M+T +I FA LGFLSPSSRGSL+TVMF+LYA+FG  GS+TSM  YKFF+G  W+
Sbjct: 374 GGQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWR 433

Query: 432 ANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLV 491
            N                   NFFL+FVHSSG IP  T+  +V LWF+ SIPLS  GS++
Sbjct: 434 LNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVI 493

Query: 492 ARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNK 551
           A KKC+W+EHPTKTNQIARQIPFQPWYLKT+P  L+AG+FPFGSIAVELYFIY+SLWFNK
Sbjct: 494 AWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNK 553

Query: 552 IFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSIL 611
           I+YM                       YHSLC+ENWKWQWR F++GG GCA YVF HSIL
Sbjct: 554 IYYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSIL 613

Query: 612 FTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           FTKF+LGG TTIVLY+GYS +IS LCCLVTG+IGF+SS+  +RKIYS +KVD
Sbjct: 614 FTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/680 (60%), Positives = 471/680 (69%), Gaps = 29/680 (4%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           V++   FYLPG AP TYK+ D IPLLVNHLTPS+ +QH D++GN + GDK   LY YDYY
Sbjct: 12  VASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYY 71

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
           N + HFC+PEK+EKQPESLGS+IFG++IYNSPF +KMLE+ ECV LC  TIPG DAKFIN
Sbjct: 72  NEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFIN 131

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTA------SEATPN 186
           KLIKNGF QNWLIDGLPAAR + D RT T FYG GFELGFVEV Q         SE    
Sbjct: 132 KLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQ 191

Query: 187 TAETTNQGV------------------ELDTRDGHNMVQT----YEHPYFTNHYDIRIEY 224
            +E   + +                   L+ R+  N+V       E P F NH+DI +EY
Sbjct: 192 LSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEY 251

Query: 225 HDRGEGNYRVVGVIVNPVSIKRSDPETCE-TDGSPLMLDEENDNEVYFTYSVKFVESETS 283
           HDRG G++RVVGVIVNPVS+      +C   +   L LDE  DNEV FTYSVKF  S+T 
Sbjct: 252 HDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTP 311

Query: 284 WATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQ 343
           WATRWDKYLH+YDP IQW                      RALKSD +RYNE NL D+F+
Sbjct: 312 WATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFE 371

Query: 344 EDSGWKLSHGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVM 403
           EDSGWKL HGDVFR P  S+ LS+LVGSG+QLF M+  SI  +ALG LSPSSRGSL T M
Sbjct: 372 EDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRGSLPTAM 431

Query: 404 FMLYALFGFVGSYTSMGIYKFFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSG 463
           FM YA+FGFVGSYTSMGIYKFF GPYWKAN                   N  L FV SS 
Sbjct: 432 FMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSN 491

Query: 464 VIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVP 523
           VIP +TL FMVFLW LFSIPL+FAGSL++ KKC+WDEHPTKTN+I RQIPFQPW+LKTVP
Sbjct: 492 VIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVP 551

Query: 524 ATLIAGVFPFGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLC 583
           ATLI G+  FGSIAVELYFIY+SLWFNKIFYM                       Y +LC
Sbjct: 552 ATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALC 611

Query: 584 LENWKWQWRGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGS 643
            ENW WQWR F +GG GC++Y+FIHSILFT+FKLGGF TIVLYVGYS +IS L C+VTG+
Sbjct: 612 SENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGA 671

Query: 644 IGFISSMFFIRKIYSSIKVD 663
           IGFI SMFF+R+I++SIKVD
Sbjct: 672 IGFICSMFFVRRIFASIKVD 691

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/675 (61%), Positives = 483/675 (71%), Gaps = 26/675 (3%)

Query: 14  STAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYN 73
           S    FYLPGVAPTTY E D IPLLVNHLTP+MYYQH DE+GN++ GDKE+ LYSYDYY 
Sbjct: 14  SQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-GDKESLLYSYDYYY 72

Query: 74  SRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINK 133
            +FHFC+PEK+EKQ ESLGSIIFGDRIYNSPFQ++ML+ KEC SLC ++IP +DAKFINK
Sbjct: 73  PKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINK 132

Query: 134 LIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEV--------TQGTASEATP 185
           LI NGFFQNWL+DGLPAAR  +D RTK+ FY  GFELG+V +         QG + +   
Sbjct: 133 LITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNGQGGSQDGDD 192

Query: 186 NTAETTNQGV-ELDTRDG----------------HNMVQTYEHPYFTNHYDIRIEYHDRG 228
           + +  + + V E D  D                   +V+  E PYF NH++I ++YHDRG
Sbjct: 193 SGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRG 252

Query: 229 EGNYRVVGVIVNPVSIKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRW 288
            GNYRVVGVIVNP SIKR  P+TC+  G  L L E    EV+F+YSVKF  SET WATRW
Sbjct: 253 NGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRW 312

Query: 289 DKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGW 348
           DKYLHVYDP IQW                        L  D +RYN++NLDDDFQE++GW
Sbjct: 313 DKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGW 372

Query: 349 KLSHGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYA 408
           KL HGDVFR P RSL LS+LVGSG QLF M  C+I FA LG LSPSSRGSL TVMF+LYA
Sbjct: 373 KLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSSRGSLTTVMFILYA 432

Query: 409 LFGFVGSYTSMGIYKFFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPAS 468
           LFG  GSYTSM  YKFF GPYWK N                   NFFL+ V S+G IP  
Sbjct: 433 LFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFG 492

Query: 469 TLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIA 528
           T+  +V LWFLFSIPLS AGSL+ARKKC WDEHPTKT QI RQIPFQPWYLKTVPA+LIA
Sbjct: 493 TMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIA 552

Query: 529 GVFPFGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWK 588
           G+FPFGSIAVELYFIY+SLWFNKIFYM                       Y+SLCLENWK
Sbjct: 553 GIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITVLLTYYSLCLENWK 612

Query: 589 WQWRGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFIS 648
           WQWRGF +GGAGCALY+FIH+ILFTKF+LGGFTTIVLYVGYS V+SLL CL+TG++GF+S
Sbjct: 613 WQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLS 672

Query: 649 SMFFIRKIYSSIKVD 663
           S++F+R+IYSS+KVD
Sbjct: 673 SLWFVRRIYSSVKVD 687

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/671 (60%), Positives = 477/671 (71%), Gaps = 21/671 (3%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
            S  + FYLPGVAPTTY E D IPLLVNHLTPSMY++H D++G + +GD+E+FLYSYDYY
Sbjct: 14  ASRVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYY 72

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
             +FHFCKPEK+EKQ ESLGSIIFGDRIYNSPF+L+ML++KEC +LC   IP NDAKFIN
Sbjct: 73  YDKFHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFIN 132

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEV--------TQGTASEAT 184
           KLI NGFFQNWL+DGLPAAR  +D+RTK+ FY  GFELGF++V         QG      
Sbjct: 133 KLIANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHP 192

Query: 185 PNTAETTNQGVELDTR------------DGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNY 232
               +   Q   LD              D   +V+  E  YF NH++I ++YHDRG G+Y
Sbjct: 193 KGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDY 252

Query: 233 RVVGVIVNPVSIKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYL 292
           RVVGVIVNP SIKR    +C   G  L L EE +  V+F+YSVKF  S+T WATRWDKYL
Sbjct: 253 RVVGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYL 312

Query: 293 HVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSH 352
           HVYDP IQW                      R L+ D +RYN+LNLDDDFQE++GWKL H
Sbjct: 313 HVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVH 372

Query: 353 GDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGF 412
           GDVFR P++SL LS+LVGSG QLF M  C+I FA LG LSPSSRGSL TVMF+LYALFG 
Sbjct: 373 GDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGS 432

Query: 413 VGSYTSMGIYKFFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFF 472
           +GSYTSM  YKFF G YWK N                   NFFL+ V S+G IP  T+  
Sbjct: 433 LGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCA 492

Query: 473 MVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFP 532
           +V LWF+FSIPLS AGSL+A+KKC W+EHPTKT QI RQIPFQPWYLKT PA LIAG+FP
Sbjct: 493 IVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFP 552

Query: 533 FGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWR 592
           FGSIAVELYF+Y+SLWFNKIFYM                       Y+SLCLENWKWQWR
Sbjct: 553 FGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWR 612

Query: 593 GFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFF 652
           GF +GGAGCALYVF+H+ILFTKFKLGGF TIVLYVGYS VISLL CL+TG++GF+SS++F
Sbjct: 613 GFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWF 672

Query: 653 IRKIYSSIKVD 663
           +R+IYSSIKVD
Sbjct: 673 VRRIYSSIKVD 683

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/679 (58%), Positives = 465/679 (68%), Gaps = 33/679 (4%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           VS   AFYLPGVAP+TY E DE+PLLVNHLTPS+ YQ KD+ G  V   +E  LYS+DYY
Sbjct: 12  VSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKMLYSFDYY 70

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
             + HFCKPEK+ KQP+SLGSI+FGDRIYNSPF +KML+ +  V LC  TIPG+DAKFIN
Sbjct: 71  FPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFIN 130

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN 192
           KLIKNGFFQNWLIDGLPAAR + D  T T FY  GF LGFVE+ +       P  A+T +
Sbjct: 131 KLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAKTKD 190

Query: 193 QGV---------------------------ELDTRDGHNMVQTYEHPYFTNHYDIRIEYH 225
            G                            + + +    +V   E PY  NHY I +E H
Sbjct: 191 SGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHNVEFPYLANHYVINVEVH 250

Query: 226 DRGEGNYRVVGVIVNPVSIKRS-DPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSW 284
           DRGEGNYRVVGV V+P S   S +PE     G+ L LDE+ DNEV F+YSV F+ESET W
Sbjct: 251 DRGEGNYRVVGVTVDPYSTTDSANPE----KGNKLFLDEKKDNEVTFSYSVNFIESETVW 306

Query: 285 ATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQE 344
           ATRWDKYLH Y+P+IQW                      +ALKSDFARY E NLD+ F E
Sbjct: 307 ATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNLDNSFNE 366

Query: 345 DSGWKLSHGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMF 404
           DSGWKL HGDVFR PS+S+ LSILVGSG QLF M+  SIF AA+G +SPSSRGSL + MF
Sbjct: 367 DSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMF 426

