Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_12.141na 1ON39239219010.0
YLR082C (SRL2)na 1ON39239216010.0
Suva_10.166na 1ON39239216010.0
Skud_12.150na 1ON39039215990.0
Kpol_1035.468.28ON116085679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_12.141
         (392 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_12.141 Chr12 complement(272182..273360) [1179 bp, 392 aa] {...   736   0.0  
YLR082C Chr12 complement(292394..293572) [1179 bp, 392 aa] {ON} ...   621   0.0  
Suva_10.166 Chr10 complement(297390..298568) [1179 bp, 392 aa] {...   621   0.0  
Skud_12.150 Chr12 complement(275805..276977) [1173 bp, 390 aa] {...   620   0.0  
Kpol_1035.46 s1035 complement(116235..117668,118047..119351,1194...    30   9.2  

>Smik_12.141 Chr12 complement(272182..273360) [1179 bp, 392 aa] {ON}
           YLR082C (REAL)
          Length = 392

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/392 (92%), Positives = 361/392 (92%)

Query: 1   MSNFKNFTLNSFEDYYGKASETPKMEDEKSEATNVXXXXXXXXXXXXXNTTRYDQKNVFR 60
           MSNFKNFTLNSFEDYYGKASETPKMEDEKSEATNV             NTTRYDQKNVFR
Sbjct: 1   MSNFKNFTLNSFEDYYGKASETPKMEDEKSEATNVSASSSKKVYKSKKNTTRYDQKNVFR 60

Query: 61  NSTTGLAQTLPTKPVKIIEQSIDFANPKSFDLLQSTHTICFNRKNGTTDTKLNMEAQTSS 120
           NSTTGLAQTLPTKPVKIIEQSIDFANPKSFDLLQSTHTICFNRKNGTTDTKLNMEAQTSS
Sbjct: 61  NSTTGLAQTLPTKPVKIIEQSIDFANPKSFDLLQSTHTICFNRKNGTTDTKLNMEAQTSS 120

Query: 121 DIDNDMLHVGAPSDLGGNSNDEAETRQLRKFRWSNNKEKCICEKLTVIYWALLLNTTKRA 180
           DIDNDMLHVGAPSDLGGNSNDEAETRQLRKFRWSNNKEKCICEKLTVIYWALLLNTTKRA
Sbjct: 121 DIDNDMLHVGAPSDLGGNSNDEAETRQLRKFRWSNNKEKCICEKLTVIYWALLLNTTKRA 180

Query: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWVTQGKELHEKGWEGDSKTGD 240
           SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWVTQGKELHEKGWEGDSKTGD
Sbjct: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWVTQGKELHEKGWEGDSKTGD 240

Query: 241 LQEQFNIAIIKLYDSAEDGRLIMAKDXXXXXXXXXXXXXXXXXXDFTSTTDENDQVALQR 300
           LQEQFNIAIIKLYDSAEDGRLIMAKD                  DFTSTTDENDQVALQR
Sbjct: 241 LQEQFNIAIIKLYDSAEDGRLIMAKDRVFREENSRSNSSVRAEEDFTSTTDENDQVALQR 300

Query: 301 NLKEDRRESIRNHILALDLNDEDFLHNIMKILSSIDEPELRQYVVIISELVSMEIDDGKT 360
           NLKEDRRESIRNHILALDLNDEDFLHNIMKILSSIDEPELRQYVVIISELVSMEIDDGKT
Sbjct: 301 NLKEDRRESIRNHILALDLNDEDFLHNIMKILSSIDEPELRQYVVIISELVSMEIDDGKT 360

Query: 361 VREKLRDVEMSINRLQVDIKEIKEMLIMLAKK 392
           VREKLRDVEMSINRLQVDIKEIKEMLIMLAKK
Sbjct: 361 VREKLRDVEMSINRLQVDIKEIKEMLIMLAKK 392

>YLR082C Chr12 complement(292394..293572) [1179 bp, 392 aa] {ON}
           SRL2Protein of unknown function; overexpression
           suppresses the lethality caused by a rad53 null mutation
          Length = 392

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/392 (76%), Positives = 334/392 (85%)

Query: 1   MSNFKNFTLNSFEDYYGKASETPKMEDEKSEATNVXXXXXXXXXXXXXNTTRYDQKNVFR 60
           MSNFKNFTLNSFEDYYGK SETPKME+EK E TNV             +T++YDQKNVFR
Sbjct: 1   MSNFKNFTLNSFEDYYGKPSETPKMEEEKLEVTNVNASSSKKVHKSKKSTSKYDQKNVFR 60

Query: 61  NSTTGLAQTLPTKPVKIIEQSIDFANPKSFDLLQSTHTICFNRKNGTTDTKLNMEAQTSS 120
           NS TG+AQ LPTKPVKIIEQ+IDFANPKSFDLLQSTHTICFN++  TT+TKLN+E  TSS
Sbjct: 61  NSMTGIAQILPTKPVKIIEQNIDFANPKSFDLLQSTHTICFNKRINTTNTKLNVETHTSS 120