Query: 405 MLYALFGFVGSYTSMGIYKFFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGV 464
             YALFGF GSY SM +YKFF GPYWKAN                   NFFL+FVHSSG 
Sbjct: 427 TFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGT 486

Query: 465 IPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPA 524
           IP + L  +V +WF+ S+PLSF GSL+A K+ +W EHPTKTNQIARQIPFQ WYLKT+PA
Sbjct: 487 IPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPA 546

Query: 525 TLIAGVFPFGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCL 584
            LIAG+FPFG+IAVELYFIYTSLWFNKIFYM                       Y SLC+
Sbjct: 547 ILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLITYQSLCM 606

Query: 585 ENWKWQWRGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSI 644
           ENW WQWR F +GG GC+LY+FIHSILFTKFKLGGFTT++LY+GY+ ++S+L C+VTG++
Sbjct: 607 ENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAV 666

Query: 645 GFISSMFFIRKIYSSIKVD 663
           GFISSM F+RKIYS+++VD
Sbjct: 667 GFISSMIFVRKIYSNVRVD 685

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/655 (58%), Positives = 458/655 (69%), Gaps = 7/655 (1%)

Query: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           +S  +AF LPG+ P TY++ D+IPLLVNHLTPSM++ HK+EEG ++S  K+  ++SYDYY
Sbjct: 12  LSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVVHSYDYY 71

Query: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132
             +FHFC+P  +EK   S+GSI+FGDRIYNSPFQL MLE K CV LC+  IPG DA+FIN
Sbjct: 72  YEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGKDAEFIN 131

Query: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTN 192
           KLIKNG++QNW IDGLPAAR V DKRTK+SFYG GFELG VE+ Q T  +  P++    +
Sbjct: 132 KLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDKLLPDSVHDIS 191

Query: 193 QGVELDTRDGHNMVQTY----EHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSD 248
              +L  RD  N+VQ      E PYF NH+DI IEYH+RG GNYRVVG  VNPVSI R  
Sbjct: 192 ---DLAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGATVNPVSIARKS 248

Query: 249 PETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXX 308
              C   G  L L+EE DN V+ TYSV FV S+TSW TRWDKYLHVYDP IQW       
Sbjct: 249 AGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDPKIQWFSLINFS 308

Query: 309 XXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSIL 368
                          +ALKSDFARYN +NLDDD +E+SGWKL HG VFR P   + LSIL
Sbjct: 309 LIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFRIPKNPMILSIL 368

Query: 369 VGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGP 428
           VGSG QLF ++ C++F AA+  LSP  RG+L T M +LY LFGF+ SY SMG+YKFF GP
Sbjct: 369 VGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYVSMGVYKFFKGP 428

Query: 429 YWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAG 488
           YWK N                   N FLMF  SS V+PA T+  ++ LWF  SIPLS AG
Sbjct: 429 YWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLWFAVSIPLSVAG 488

Query: 489 SLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLW 548
           SL+A+KKCHWDEHPT TNQIA+ IP Q WYLKT+PA+LI G+F FGSI+V+LYFIYTSLW
Sbjct: 489 SLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSISVQLYFIYTSLW 548

Query: 549 FNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIH 608
           FN IFYM                       YHSLC ENWKWQWRGF +GG GC++YV +H
Sbjct: 549 FNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIGGLGCSIYVLLH 608

Query: 609 SILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           S+ F + KLGGFT I+LY+GYSSV++ L  LVTGS+GF+SSMFFI++I+SS+KVD
Sbjct: 609 SLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIFSSVKVD 663

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/654 (56%), Positives = 466/654 (71%), Gaps = 7/654 (1%)

Query: 16  AKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSR 75
           + AFY+PG++  TY   D I L VN LTPSMY++H DE G +V+ DKE+FLYSYDYY  +
Sbjct: 19  SNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDK 78

Query: 76  FHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLI 135
           FHFC+PEKVE++ ESLGS++FGDRIYNSPF+L MLE KECV LCK TIP +DAKFINKLI
Sbjct: 79  FHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLI 138

Query: 136 KNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQ--GTASEATPNTAETTNQ 193
           KNGFF NWLIDGLP+AR + D +T++ FY +GF LG V V    G +    P  ++  N+
Sbjct: 139 KNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNE 198

Query: 194 GVEL-DTRDGHN----MVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSD 248
            V+    R+  N    ++   E  YF NH++I IEYHDRG  NYRVVGV V+P+SIKR D
Sbjct: 199 AVKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDD 258

Query: 249 PETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXX 308
            E+C   G+ L L+E  +N+V FTYSV F++SET+WATRWDKYLH YDPSIQW       
Sbjct: 259 FESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFT 318

Query: 309 XXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSIL 368
                          RALK D +RY +LNLD+ F EDSGWKL+HGDVFR P +++ LSI 
Sbjct: 319 IVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIY 378

Query: 369 VGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGP 428
           VGSGVQLF M+ C +  AALGF+SPS RG+L T MF+LYA+FGFVGSYTSMG+YKFF GP
Sbjct: 379 VGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGP 438

Query: 429 YWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAG 488
           YWKAN                   NFFL+ VHSSG IPAST+  M+ LW L S+PLSF G
Sbjct: 439 YWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICLWLLVSVPLSFLG 498

Query: 489 SLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLW 548
           S VA KKC+W+++PT  N+I R+IP QPWY++++P  L++G+ PFG+IAVELYFIY+SLW
Sbjct: 499 SFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLW 558

Query: 549 FNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIH 608
           +NKIFYM                       YHSLCLENW+WQWR F+ GG GCA Y+F++
Sbjct: 559 YNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLY 618

Query: 609 SILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKV 662
           SI FT+FK  GF +I+LY+GYSS+I ++ CL+TG++ F+ +MFF+++I++SIKV
Sbjct: 619 SIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/650 (56%), Positives = 448/650 (68%), Gaps = 6/650 (0%)

Query: 14  STAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYN 73
           + ++A +LPG++PT Y    EI L VNHLTPS ++QHKD++GNN+  DKE++LYSYDYYN
Sbjct: 13  AVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYN 72

Query: 74  SRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINK 133
           S+ HFCKPE V +Q ESLGS++FGDR+YNSPF+L MLE+K CVSLCK  IPG DA FINK
Sbjct: 73  SKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINK 132

Query: 134 LIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQ 193
           LIKNGF  NWL+DGLPA   ++++R  ++    GF LG VE+ QG  + A     E T  
Sbjct: 133 LIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREET-- 190

Query: 194 GVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCE 253
           G+   +  G N+V   E P+  NHYDI I+YH+   G YR+VGV V P SIK++   +CE
Sbjct: 191 GI---SAHGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NSCE 246

Query: 254 TDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXXXX 313
             G  + L E+ DNEV +TYSV++V    +WATRWD Y   YD ++QW            
Sbjct: 247 FTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLISCVIVVIG 306

Query: 314 XXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGV 373
                     RALKSDFARYNELNLDD+F E+SGWKLSHGDVFR P++SL LS+LVGSGV
Sbjct: 307 LSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGSGV 366

Query: 374 QLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKAN 433
           QL  +    I  AA+ F +  SR  L T+ F+LYALFGFVGSY SMG+Y+FF GPY K N
Sbjct: 367 QLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVN 426

Query: 434 XXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVAR 493
                              NFFL+  HSS  IP S LF +V LW + S+PLS AGSL A 
Sbjct: 427 MILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAI 486

Query: 494 KKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIF 553
           K C WD+HPTKTNQIARQIPFQPWYLKT+PA L+AG+FPF SIAVELYFIY SLWF++ F
Sbjct: 487 KTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFF 546

Query: 554 YMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFT 613
           YM                       YHSLCLENW+WQWR FIVGG G A+Y+FIHSI FT
Sbjct: 547 YMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFT 606

Query: 614 KFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           +FKL GFTTIVLYVGYS +IS+LCCL TG++GF SSMF +RKI+SS+KVD
Sbjct: 607 EFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/622 (55%), Positives = 429/622 (68%), Gaps = 7/622 (1%)

Query: 46  MYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPF 105
           M+Y HK++EG ++S D +  +YSYDYY  + HFCKPE VEK   S+GS++FGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 106 QLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYG 165
           QL ML+ K C  LC  TI G DAKFINKLIKNG++QNWLIDGLPAAR V D RTK++FYG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 166 AGFELGFVEVTQGTASEATPNTAETTNQGVELDTRDGHNMVQTY----EHPYFTNHYDIR 221
            GFELG VE+ Q T  +  PN+A+T     +L  RD  N+VQ      E PYF NH+DIR
Sbjct: 121 NGFELGLVEIRQTTGEKLLPNSADTFR---DLHKRDAKNIVQNLMQDIEVPYFVNHFDIR 177

Query: 222 IEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESE 281
           IEYHDRG  NYRVVGV VNPVSI RS    C+  G  L L E   N ++FTYSV+F+ SE
Sbjct: 178 IEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSE 237

Query: 282 TSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDD 341
           T+W TRWDKYLHVYDP+IQW                      +ALKSDF+RY ELNLD+ 
Sbjct: 238 TAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGELNLDET 297

Query: 342 FQEDSGWKLSHGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLAT 401
            +ED+ WKL HGDVFRAP   + LSILVGSGVQLF M+ C+IF  A+G ++P SRG+L T
Sbjct: 298 IKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPT 357

Query: 402 VMFMLYALFGFVGSYTSMGIYKFFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFVHS 461
           VMF+LY  F F+ S+ SMG+YKFF+G  W  N                   N FL+FVHS
Sbjct: 358 VMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFLIFVHS 417

Query: 462 SGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKT 521
           SGVIP +T   ++ LWF   +PLS  GSL+ARK CHWD HPTKTN +++ IP Q WYL+T
Sbjct: 418 SGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQT 477

Query: 522 VPATLIAGVFPFGSIAVELYFIYTSLWFNKIFYMXXXXXXXXXXXXXXXXXXXXXXXYHS 581
           +PA+LI G+F FGS++VELYF+YTSLWFNKIFYM                       Y+S
Sbjct: 478 IPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVLFTYYS 537

Query: 582 LCLENWKWQWRGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVT 641
           L  ENW+WQWR F++ G GC+ YVF+HS+LFT+ KLGGFT  +LY+GYS VI+ L  +VT
Sbjct: 538 LSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVT 597

Query: 642 GSIGFISSMFFIRKIYSSIKVD 663
           G++GF+SSM F+R IYS++KVD
Sbjct: 598 GALGFLSSMLFVRTIYSAVKVD 619

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/652 (56%), Positives = 445/652 (68%), Gaps = 16/652 (2%)

Query: 16  AKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSR 75
           A+ FYLPG APTTY+  D IPLLVNH+TP+++    D  G +   DKE +LY+YDYY  R
Sbjct: 14  AQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYLYAYDYYYPR 71

Query: 76  FHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLI 135
            H C+P+K+EK  ESLGSIIFGDR++NSPF+LKMLEEK CV+LC+KT+P  DAKFIN+LI
Sbjct: 72  LHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLI 131

Query: 136 KNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGV 195
           ++GFF NWL+DGLPA R + D RT T FYG GFELG   V +GT         E     +
Sbjct: 132 RSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDRNQEEPGE-----I 184

Query: 196 ELDTRD----GHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPET 251
           EL TR     G ++V     PYF NH++I ++YH R E   RVVGV V P S++    + 
Sbjct: 185 ELQTRRVLQPGESVVAV---PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDK 241

Query: 252 CETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXX 311
           C   G+ L+L E  D +V FTYSV+F ES+ SWATRW KYLHVYDP +QW          
Sbjct: 242 CANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINFSLVV 301

Query: 312 XXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGS 371
                       RALK+D  RYN+ NLD++FQED GWKL H DVFR+PS++L LS+ VGS
Sbjct: 302 LLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGS 361

Query: 372 GVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWK 431
           G QLF M  C++F A LGFLSPSSRGSL T+MF+LYA+FG  GSY SM  YK F G  WK
Sbjct: 362 GGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWK 421

Query: 432 ANXXXXXXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLV 491
            N                   NFFL+ V SSG +P  T+  +V LWF+ SIP+S  GSL 
Sbjct: 422 VNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLF 481

Query: 492 ARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNK 551
           ARKK  WD+HPTKT+QIA+QIP QPWYL+T PA  IAG+FPFG+IAVELYFIYTS+WFN 
Sbjct: 482 ARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWFNT 541

Query: 552 IFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSIL 611
           +FYM                       Y+SLC+ENW WQWR FI+GG GC+ YVFI+SIL
Sbjct: 542 MFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFINSIL 601

Query: 612 FTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           FTKF+LGGF TIVLYVGYS +IS L CLVTG+IGF+SS++F+RKIYSSIKVD
Sbjct: 602 FTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/646 (45%), Positives = 386/646 (59%), Gaps = 56/646 (8%)

Query: 18  AFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFH 77
            FY PGV+P TY   DEIPLLVN+L+                    +FL++ DYY+    
Sbjct: 16  GFYFPGVSPVTYHIGDEIPLLVNYLS-------------------SDFLWNIDYYSDSIG 56

Query: 78  FCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKN 137
            CKP  +++Q ESLGS+IFGDR+YNSPF++ ML+  ECV LC  TI   D    N     
Sbjct: 57  LCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNTFFGY 113

Query: 138 GFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVEL 197
            +  NWL+DGLP                    LG      GT+     +       G + 
Sbjct: 114 RYSYNWLVDGLPV-------------------LG----IDGTSDANGYHNNSELFMGYQA 150

Query: 198 DTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGS 257
           D           E  Y  NH+DI I Y+DRG+G YRVV     P+S+ R+  E C  D  
Sbjct: 151 D-----------EQKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCSKDAK 199

Query: 258 PLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWXXXXXXXXXXXXXXXX 317
           P+ +   N   + FTYSV F +S+ SW+TRWD+YLHVYD  IQ                 
Sbjct: 200 PVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSSV 259

Query: 318 XXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGVQLFF 377
                 R LK D A Y+E NLDD+FQ+D  WK+ HG+VFR+PS++L LS+ VGSG QLFF
Sbjct: 260 LVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLFF 319

Query: 378 MVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKANXXXX 437
           M  C++   + GFLSPS+RGSL TVMF+LYALFG VGSYTSM IYKFF G  WK N    
Sbjct: 320 MALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILT 379

Query: 438 XXXXXXXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCH 497
                          NFFL++  SSG +P  T+  ++ LWF+ S+P+S  GSL++ K   
Sbjct: 380 PLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLNR 439

Query: 498 WDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIFYMXX 557
           WDEHP KTNQIARQ+P QPWY+KT  AT +AG+FPFG++AVELY+IY S+W   IF+M  
Sbjct: 440 WDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMYG 499

Query: 558 XXXXXXXXXXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFTKFKL 617
                                Y+SLC+ENWKWQWR FI+GG GC++YVF+HS+ F KFK 
Sbjct: 500 FLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFKF 559

Query: 618 GGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
            GF ++VLY+GYS+++S++CCLVTGSIGF+++++F+RKIYS+IKVD
Sbjct: 560 PGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  135 bits (341), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 165/682 (24%), Positives = 266/682 (39%), Gaps = 107/682 (15%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEK 83
           + P  Y + D + L+VN                 V  D     Y+Y  Y+    F  P  
Sbjct: 42  LRPNYYSKGDPVELIVN----------------KVESDLTQLPYAY--YD--LPFTCPPT 81

Query: 84  VEKQPE--SLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQ 141
           + K+P   SL  II GDR + S + L   E+ +C  LC +       K   +L+KNG+  
Sbjct: 82  MHKKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVV 141

Query: 142 NWLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAET-TNQGVELDT 199
            WLID  LPA            +Y +GF LGFV+          P T +T  N  V +  
Sbjct: 142 QWLIDDELPAVTTFISTTDHKKYYASGFPLGFVD----------PETGKTYLNTHVMIVI 191

Query: 200 RDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPL 259
           R  +N V T +H  F        E + +   ++   G           D E  E     L
Sbjct: 192 R--YNTVDTNKHTIFG------FELYPKSTVDFHCPGA--------SKDYEQYE-----L 230

Query: 260 MLDEENDNEVY--FTYSVKFVESE-TSWATRWDKYLHVYDPS------IQWXXXXXXXXX 310
           ++ E +D+  +  FTYSV + E     W  RWD YL+  + S        W         
Sbjct: 231 VVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFHWISLANSFGI 290

Query: 311 XXXXXXXXXXXXXRALKSDFARYNELNLDDD-----FQEDSGWKLSHGDVFRAPSRSLTL 365
                        R  K     +++++ ++D     +     W L+     + P  ++ L
Sbjct: 291 VFLISSITAVILYRTFKISRRSFSDISKEEDDKGSIYVVARKWLLNE----QTPLANV-L 345

Query: 366 SILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFF 425
            I V  GVQ  F V  S+  +       + R S+ T+  + +    F+ S+T   + K  
Sbjct: 346 IIFVSMGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAFMASFTGAHLLKSR 405

Query: 426 DGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMFV----------HSSGVIPASTLFFMVF 475
           +    ++                    +F ++             S+  +P  T+ F++ 
Sbjct: 406 EEMCSESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLIS 465

Query: 476 LWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIA---------RQIPFQPWYLKTVP--- 523
           ++F+  IPLS  G  +A K    +  P+ +  I          + I   P  L   P   
Sbjct: 466 VYFVVCIPLSLLGGYIAVKST--NSKPSFSFSIGNYSDRIFVYKTITMSPSVLINRPLSS 523

Query: 524 -ATLIAGVFPFGSIAVELYFIYTSLWFNK-IFY----MXXXXXXXXXXXXXXXXXXXXXX 577
            A L  G+FPF  I VEL ++Y SLW  K  FY                           
Sbjct: 524 LAILAGGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTFI 583

Query: 578 XYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILFTKFKLG--GFTTIVLYVGYSSVISL 635
             +S    +  W+W  F + GA CA Y+ ++S+ +  F L   GF++I + V Y ++ ++
Sbjct: 584 LLNSADKNSNNWRWTSFQI-GASCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFNI 642

Query: 636 LCCLVTGSIGFISSMFFIRKIY 657
           +C   TGSI  ++S +F++KIY
Sbjct: 643 MCGCATGSIACLTSHWFVQKIY 664

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  135 bits (340), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 164/715 (22%), Positives = 271/715 (37%), Gaps = 127/715 (17%)

Query: 14  STAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYN 73
           S+ K  Y   + P  Y++ D + L+VN                 V  D     Y+Y    
Sbjct: 42  SSQKNLYDGWITPNFYRKGDPLELIVN----------------KVESDLTQLPYAY---- 81

Query: 74  SRFHFCKPEKVEKQPE--SLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFI 131
               F  P  + K+P   SL  II GDR + S ++LK  E+  C +LC +       + +
Sbjct: 82  YDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTL 141

Query: 132 NKLIKNGFFQNWLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAET 190
           +KL++ G+   WLID  LPAA           +Y +GF LGF++          P+T +T
Sbjct: 142 DKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFID----------PDTDKT 191

Query: 191 TNQGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSD-P 249
                                 Y  NH  + I +H        +VG  V P S+     P
Sbjct: 192 ----------------------YLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCP 229

Query: 250 ETCETDGSPLMLDEENDNEVY---FTYSVKFVES-ETSWATRWDKYLHV----YDPSIQ- 300
              +      ++  E++NE+    FTYSV + E  E  W  RWD +L+      + SIQ 
Sbjct: 230 GASKNYEQYEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQF 289

Query: 301 -WXXXXXXXXXXXXXXXXXXXXXXRALKSD---------FARYNELNLDDDFQEDSGWKL 350
            W                      R + +D               +  +DD  +D   K 
Sbjct: 290 HWMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKY 349

Query: 351 S----HGDVFRAPSRSL----TLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATV 402
           S      D  +    +L     L +LV  GVQ  F +  S+  +       + R S+ T+
Sbjct: 350 SVYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTM 409

Query: 403 MFMLYALFGFVGSYTSMGIYKFFDGPYWKANXX--------------XXXXXXXXXXXXX 448
             + + L  F+ S+    +         KAN                             
Sbjct: 410 AILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGI 469

Query: 449 XXXXNFFL---MFVH-SSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARK---KCHW--- 498
                F L   ++ H S+  +P  T+ F + ++F+  IPLS  G +VA       +W   
Sbjct: 470 VMVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSG 529