Query: 121 DIDNDMLHVGAPSDLGGNSNDEAETRQLRKFRWSNNKEKCICEKLTVIYWALLLNTTKRA 180
           DIDND+LHVGAP+DLGGNSNDEAETRQLRKFRWSNNKEK +CEKLTVIYWALLL+TTKRA
Sbjct: 121 DIDNDILHVGAPTDLGGNSNDEAETRQLRKFRWSNNKEKSLCEKLTVIYWALLLHTTKRA 180

Query: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWVTQGKELHEKGWEGDSKTGD 240
           SKRRPILCHQ+IAEFFNRVYKEKSRVPITSRYIRDNLV WVTQGKELHEKGW GD+KTGD
Sbjct: 181 SKRRPILCHQMIAEFFNRVYKEKSRVPITSRYIRDNLVAWVTQGKELHEKGWVGDAKTGD 240

Query: 241 LQEQFNIAIIKLYDSAEDGRLIMAKDXXXXXXXXXXXXXXXXXXDFTSTTDENDQVALQR 300
           LQEQFNIA +KLY+SAEDGRL + KD                  D T+ T+EN  ++ ++
Sbjct: 241 LQEQFNIATVKLYESAEDGRLSIGKDKPFREENTGSDSLVRAEEDSTAVTNENGHISSEK 300

Query: 301 NLKEDRRESIRNHILALDLNDEDFLHNIMKILSSIDEPELRQYVVIISELVSMEIDDGKT 360
           NLK+DRRESIRN IL LDLNDEDF  N+MK+LS+IDEPELRQYV++ISELVSME+DDGKT
Sbjct: 301 NLKKDRRESIRNQILTLDLNDEDFFQNVMKVLSAIDEPELRQYVIVISELVSMEMDDGKT 360

Query: 361 VREKLRDVEMSINRLQVDIKEIKEMLIMLAKK 392
           VREKLRDVE++INRLQVDIKEIKEML+ L  K
Sbjct: 361 VREKLRDVELNINRLQVDIKEIKEMLVTLINK 392

>Suva_10.166 Chr10 complement(297390..298568) [1179 bp, 392 aa] {ON}
           YLR082C (REAL)
          Length = 392

 Score =  621 bits (1601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/392 (76%), Positives = 326/392 (83%)

Query: 1   MSNFKNFTLNSFEDYYGKASETPKMEDEKSEATNVXXXXXXXXXXXXXNTTRYDQKNVFR 60
           MSNFKNFTLNSFEDYYGKASE  +ME+EK EATN+             N ++YDQKNVFR
Sbjct: 1   MSNFKNFTLNSFEDYYGKASEPSRMEEEKLEATNLNVSSLKKVHKGKKNASKYDQKNVFR 60

Query: 61  NSTTGLAQTLPTKPVKIIEQSIDFANPKSFDLLQSTHTICFNRKNGTTDTKLNMEAQTSS 120
           NS TG+ Q  P KP+KIIEQ+I+FANPKSFDLLQSTHTICF++KNGTTDTKLNMEAQTSS
Sbjct: 61  NSMTGVVQAAPLKPIKIIEQNIEFANPKSFDLLQSTHTICFSKKNGTTDTKLNMEAQTSS 120

Query: 121 DIDNDMLHVGAPSDLGGNSNDEAETRQLRKFRWSNNKEKCICEKLTVIYWALLLNTTKRA 180
           DIDND+LHVGAP+DLGGNSNDEAETRQLRKFRWSNNK+KC+CEKLTVIYWALLLNTTKRA
Sbjct: 121 DIDNDLLHVGAPTDLGGNSNDEAETRQLRKFRWSNNKDKCLCEKLTVIYWALLLNTTKRA 180

Query: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWVTQGKELHEKGWEGDSKTGD 240
           SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTW+ QGKELHEKGW   +KTGD
Sbjct: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWIAQGKELHEKGWIDIAKTGD 240

Query: 241 LQEQFNIAIIKLYDSAEDGRLIMAKDXXXXXXXXXXXXXXXXXXDFTSTTDENDQVALQR 300
           LQEQFN A IKLY+SAEDGR I +KD                  +   TTDE   V   +
Sbjct: 241 LQEQFNFATIKLYESAEDGRFIASKDKTSREENTVNDGSIQPEEESADTTDETGPVTTGK 300

Query: 301 NLKEDRRESIRNHILALDLNDEDFLHNIMKILSSIDEPELRQYVVIISELVSMEIDDGKT 360
           + KEDRRE IRN ILALDLNDEDF  N+MK LSSIDEP+LRQYV IISELV+MEIDDGKT
Sbjct: 301 STKEDRRELIRNQILALDLNDEDFFQNVMKTLSSIDEPKLRQYVTIISELVNMEIDDGKT 360