Query: 499 ---DEHPTKTNQI---ARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI 552
              DE  +  N +     +  F P          + G+FP   I VE+ ++Y SLW  K 
Sbjct: 530 ITKDESNSDGNGLFVPKSRAKFNPL---VYCGIYLCGIFPLLVIYVEMQYVYKSLWLEKT 586

Query: 553 ----FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENW----KWQWRGFIVGGAGCALY 604
               FY                            C E+      W+W+ F +G +G  +Y
Sbjct: 587 TFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVY 645

Query: 605 VFIHSI--LFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIY 657
           + ++S+  +F    + GF++I++ + YS + +++C L  G++ ++++ +FI KIY
Sbjct: 646 MELYSLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  131 bits (330), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 166/721 (23%), Positives = 278/721 (38%), Gaps = 128/721 (17%)

Query: 14  STAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYN 73
           S+    Y   + P  YK  D + L+VN                 V  D     Y+Y    
Sbjct: 42  SSQSNLYDGWITPNFYKNGDPLELIVN----------------KVESDLTQLPYAY---- 81

Query: 74  SRFHFCKPEKVEKQPE--SLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFI 131
               F  P  + K P   SL  II GDR + S ++L   E+  C  LC +       + +
Sbjct: 82  YDLPFTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTL 141

Query: 132 NKLIKNGFFQNWLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAET 190
           +KLI+ G+   WLID  LPAA           +Y +GF LGF++          P+T +T
Sbjct: 142 DKLIREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFMD----------PDTGKT 191

Query: 191 TNQGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSD-P 249
                                 Y  NH  + I +H    G   +VG  V P S+     P
Sbjct: 192 ----------------------YLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCP 229

Query: 250 ETCETDGSPLMLDEENDNEVY---FTYSVKFVES-ETSWATRWDKYLHVYDPS------I 299
              +T     +   E++NE+    FTYSV + E  E  W  RWD +L+  + S       
Sbjct: 230 GASKTYEQYEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQF 289

Query: 300 QWXXXXXXXXXXXXXXXXXXXXXXRALKSD---------------FARYNELNLDDDFQE 344
            W                        + +D                   + LN +D + +
Sbjct: 290 HWMSFANSVIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLN-NDKYSK 348

Query: 345 DSGWKLSHGDVFRAPSRSLTLS---ILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLAT 401
           +S + ++   +        +L    +LV  GVQ  F V  S+  +       + R S+ T
Sbjct: 349 NSVYMVAKDWIQNGKPDLFSLKGLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLT 408

Query: 402 VMFMLYALFGFVGSY--TSMGIY---KFFDGPYWKANXX---------XXXXXXXXXXXX 447
           +  + + +  F+ S+  T + I    + F+  Y+  N                       
Sbjct: 409 MAILCFVIGAFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPG 468

Query: 448 XXXXXNFFL---MFVH-SSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARK---KCHW-- 498
                 F L   ++ H S+  +P  T+ F + ++F+  IPLS  G +VA       +W  
Sbjct: 469 MIMISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLS 528

Query: 499 ----DEHPTKTNQIARQIPFQPWYLKTVP--ATLIAGVFPFGSIAVELYFIYTSLWFNKI 552
               DE  +K N++   +P  P     +      + GVFP   I VE+ ++Y SLW  K 
Sbjct: 529 GITIDESDSKNNKLF--LPKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKT 586

Query: 553 ----FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENW----KWQWRGFIVGGAGCALY 604
               FY                            C E+      W+W+ F +G +G  +Y
Sbjct: 587 TFYYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVY 645

Query: 605 VFIHSI--LFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKV 662
           + ++S+  +F    + GF++I++ + YS + +++C L  G++ ++++ +FI KIY  +KV
Sbjct: 646 MELYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIY-HVKV 704

Query: 663 D 663
           +
Sbjct: 705 N 705

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  131 bits (329), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 164/716 (22%), Positives = 273/716 (38%), Gaps = 128/716 (17%)

Query: 14  STAKAFYLPG-VAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72
           S+    Y  G + P  YK+ND + L+VN                 V  D     Y+Y   
Sbjct: 42  SSQNNLYYDGWITPNFYKKNDFLELIVN----------------KVESDLTQLPYAY--- 82

Query: 73  NSRFHFCKPEKVEKQPE--SLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKF 130
                F  P  + K+P   SL  II GDR + S ++L+  E+  C +LC +       + 
Sbjct: 83  -YDLPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQT 141

Query: 131 INKLIKNGFFQNWLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAE 189
           ++KL++ G+   WLID  LPAA           +Y +GF LGFV+          P+T +
Sbjct: 142 LDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFVD----------PDTDK 191

Query: 190 TTNQGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIK--RS 247
           T                      Y  NH  + I +H  G+    VVG  V P S+     
Sbjct: 192 T----------------------YLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHC 229

Query: 248 DPETCETDGSPLMLDEENDNEVY--FTYSVKFVES-ETSWATRWDKYLHVYDPS------ 298
              +   +   +++ E+  +  Y  FTYSV + E  E  W  RW+ +L+  + S      
Sbjct: 230 PGASKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQ 289

Query: 299 IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYN-------------ELNLDDDFQED 345
             W                      R +++D    +             E +LDDD    
Sbjct: 290 FHWMSLANSLGIVLSISFITFVIYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDDKYGK 349

Query: 346 SGWKLSHGDVFRAPSRSL----TLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLAT 401
           +   +   D  +     L     L +LV  GVQ  F +  S+  +       + R S+ T
Sbjct: 350 NSVYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLT 409

Query: 402 VMFMLYALFGFVGSY--TSMGIY---KFFDGPYWKANXXXX---------XXXXXXXXXX 447
           +  + + L  F+ S+  T +GI    +  +  Y   N                       
Sbjct: 410 MAILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPG 469

Query: 448 XXXXXNFFLMFV----HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARK--------- 494
                 F L  V     S+  +P  T+ F + ++F+  IPLS  G +VA           
Sbjct: 470 MVMIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLS 529

Query: 495 ---KCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNK 551
              K   D + +K  +   +  F P          + G+FP   I VE+ ++Y SLW  K
Sbjct: 530 GITKDETDGNGSKLFKPKSRTRFNPL---VHCGVYLCGIFPLLVIYVEMQYVYKSLWLEK 586

Query: 552 I----FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENWK----WQWRGFIVGGAGCAL 603
                FY                            C ++ +    W+WR F +G +G  +
Sbjct: 587 TTFYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GV 645

Query: 604 YVFIHSI--LFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIY 657
           Y+ ++S+  +F    + GF++I++ + YS + ++LC L  G++  +++ +FI +IY
Sbjct: 646 YMELYSLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINRIY 701

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  130 bits (328), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 159/688 (23%), Positives = 266/688 (38%), Gaps = 107/688 (15%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEK 83
           + P  Y+  D + LLVN                 V  D   F   Y YY+  F  C P +
Sbjct: 41  LQPNVYRWGDHVELLVN----------------KVESDLTQF--PYGYYDLPFT-CPPTE 81

Query: 84  VEKQPE--SLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQ 141
            +K+P   SL  II GDR + S ++LK  ++  C +LC +       +   +L++ G+  
Sbjct: 82  -DKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVV 140

Query: 142 NWLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTR 200
            WLID  LPAA           +Y +GF LGFV+          P+T +T          
Sbjct: 141 QWLIDQELPAATTFISTIDHKKYYVSGFPLGFVD----------PDTEKT---------- 180

Query: 201 DGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSD-PETCETDGSPL 259
                       Y   H  + I Y+      + +VG  V P S+     P   +      
Sbjct: 181 ------------YLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPGASKGYEQYE 228

Query: 260 MLDEENDNE---VYFTYSVKFVES-ETSWATRWDKYLHVYDPS------IQWXXXXXXXX 309
           ++  EN++E   + FTYSV + E  +  W+ RW+ +L+  + S        W        
Sbjct: 229 LIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMTLGNSVG 288

Query: 310 XXXXXXXXXXXXXXRALKSDFARYNE---LNLDDDFQEDSGWKLSHGDVFRAPSRSLT-- 364
                         R ++      +E      D++ + DS + ++   + +  S S++  
Sbjct: 289 ISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQTDSSSISFK 348

Query: 365 -LSILVGSGVQLFFMVTCSIFFA-ALGFLSPSSRGSLATVMFML----YALFGFVGSYTS 418
            L+I V  GVQ  F +  S+ F+ +L  L       L+   F L    Y    FVG++  
Sbjct: 349 ILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLFVGTWLH 408

Query: 419 MGIYKFFDGPYWKANXXXXXXXXXX--XXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFL 476
           +      DG   +                       N+ +    SS  +P  T+   V +
Sbjct: 409 IDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVLFVSI 468

Query: 477 WFLFSIPLSFAGSLVARK--KCHWDEHPTKTNQIARQIPFQPWYLKTVPAT--------- 525
           +F+  IPLS  G  V+ +  +      P  ++  AR I  +P    T  A          
Sbjct: 469 YFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSI--KPCRAPTTLAPRKISERLTF 526

Query: 526 -----LIAGVFPFGSIAVELYFIYTSLWFNKI-------FYMXXXXXXXXXXXXXXXXXX 573
                 I G  PF  I VEL +IY S+W  K        F +                  
Sbjct: 527 DFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSFLGC 586

Query: 574 XXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSI--LFTKFKLGGFTTIVLYVGYSS 631
                 H        W+W+ F++G   CA Y+ ++S+  +F   K+ GF +I + V YS 
Sbjct: 587 YVMMRKHKRVATFDSWRWKCFMMG-TSCAWYMELYSLYYIFHTLKMTGFPSIFISVSYSL 645

Query: 632 VISLLCCLVTGSIGFISSMFFIRKIYSS 659
           + +++C    GS+G+++S + + +++ +
Sbjct: 646 IFNIMCGCGMGSLGYLTSCWLVNRVFCT 673

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  130 bits (326), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 158/724 (21%), Positives = 264/724 (36%), Gaps = 160/724 (22%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEK 83
           + P  Y+END + ++VN                 +  D   F   Y YY   F  C P  
Sbjct: 56  IRPNVYEENDPVEIIVN----------------KIESDLTQF--PYAYYELPFT-CPPTN 96

Query: 84  VEKQPE-SLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQN 142
           V+K    SL  II GDR + S + L   +++ C+ LC +    +  +  ++LIK G+   
Sbjct: 97  VKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQ 156

Query: 143 WLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTRD 201
           WLID  LPAA      +    +Y +GF LGF++   G                       
Sbjct: 157 WLIDDELPAATTFISTKDHKKYYASGFPLGFMDKDTGKT--------------------- 195

Query: 202 GHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPLML 261
                      Y  NH  + I YH      + +VG+ V P S+          +     +
Sbjct: 196 -----------YLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCPGASKNFDHYEV 244

Query: 262 DEENDNEVY--FTYSVKFVES-ETSWATRWDKYLHVYDPS------IQWXXXXXXXXXXX 312
           + E     Y  FTYS+ + E     W  RW+ +++  + S        W           
Sbjct: 245 NTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWISLANSVVIVT 304

Query: 313 XXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSG 372
                      +++ +D     E       Q  S W + H  +         L++    G
Sbjct: 305 LMTLVVALILAKSVSTD-----ETVSTSTSQVASQWVVQHSYLLNH------LNVFTAMG 353

Query: 373 VQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKA 432
           VQ  F +  S+  +       + R S+ T+  M +      G+YTS      F G    A
Sbjct: 354 VQFLFTILGSLIISCSMNKLHNIRNSVLTMALMCF----ISGAYTSS-----FVGALLSA 404

Query: 433 NXXXXXXXXXXX-------XXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLS 485
           N                          N  +    S+  +P  T+  ++ ++F+  IPLS
Sbjct: 405 NHNTTIKISIACGSALPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVYFIVCIPLS 464

Query: 486 FAGSLVA---RKKC-----------------HWDEHPTKTNQIA-------RQIPFQPWY 518
             G + A   R+KC                 H+D+ P   N++         ++P     
Sbjct: 465 ILGGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISGNSKLPLM--L 522

Query: 519 LKTVPATLIAGVFPFGSIAVELYFIYTSLWFNK--IFYMXXXXXXXXXXXXXXXXXXXXX 576
            + V  T+I+G+ PF  I VEL F+Y SLW  K   +Y+                     
Sbjct: 523 RQPVLLTVISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIVLLCVVVCEISII 582

Query: 577 XXY---------------------HSLCLENWKWQ----------------WRGFIVGGA 599
             Y                     HS  L+  + Q                W+ F +GG+
Sbjct: 583 GCYLTLIHVSPDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAMTQWRWKSFQIGGS 642

Query: 600 GCALYVFIHSILF--TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIY 657
             A Y+  +S+ +  T  K+  F++I+L+  YS++ + LC    G++G++S  +F+ +I+
Sbjct: 643 -VAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGYLSCCWFVNRIH 701

Query: 658 SSIK 661
           ++ K
Sbjct: 702 TNSK 705

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  127 bits (320), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 154/668 (23%), Positives = 256/668 (38%), Gaps = 90/668 (13%)

Query: 42  LTPSMYYQHKDEE--GNNVSGDKENFLYSYDYYNSRFHFCKPEKVEKQPE--SLGSIIFG 97
           L P+ Y+Q  + E   N V  D     Y+Y        F  P  + K+P   SL  II G
Sbjct: 41  LQPNFYFQGDEVELIVNKVESDLTQLPYAY----YDLPFTCPPTMHKKPLHLSLNEIIRG 96

Query: 98  DRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQNWLID-GLPAARNVSD 156
           DR + S + LK  ++  C  LC +       K   KL+++G+   WLID  LPAA     
Sbjct: 97  DRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQWLIDEELPAATTFIS 156

Query: 157 KRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTRDGHNMVQTYEHPYFTN 216
              +  +Y +GF LGFV+          P+T +                       Y   
Sbjct: 157 TIDQKKYYASGFPLGFVD----------PDTGKV----------------------YLNT 184

Query: 217 HYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPL-MLDEENDNE---VYFT 272
           H  + I Y+      + +VG  V P S+          +  P  ++  END++   + FT
Sbjct: 185 HVMLVIRYNTVDVNKHTIVGFEVYPKSVSDFHCPGASKNYEPYEIVIPENDDDLTFIPFT 244

Query: 273 YSVKFVESE-TSWATRWDKYLHVYDPS------IQWXXXXXXXXXXXXXXXXXXXXXXRA 325
           YSV + E     W  RWD YL+  + S        W                      R+
Sbjct: 245 YSVYWREEYLVDWDHRWDLYLNSGELSENKTTQFHWISLANSAGIVFLMSFVVSVILLRS 304

Query: 326 LKSDFARYNELNLDDDFQEDSGWKLSHGDVF--RAPSRSLTLSILVGSGVQLFFMVTCSI 383
            KS      ++N  ++ +    ++++   +   R P  +L L + V  GVQ  F V  S+
Sbjct: 305 FKSSRDISTDINKSEEHRNGLVYEVARNWIINERTPLANL-LILFVSMGVQFLFTVLGSL 363

Query: 384 FFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKANXXXXXXXXXX 443
             +           S+ T+  + + L  F+ SY    + +  +    K            
Sbjct: 364 TISCSLNKLHDIGDSVLTMAVLCFVLGAFMSSYIGSVLLRLKNKATMKKQPIKKGFHLFF 423

Query: 444 XXXXXXXXXNFFLMFV----------HSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA- 492
                       ++             S+  +P  T+   + ++F+  IPLS  G  +A 
Sbjct: 424 AILCGSFLPGIVMIVTLLLNSIVWAHDSTHALPFKTVVMFITVYFIVCIPLSILGGYMAN 483

Query: 493 --RKKCHWDEHPTKTNQIARQI------PFQPWYL--------KTVPATLIAGVFPFGSI 536
             + K    +    T++   ++      P +  +L        K     L++G+FPF  I
Sbjct: 484 SSKTKGSLTDPKFHTSRPELELFANKLKPKKHIFLFGARLKSIKIALPILLSGIFPFVII 543

Query: 537 AVELYFIYTSLWFNK--IFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCL---ENWKWQW 591
            VEL ++Y S+W  K   +Y                        Y  L +    N  W+W
Sbjct: 544 YVELQYVYKSVWLEKTAFYYFYGFLFANILLLCIVVGEIAIIGTYTMLHMADRNNTDWRW 603

Query: 592 RGFIVGGAGCALYVFIHSILFTKFKLG--GFTTIVLYVGYSSVISLLCCLVTGSIGFISS 649
             F + G+ CA Y+ ++S+ +  F L   GF++I + V Y ++ + LC    GSI  ++S
Sbjct: 604 ISFFM-GSSCAWYMELYSLYYVFFILNIRGFSSIFISVCYGALFNTLCGCAMGSIASLTS 662

Query: 650 MFFIRKIY 657
            FF+ K+Y
Sbjct: 663 HFFVEKLY 670

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  126 bits (317), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 151/668 (22%), Positives = 251/668 (37%), Gaps = 108/668 (16%)

Query: 42  LTPSMY-YQHK-DEEGNNVSGDKENFLYSYDYYNSRFHFCKPEKVEKQPESLGSIIFGDR 99
           L+P+ Y Y  K D   N V  D  +F  SY YY+  F     + ++  P +   I++G++
Sbjct: 57  LSPNFYEYGDKVDITVNKVESDLTHF--SYGYYDLHFTCPPSQDMKPLPLTFSDILYGNK 114

Query: 100 IYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQNWLI-DGLPAARNVSDKR 158
            + S +QL   ++++CV LC +   G   K   +LIK  +   WL  D LP A    + +
Sbjct: 115 KWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQWLADDDLPGATTYLNTK 174

Query: 159 TKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTRDGHNMVQTYEHPYFTNHY 218
            K  +Y +GF LG          +  P T E                       Y  NH 
Sbjct: 175 DKKKYYSSGFPLG----------QYDPETDEA----------------------YINNHV 202

Query: 219 DIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPLMLDEENDNE--VYFTYSVK 276
            I I YH   +G   +VG  V P S+          D +P  +D  N++   + FTY+V 
Sbjct: 203 MIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCPGASKDYTPYKIDPTNEDIEFISFTYAVY 262

Query: 277 FVES-ETSWATRWDKYLH------VYDPSIQWXXXXXXXXXXXXXXXXXXXXXXRALKSD 329
           + E  +  W  RW+ +++             W                      R     
Sbjct: 263 WREDFKVDWKNRWNFFINGGELKESTSNQFHWITFANGIIVTSCLLLIVIAILKR----- 317

Query: 330 FARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFA-AL 388
                E +     Q  + W  +   +F        L++LV  G+   F    ++  + +L
Sbjct: 318 ----QETDGSITTQLAAEWSKARVPLF------FQLNLLVSMGIHFLFTTLGTLIISCSL 367

Query: 389 GFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWK---ANXXXXXXXXXXXX 445
                     L   +F+  +     GS+TS  I    +G   +    N            
Sbjct: 368 NHTHRIGSSVLTCAVFLFIS-----GSFTSSFIGALLEGQMSQHKLVNSIIFGSTLPGIT 422

Query: 446 XXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKT 505
                  N+ L   +++  +P  T+  +   +F+  +P+S  G   A +    +   T  
Sbjct: 423 LVIVLLLNYILKANNAANTLPHGTVALLFGAYFIVCVPISIIGGKCADRFLKVNSTNTLL 482

Query: 506 NQIA----RQIPFQPWYLKT-----------VPATLIAGVFPFGSIAVELYFIYTSLWFN 550
           N  A     +   +P Y+++           +  TL  G+ PF  I VEL F Y SLW  
Sbjct: 483 NSFALAEVNKHDTRPLYVESKNSIPFVLKNPIAITLTFGLIPFALIYVELLFAYKSLWLQ 542

Query: 551 K--IFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLEN------W------------KWQ 590
           K  ++Y+                       Y  L   N      W             W+
Sbjct: 543 KTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHLNYGNDSLNFKWDNVIGRVLEACHSWR 602

Query: 591 WRGFIVGGAGCALYVFIHSILFTKF--KLGGFTTIVLYVGYSSVISLLCCLVTGSIGFIS 648
           W+ F +GGA  A Y+  +SIL+  F  +   F +  L+V YS++ ++LC    GS+ ++S
Sbjct: 603 WKAFHMGGA-VAWYMEAYSILYLIFVARYRDFISSFLFVCYSTLFNILCWTAFGSLSYLS 661