Query: 361 VREKLRDVEMSINRLQVDIKEIKEMLIMLAKK 392
           VREKLRDVEMSINRLQVDI+EIKEMLI LA K
Sbjct: 361 VREKLRDVEMSINRLQVDIREIKEMLIALANK 392

>Skud_12.150 Chr12 complement(275805..276977) [1173 bp, 390 aa] {ON}
           YLR082C (REAL)
          Length = 390

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/392 (77%), Positives = 329/392 (83%), Gaps = 2/392 (0%)

Query: 1   MSNFKNFTLNSFEDYYGKASETPKMEDEKSEATNVXXXXXXXXXXXXXNTTRYDQKNVFR 60
           MSNFKNFTLNSFED+YGKASETPK+E+EK EA N                ++YDQKNVFR
Sbjct: 1   MSNFKNFTLNSFEDFYGKASETPKIEEEKLEAMNTNASSLKKVHKNKKVISKYDQKNVFR 60

Query: 61  NSTTGLAQTLPTKPVKIIEQSIDFANPKSFDLLQSTHTICFNRKNGTTDTKLNMEAQTSS 120
           NS T LAQ  P+K VKIIEQ+I+F+NPKSFDLLQ+THTICFN+KNGT DTK+NMEAQTSS
Sbjct: 61  NSMTALAQVPPSKSVKIIEQNIEFSNPKSFDLLQATHTICFNKKNGTKDTKINMEAQTSS 120

Query: 121 DIDNDMLHVGAPSDLGGNSNDEAETRQLRKFRWSNNKEKCICEKLTVIYWALLLNTTKRA 180
           DIDNDML+V AP+DLGGNSNDEAETRQLRKFRWSNNKEKC+CEKLTVIYWALLLNTTKRA
Sbjct: 121 DIDNDMLYVEAPADLGGNSNDEAETRQLRKFRWSNNKEKCLCEKLTVIYWALLLNTTKRA 180

Query: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVTWVTQGKELHEKGWEGDSKTGD 240
           SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLV WVTQGKELHEKGW GD+KT D
Sbjct: 181 SKRRPILCHQVIAEFFNRVYKEKSRVPITSRYIRDNLVAWVTQGKELHEKGWIGDTKTSD 240

Query: 241 LQEQFNIAIIKLYDSAEDGRLIMAKDXXXXXXXXXXXXXXXXXXDFTSTTDENDQVALQR 300
           LQEQFNIA +KLY+S E+GR+IM KD                  +  S TDEN QVAL++
Sbjct: 241 LQEQFNIATVKLYESTENGRIIMGKD--KVFREENAGSDGLVQEESASVTDENGQVALEK 298

Query: 301 NLKEDRRESIRNHILALDLNDEDFLHNIMKILSSIDEPELRQYVVIISELVSMEIDDGKT 360
           NLKEDRRESIRN ILALDL DEDF  N MK LS+IDEPELRQY VIISELVSMEIDDGKT
Sbjct: 299 NLKEDRRESIRNQILALDLGDEDFFQNTMKNLSAIDEPELRQYGVIISELVSMEIDDGKT 358

Query: 361 VREKLRDVEMSINRLQVDIKEIKEMLIMLAKK 392
           VREKLRDVEMSINRLQ+DIKEIKE+LI L  K
Sbjct: 359 VREKLRDVEMSINRLQLDIKEIKELLITLMNK 390

>Kpol_1035.46 s1035
           complement(116235..117668,118047..119351,119401..119409,
           119456..120190) [3483 bp, 1160 aa] {ON}
           complement(116235..117668,118047..119351,119401..119409,
           119456..120190) [3483 nt, 1161 aa]
          Length = 1160

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 47/85 (55%), Gaps = 6/85 (7%)

Query: 301 NLKEDRRESIRNHILALDLNDEDFLHNIMKILSSIDEP-ELRQYVVIISELVSMEIDDGK 359
           N+  +  +SI +H+  L + D + LHN +K++   D P  LR  + I S    +++++ K
Sbjct: 197 NMGYNSVKSITSHVDILSVADLELLHNKLKLIKYYDIPRSLRPLIQIESXXXGLKLNNEK 256

Query: 360 TVREKLRDVEM--SINRLQVDIKEI 382
           +   +L +V +  S+  L  D+K++
Sbjct: 257 S---ELPEVSLGESVQTLDKDVKKL 278

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,356,215
Number of extensions: 1734129
Number of successful extensions: 6069
Number of sequences better than 10.0: 22
Number of HSP's gapped: 6291
Number of HSP's successfully gapped: 22
Length of query: 392
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 280
Effective length of database: 40,638,807
Effective search space: 11378865960
Effective search space used: 11378865960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)