Query: 649 SMFFIRKI 656
           S++FI K+
Sbjct: 662 SLWFIGKL 669

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  122 bits (305), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 163/714 (22%), Positives = 263/714 (36%), Gaps = 127/714 (17%)

Query: 17  KAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRF 76
             +Y   + P  YK+ D + L+VN                 V  D     Y+Y       
Sbjct: 45  NTYYDGWITPNFYKKGDPLELIVN----------------KVESDLTQLPYAY----YDL 84

Query: 77  HFCKPEKVEKQPE--SLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKL 134
            F  P  + K+P   SL  II GDR + S + L   E+  C +LC +       + ++KL
Sbjct: 85  PFTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKL 144

Query: 135 IKNGFFQNWLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQ 193
           ++ G+   WLID  LPAA           +Y +GF LGFV+          P+T +T   
Sbjct: 145 VREGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD----------PDTGKT--- 191

Query: 194 GVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSD-PETC 252
                              Y  NH  + I +H        +VG  V P S+     P   
Sbjct: 192 -------------------YLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPGAS 232

Query: 253 ETDGSPLMLDEENDNEVY---FTYSVKFVES-ETSWATRWDKYLHVYDPS------IQWX 302
           +      ++  E++NE+    FTYSV + E  E  W  RWD +L+  + S        W 
Sbjct: 233 KNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFHWM 292

Query: 303 XXXXXXXXXXXXXXXXXXXXXRALKSDFARYN-------------ELNLDDDFQEDSGWK 349
                                + +  D    +             E NLDDD    +   
Sbjct: 293 SFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDDKYGKNSVY 352

Query: 350 LSHGDVFRAPSRSL----TLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFM 405
           +   D  +    ++     L +LV  GVQ  F V  S+  +       + R S+ T+  +
Sbjct: 353 MVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVITMAIL 412

Query: 406 LYALFGFVGSY--TSMGIY--------KFFDGPYWKANXXXXXXXXXXXXXXX----XXX 451
            + L  F+ S+  T + I          + D      N                      
Sbjct: 413 CFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGSSLPGLVMV 472

Query: 452 XNFFL---MFVH-SSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARK---KCHWDEHPTK 504
             F L   ++ H S+  +P  T+ F + ++F+  IPLS  G  VA       HW    TK
Sbjct: 473 STFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWLSGITK 532

Query: 505 TNQIAR---------QIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI--- 552
                          +  F P          + G+FPF  I VEL ++Y S+W  K    
Sbjct: 533 DETCGNSSRLFVPRSRTKFNPL---VYCGIYLCGLFPFLVIYVELQYVYKSVWLEKTTFY 589

Query: 553 -FYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENW----KWQWRGFIVGGAGCALYVFI 607
            FY                            C E+      W+W+ F +G +G  +Y+ +
Sbjct: 590 YFYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG-GVYMEL 648

Query: 608 HSI--LFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSS 659
           +S+  +F    + GF++ ++ + YS + +++C L  G + ++++ +FI KIY S
Sbjct: 649 YSLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIYHS 702

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 143/636 (22%), Positives = 238/636 (37%), Gaps = 95/636 (14%)

Query: 69  YDYYNSRFHFCKPEKVEKQPE--SLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGN 126
           + YY+    F  P   EK+P   SL  II GDR + S ++L + ++  C  LC +     
Sbjct: 68  FGYYD--LPFTCPPTPEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTRE 125

Query: 127 DAKFINKLIKNGFFQNWLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATP 185
             +    LIK+G+   W+ID  LPAA           +Y  GF LG V+          P
Sbjct: 126 GLQTAKDLIKSGYMVQWMIDDDLPAATTYISTTDNLKYYAPGFPLGSVD----------P 175

Query: 186 NTAETTNQGVELDTRDGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIK 245
            ++                        +F NH  + I Y+        +VG    P S+ 
Sbjct: 176 RSSRV----------------------FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVS 213

Query: 246 RSDPETCETDGSPLMLDEENDNEVYF---TYSVKFVE-SETSWATRWDKYL---HVYDPS 298
                    D  P  + +    E+ +   TYSV + E +E  W+ RW  Y+    + D S
Sbjct: 214 DYHCPGASKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSS 273

Query: 299 ---IQWXXXXXXXXXXXXXXXXXXXXXXRALKSDFARYNELNLDDDFQEDSGWKLSHGDV 355
                W                        L   F   NE  L+    EDS       D+
Sbjct: 274 SSTFHWMALANSVGIVLFVTFIVIVN----LIMIFRNPNE-QLESKENEDSS------DI 322

Query: 356 FRAPSRSLT---------LSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFML 406
           F   +  L          L + V  G+Q+ FM+   +  +       + + S+ T+  + 
Sbjct: 323 FNVANNWLRARQGFQLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNSVLTIAALC 382

Query: 407 YA----LFGFVGSYTSM----GIYKFFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFLMF 458
           +     +  FVG++  M      Y F++  +                       N  +  
Sbjct: 383 FVAGAFMASFVGTWLKMDQNISAYTFYNPVF----AVLCGSALPGSIMVLTLSLNCIIWI 438

Query: 459 VHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA---RKKCHWDEHPTKT---NQIARQI 512
             S+  +P  T+   V  +F+  I +S  G  VA    +    D  P  T    ++ R+ 
Sbjct: 439 WDSTKALPFGTMVVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRS 498

Query: 513 PFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI-------FYMXXXXXXXXXX 565
                 L    A LI+G  PF  I VEL ++Y S+W  K        F            
Sbjct: 499 RAISGKLVVFLAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVV 558

Query: 566 XXXXXXXXXXXXXYHSLCLENWKWQWRGFIVGGAGCALYVFIHSI--LFTKFKLGGFTTI 623
                         +   + +  W+WR F++   GC+ Y+ I+S+  +F    + G + +
Sbjct: 559 CEISLLGCLVLMKLNHKFINDQNWRWRCFVIS-TGCSWYMEIYSLYYIFFIIHMTGDSAV 617

Query: 624 VLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSS 659
            + V YS + ++LC L TGS+G+++S +F++KI+ +
Sbjct: 618 FISVCYSFIFNVLCGLATGSLGYLTSSWFVKKIHRT 653

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  111 bits (277), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 166/709 (23%), Positives = 263/709 (37%), Gaps = 127/709 (17%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEK 83
           V P  YK  D + L+VN                 V  D     Y+Y  Y+  F  C P K
Sbjct: 51  VNPNLYKIGDHVELIVN----------------KVESDLTQLPYAY--YDLPF-ICPPTK 91

Query: 84  VEKQPE--SLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQ 141
            EK+P   SL  I  GDR + S ++L    +  C  LC +           +L++ G+  
Sbjct: 92  -EKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVT 150

Query: 142 NWLID-GLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTR 200
            WLID  LPAA           +Y AGF +G+V                        D R
Sbjct: 151 QWLIDESLPAATTFISSTNHNKYYAAGFPVGYV------------------------DDR 186

Query: 201 DGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIK--RSDPETCETDGSP 258
            G          +  NH  + I YH   E  + +VG  V P S+            D   
Sbjct: 187 TGKT--------FLNNHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPGANKNHDKYE 238

Query: 259 LMLDEENDNEVY--FTYSVKFVES-ETSWATRWDKYLHVYDPS------IQWXXXXXXXX 309
           +++ E++D   +  FTYSV + E  E  W  RW+ +L+  + S        W        
Sbjct: 239 IIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFHWMSFLNSVG 298

Query: 310 XXXXXXXXXXXXXXRALKSDFARYNEL----NLDDDFQEDSGWKLSHGDVFRAPSRSLT- 364
                         +           +    NL  D ++D+  K+S G VF      +T 
Sbjct: 299 IASMTTTIVSIILLKIFSKKERESRNINTSTNLGQDNEDDNDDKIS-GSVFVNAKTWITV 357

Query: 365 --------LSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLY----ALFGF 412
                   L  L   G+Q  F +  S+  +       + R ++ T+  + +    A+ G+
Sbjct: 358 GKIPYWKALICLTSMGIQFSFTILGSLIISCSLSKLHNIRFTVLTMSLICFICGAAISGY 417

Query: 413 VGS--YTSMGIYK-FFDGPYWKANXXXXXXXXXXXXXXXXXXXNFFL---MFVH-SSGVI 465
           +GS  Y    I K +      +                     +F L   +  H S+  +
Sbjct: 418 IGSRLYIEYQILKGYLRNEVNRTKVYKFSVVCGSSLPGLLMVISFSLNCIILAHDSTNAL 477

Query: 466 PASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPT-------KTNQIARQIP----- 513
           P  T  F+V ++F+  IPLS  G ++A   C  D + T       + N I+R+       
Sbjct: 478 PFKTEVFLVSIYFVTCIPLSLLGGVLAL-NCKVDSYNTLKRITSLRRNTISRKSRSDFTK 536

Query: 514 ----FQPWYLK------TVPATLIAGVFPFGSIAVELYFIYTSLWFNK--IFYMXXXXXX 561
               +Q           T    L  G F F  I VEL ++Y S+W  K   +Y       
Sbjct: 537 KVSLYQRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFYYYYGFLLA 596

Query: 562 XXXXXXXXXXXXXXXXXYHSLCLENWK-----WQWRGFIVGGAGCALYVFIHSILFTKFK 616
                            Y  L  +N +     W W+ F++ G+ CA Y+ ++S+ +  F 
Sbjct: 597 NILILSIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLM-GSSCAWYMELYSLYYIFFV 655

Query: 617 LG--GFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663
           L   GF++I + V YS + + +C    GS+ +++S   + +IY   KVD
Sbjct: 656 LNMQGFSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY---KVD 701

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 112/276 (40%), Gaps = 58/276 (21%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEK 83
           + P  YK+ D++ +++N +                    E   + Y YY+ +F  C P  
Sbjct: 40  IKPNVYKKGDKVDVIINKVV------------------SETARFPYGYYDLQF-VCPPSD 80

Query: 84  VEKQPE--SLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQ 141
            +K+P   SL  II GDR + S + L   E  +C+ LC +       K  + LI+ G+  
Sbjct: 81  -KKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVA 139

Query: 142 NWLI-DGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTR 200
           +WLI D LPAA   +  ++   FY AGF LG V+   G                    TR
Sbjct: 140 HWLIDDDLPAATTFAKTKSGKKFYTAGFPLGEVDAVTG-------------------KTR 180

Query: 201 DGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPLM 260
                          NH  + + Y       + ++G  V P S+  +       D  P  
Sbjct: 181 -------------LYNHLMLVVRYQTVDVNKHTIIGFEVYPKSVSDAHCPGANKDYQPYE 227

Query: 261 LDEENDNEVY--FTYSVKFV-ESETSWATRWDKYLH 293
           ++ E     Y  FTYS+ +  ES   W+ RW+ ++H
Sbjct: 228 INTEESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 45/111 (40%), Gaps = 22/111 (19%)

Query: 461 SSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQ--------- 511
           SS  IP  T+   V  +F+ S PLS  G   ARK  +        N I++          
Sbjct: 420 SSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKN-AAKLAPANAISKSPFSFLLTLS 478

Query: 512 ------------IPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFN 550
                        PF       +  T++AG+ PF  I VEL+++Y S+W  
Sbjct: 479 YDTRSWPATALGKPFPIALSNPILLTILAGIAPFVVICVELFYVYKSMWLQ 529

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 44/75 (58%), Gaps = 3/75 (4%)

Query: 589 WQWRGFIVGG--AGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGF 646
           W+W+ F+ GG  A       ++ ++F    L   ++I+L+V Y+++ + +C    G++G+
Sbjct: 615 WRWKSFVAGGSVAWYLELYSLYYLIFV-LHLRDLSSILLFVCYTALFNFMCWCAFGALGY 673

Query: 647 ISSMFFIRKIYSSIK 661
           +S ++F+  I SS K
Sbjct: 674 LSCLWFLSHISSSSK 688

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 89.7 bits (221), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 77/274 (28%), Positives = 116/274 (42%), Gaps = 58/274 (21%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEK 83
           + P  YK  D++ L VN +         + E  N+          Y YY+ RF  C P +
Sbjct: 44  IKPNVYKRGDKVDLTVNKV---------ESEITNLP---------YGYYDLRF-VCPPSE 84

Query: 84  VEKQPE-SLGSIIFGDRIYNSPFQLKMLEEKECVSLC-KKTIPGNDAKFINKLIKNGFFQ 141
            +K    SL  +I GDR + S + L+    ++C  LC +KT+P +  +  ++LI+  +  
Sbjct: 85  TKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMP-DGLRQADRLIRENYMV 143

Query: 142 NWLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTR 200
           +WLIDG LPAA   +  R+   FY AGF LG V+                          
Sbjct: 144 HWLIDGDLPAATTFASTRSGKKFYTAGFPLGRVD-------------------------- 177

Query: 201 DGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPLM 260
             H   +T+ H    NH  + I Y       Y +VG  V P S+             P +
Sbjct: 178 --HETDKTHLH----NHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASKSFEPYV 231

Query: 261 LDEENDNEVY--FTYSVKFV-ESETSWATRWDKY 291
           ++ E     Y  FTYSV +  ES   W+ RW+ +
Sbjct: 232 INTEETEVTYIPFTYSVYWREESNIDWSHRWNLF 265

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 589 WQWRGFIVGGAGCALYVFIHSILFTKF--KLGGFTTIVLYVGYSSVISLLCCLVTGSIGF 646
           W+W+ F+  GA  A Y  ++S+ +  F   L  F++I+L+V Y+S+ +L+C    G++G+
Sbjct: 619 WRWKAFM-AGASVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALGY 677

Query: 647 ISSMFFI 653
           ++ ++F+
Sbjct: 678 LTCLWFL 684

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 47/115 (40%), Gaps = 28/115 (24%)

Query: 461 SSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYL- 519
           SS  +P  TL  ++  +F+  +PLSF G   ARK      +     Q   ++PF   +L 
Sbjct: 424 SSAALPFGTLLALLTSYFVICLPLSFLGGFSARKLRSAPANGLNYEQ--SKVPFS--FLL 479

Query: 520 ---------------KTVPA--------TLIAGVFPFGSIAVELYFIYTSLWFNK 551
                          K +PA        T++ G  PF     EL F+Y SLW  K
Sbjct: 480 SIEYHEYNLLPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTELLFVYRSLWLQK 534

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 111/237 (46%), Gaps = 39/237 (16%)

Query: 461 SSGVIPASTLFFMVFLWFLFSIPLS-FAGSLVARKKCH---------------------W 498
           S+ V+P +T+  ++F++F+  IPLS   GS+ A K                         
Sbjct: 441 STNVLPFATIMKLLFIYFIVCIPLSVLGGSIAANKDSEEYSRLRSDSIKRISRTRANKIM 500

Query: 499 DEHPTKTNQIARQIPFQ-PWYLK-------TVPATLIAGVFPFGSIAVELYFIYTSLWFN 550
           DE      +  R++ ++  W LK       TV + L +G+FPF  I VEL F+Y S+W+ 
Sbjct: 501 DEDQGTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQFVYKSVWYE 560

Query: 551 K--IFYMXXXXXXXXXXXXXXXXXXXXXXXYHSLCLENW----KWQWRGFIVGGAGCALY 604
           K   +Y                        Y  + + +      W+W+ F +  + CA Y
Sbjct: 561 KTTFYYYYGFLLANIILLCLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQL-SSSCAWY 619

Query: 605 VFIHSI--LFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSS 659
           +  +SI  +F    +  F++I++ V YS + + LC L  GSIG+++S++F++++Y S
Sbjct: 620 MEAYSIYYVFKVLNMRDFSSILISVCYSLLFNALCGLAMGSIGYLASLWFVKRVYRS 676

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 110/261 (42%), Gaps = 48/261 (18%)

Query: 42  LTPSMYYQHKDEEG---NNVSGDKENFLYSYDYYNSRFHFCKPEKVEKQPE--SLGSIIF 96
           LTP++Y +H D      N +  D       Y YY+    F  P  V+K+P   SL  +I 
Sbjct: 33  LTPTIY-RHGDPVEIIVNKIESDATQL--PYGYYD--LPFTCPPTVDKKPLHLSLNEVIR 87

Query: 97  GDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQNWLIDG-LPAARNVS 155
           GDR + S ++L+  ++ EC  LC +    +  + ++K IK  +   W ID  LPAA    
Sbjct: 88  GDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVVQWFIDKELPAATTFI 147

Query: 156 DKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTRDGHNMVQTYEHPYFT 215
               +  +YG+GF LGFV+   G                                  Y  
Sbjct: 148 STVDQKKYYGSGFPLGFVDEETGKV--------------------------------YVN 175

Query: 216 NHYDIRIEYHDRGEGNYRVVGVIVNPVSIK--RSDPETCETDGSPLMLDE--ENDNEVYF 271
           NH  + I YH   + N+ +VG  + P S+        + + D   +++ E    D  + F
Sbjct: 176 NHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASKDYDQYEVVVPEIANEDTFIPF 235

Query: 272 TYSVKFVES-ETSWATRWDKY 291
           TYSV + E  +  W  R++ +
Sbjct: 236 TYSVYWREEFDVEWKDRYNLF 256

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 111/269 (41%), Gaps = 51/269 (18%)

Query: 34  EIPLL----VNHLTPSMYYQHKDEE--GNNVSGDKENFLYSYDYYNSRFHFCKPEKVEKQ 87
            IP++     N LTP++Y +  D E   N +  D       Y YY+  F  C P   +++
Sbjct: 25  HIPIIQRHDANRLTPNIYRKGDDVELIVNKIESDLTKL--PYGYYDLPF-ICPPTN-QRK 80

Query: 88  P--ESLGSIIFGDRIYNSPFQLKMLEEKECVSLC-KKTIPGNDAKFINKLIKNGFFQNWL 144
           P   SL  I+ GDR + S + L   ++ +C  LC +KT P    K IN L+K  +   W 
Sbjct: 81  PLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYIVQWS 139

Query: 145 IDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTRDGH 203
           ID  LPA+           +Y  GF LGFV+          P+T                
Sbjct: 140 IDNDLPASTTFISTSENRKYYIPGFSLGFVD----------PDT---------------- 173

Query: 204 NMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPLMLDE 263
                 E  Y  NH  + I YH   + ++ +VG+ V P S+          +     L  
Sbjct: 174 ------ETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQFELVA 227

Query: 264 ENDNEVY---FTYSVKFVES-ETSWATRW 288
            +D EV    FTYSV + E  +  W  R+
Sbjct: 228 NDDEEVTYIPFTYSVYWREEFDVEWKDRY 256

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 98/223 (43%), Gaps = 34/223 (15%)

Query: 461 SSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCH-----------WDEHPTKTNQIA 509
           SS  +P  T+ F++ ++F+  IPLS  G   A   C              +     + +A
Sbjct: 442 SSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQKRTLRAFSSPAQQKLAVTNSNLA 501

Query: 510 RQI------PFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNK--IFYMXXXXXX 561
           R I      PF            I G+FPF  I VEL  +Y  +W  K   +Y+      
Sbjct: 502 RTIKSIFDDPFSGLLAS------IGGLFPFFIIYVELQHVYKFVWLEKASFYYLRWFLFA 555

Query: 562 XXXXXXXXXXXXXXXXXY---HSL--CLENWKWQWRGFIVGGAGCALYVFIHSILFTKFK 616
                            Y   HS    LEN  W+WR F +  + CA Y+ ++S+ +  + 
Sbjct: 556 NIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQISSS-CAWYMELYSLYYIFYV 613

Query: 617 LG--GFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIY 657
           L   GF++I+L V  S++ + LC    GSIG++++ +F+ ++Y
Sbjct: 614 LNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWFVGRVY 656

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 105/269 (39%), Gaps = 56/269 (20%)

Query: 26  PTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEKVE 85
           P+ Y   + + LLV+                N+  D+E     + YY + F    P +  
Sbjct: 39  PSAYTRGERVQLLVD----------------NIWTDRE----VWGYYETLFTCPPPAEAR 78

Query: 86  KQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQNWLI 145
               SLG +   +  + S + L +  E +C  LC + +  +  + + ++I++G    W +
Sbjct: 79  AIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWTL 138

Query: 146 DGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTRDGHNM 205
           DGLPAA    D+++    Y AGF+LG                        E+D   GH  
Sbjct: 139 DGLPAATTYPDRQSSYR-YEAGFKLG------------------------EVDAETGHVR 173

Query: 206 VQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPLML--DE 263
           +         NH  + + Y    +G Y +VG    P S+        +T+     L  D 
Sbjct: 174 LH--------NHVMLVVRYRILDDGRYVIVGFEAYPRSVAGEGCTGGQTEYEHFWLNPDA 225

Query: 264 ENDNEVYFTYSVKF-VESETSWATRWDKY 291
           +    V FTY+V +  +S   W  RW  Y
Sbjct: 226 QAMIMVPFTYAVYWRYQSAVKWNERWRLY 254

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 5/64 (7%)

Query: 587 WKWQWRGFIVGGAGCALYV---FIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGS 643
           + W+W+ F VGGA  A Y+    IHSI      LG    I+L + Y++V+++   LV G+
Sbjct: 577 YSWRWKLFGVGGAA-AWYLEAHAIHSIRHAYAHLGS-PNIILAIFYATVLNIAYWLVFGA 634

Query: 644 IGFI 647
            G++
Sbjct: 635 FGYL 638

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 113/497 (22%), Positives = 185/497 (37%), Gaps = 67/497 (13%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEK 83
           V P TY   D + ++VN +      Q KD  G++  G       SY Y++  +  C P  
Sbjct: 46  VHPNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEG------VSYKYHDLPY-ICPPTN 93

Query: 84  VEKQ-PESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQN 142
            +K    SL  +  GD    S + LK   + +C +LC +       +   ++I   +  N
Sbjct: 94  TKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVN 153

Query: 143 WLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTRD 201
           W ID  LPAA       T+   Y  GF LG+ +   G+                      
Sbjct: 154 WFIDDYLPAATTYISSVTRKKKYFEGFSLGWKDPETGSY--------------------- 192

Query: 202 GHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSD-PETCETDGSPLM 260
                      Y  NH  + I Y+   +  + +VG  V P SI     P      G   +
Sbjct: 193 -----------YINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARRGHGHYEL 241

Query: 261 LDEENDNE---VYFTYSVKFVES-ETSWATRWDKY-------LHVYDPSIQWXXXXXXXX 309
            D EN++E   + F+YSV + E  E  W TRW  +       L   D S+Q         
Sbjct: 242 KDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVRPNYMDLDAEDESLQLGFISNLLH 301

Query: 310 XXXXXXXXXXXXXXRALKSDFA---RYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLS 366
                           L S        ++L    + +    W  +  +      +++ L+
Sbjct: 302 WYSPYTTVIIFTILLFLVSLLVLDINSHKLVFMSNPKTVIAWATT-ANKLNKTWKNILLN 360

Query: 367 ILVGSGVQ-LFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYA--LFG-FVGSYTSMGIY 422
           ILV  G Q LF  +   +  ++L  L   S   +  ++  + A  L G FVG++  M ++
Sbjct: 361 ILVSMGCQALFIFMPVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFVGTWLRMYMF 420

Query: 423 KFFDGPYWKANXXXXXXXXX-XXXXXXXXXXNFFLMFVHSSGVIPASTLFFMVFLWFLFS 481
           +    P +                       N    F+  +   P   L +++F++F+FS
Sbjct: 421 QKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWLIFVYFIFS 480

Query: 482 IPLSFAGSLVARKKCHW 498
           IP+S  G  +A K  H+
Sbjct: 481 IPMSLIGGSLAVKIQHY 497

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 109/283 (38%), Gaps = 58/283 (20%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEK 83
           V P  Y++ +E+ +L+N                 V G       SY YY+ +F  C P K
Sbjct: 40  VRPRIYQDGEEVEMLLNQ----------------VVGKPGEL--SYGYYDLQFT-CTPTK 80

Query: 84  VEKQPE-SLGSIIFGDRIYNSPFQLKMLEEKECVSLC-KKTIPGNDAKFINKLIKNGFFQ 141
             +    SL  +  GDR + S ++L    E +C +LC +KT P    +  + LI+  +  
Sbjct: 81  SRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIE-ADSLIRQNYTV 139

Query: 142 NWLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTR 200
             LID  +PA++     R    +Y  GF LGFV+          P T  T          
Sbjct: 140 QLLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD----------PETDVT---------- 179

Query: 201 DGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPLM 260
                       Y  NH+ + I Y+      Y +VG  V P S+          D     
Sbjct: 180 ------------YLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCPGSSKDYENYA 227

Query: 261 LDEENDNEVY--FTYSVKFVES-ETSWATRWDKYLHVYDPSIQ 300
           ++    + V+   TYSV + E     W  RW+ YL   D  + 
Sbjct: 228 VNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVN 270

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 98/245 (40%), Gaps = 57/245 (23%)

Query: 465 IPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEH----------------PTK---- 504
           +P   +  ++ L+F+ S+PLS  G   A  K   D+H                P+K    
Sbjct: 428 MPFRDITLLLALYFMVSLPLSLLGGTSASYKLK-DQHFQLYSLSTKYTGTPVSPSKPTFW 486

Query: 505 ---------TNQIA-RQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNK--I 552
                    T   A  QIP   W  K    T I G+ PF +I +++ FI+  LW +   +
Sbjct: 487 FNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGIIPFLAIYLQMEFIWKPLWTHSKSL 544

Query: 553 FYMXXXXXXXXXXXXXXXXXXXXXXXYHSL--------CLENW-----------KWQWRG 593
           F +                       Y  +        C ++             W+W+ 
Sbjct: 545 FQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDSECCFDDTCVTGRISNAVSSWRWKA 604

Query: 594 FIVGGAGCALYVFIHSILFTKF--KLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMF 651
           F +GGA  A Y   +S+ +  F  +L  F +I+LY+ Y +++++      GSIG+++  +
Sbjct: 605 FYMGGAA-AWYWEAYSLYYMIFILRLRNFGSILLYLSYGTLLNVFYFYSFGSIGYLACCW 663

Query: 652 FIRKI 656
           F+ K+
Sbjct: 664 FLNKL 668

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 96/276 (34%), Gaps = 57/276 (20%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEK 83
           + P  YK  D++ +  N   P       D+   +        L  YD       F  P  
Sbjct: 60  IKPNLYKVGDKVQITTNKALP-------DDPAVSQPA-----LCYYD-----LPFVCPPS 102

Query: 84  VEKQP--ESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQ 141
             K+P   SL  +  GD +  S + L+  +++ C  LC +       +    LIKN +  
Sbjct: 103 DTKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIV 162

Query: 142 NWLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTR 200
            W +D  LP        +     Y  GF LG+ +   G A                    
Sbjct: 163 QWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYFDNQTGQA-------------------- 202

Query: 201 DGHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETCETDGSPL- 259
                       Y   H    + YH      + +VG+ V P SI   +      D  PL 
Sbjct: 203 ------------YLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPGASKDFIPLE 250

Query: 260 -MLDEENDNEVY--FTYSVKFVES-ETSWATRWDKY 291
             + E ND+  Y  F+YSV + E  +  W  RWD +
Sbjct: 251 VKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLF 286

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 103/273 (37%), Gaps = 56/273 (20%)

Query: 24  VAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRFHFCKPEK 83
           + P  YK  D + LLVN    ++            + D    L  Y Y++  F  C P  
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTL------------NAD----LKPYIYHDLPF-VCPPTS 89

Query: 84  VEKQPE-SLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIKNGFFQN 142
           V K       S+  GD +  S ++LK  ++ EC  LC +    N       +IK  +   
Sbjct: 90  VRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQIL 149

Query: 143 WLIDG-LPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVELDTRD 201
           W ID  LP +       T+   Y  GF LG  +                         +D
Sbjct: 150 WSIDDELPISMPYISTITQRKKYIPGFPLGRFD-------------------------KD 184

Query: 202 GHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVG--VIVNPVSIKRSDPETCETDGSPL 259
            + +       Y  NH  + I Y+   +  + +VG  V +  VS       +   +   L
Sbjct: 185 KNKV-------YLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGASKNYEEYEL 237

Query: 260 MLDEENDNEVY--FTYSVKFVES-ETSWATRWD 289
           ++ E +D+  +  FTYSV + E  +  W +RW+
Sbjct: 238 VIPENDDDLTFIPFTYSVYWREEFDIDWTSRWN 270

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 47/236 (19%), Positives = 91/236 (38%), Gaps = 39/236 (16%)

Query: 458 FVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARK-KCHWDEH------PTKTNQIAR 510
            + SS   P  TL  M+  +++  +P S  G  +A+K + H+ E         + N    
Sbjct: 449 LIESSSRYPFKTLTMMISFFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDE 508

Query: 511 QIPFQPWY---------LKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKIFYMXXXXXX 561
           +  F+  +         L T+  +LI  + PF  I  ELY+I+T+ W N   ++      
Sbjct: 509 KKRFKAQHRPSSINKNKLGTLVYSLITAIVPFFIIKSELYWIFTNKWLNYTTFIKSFIFL 568

Query: 562 XXXXXXXXXXXXXXXX-------XYHSLCLENWK-----WQWRGFIVGGAGC------AL 603
                                        +  W+      +W  F+     C      +L
Sbjct: 569 IIKLFIIIITVSSTSLVGLFVNIMMTKKGISQWRDDPISLRWSCFLNSFNICYLTGLYSL 628

Query: 604 YVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSS 659
           Y  I  I     ++ GF+  VL + Y+  ++++  +  G+I +++  + I K+Y +
Sbjct: 629 YYIIEVI-----RIHGFSMTVLTIFYTIALNVILGISCGAIAYMTCYWLIIKLYKN 679

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 26/42 (61%)

Query: 326 LKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSI 367
           +K+++ ++  +  D +FQ  +GWKLS+ D    P+R+ T  I
Sbjct: 43  IKTEYRQFRNMTYDSNFQNITGWKLSYQDALDDPNRNATYPI 84

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,802,756
Number of extensions: 2955907
Number of successful extensions: 7386
Number of sequences better than 10.0: 53
Number of HSP's gapped: 7373
Number of HSP's successfully gapped: 83
Length of query: 663
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 547
Effective length of database: 40,180,143
Effective search space: 21978538221
Effective search space used: 21978538221
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)