Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_11.3625.712ON72172134660.0
YKR098C (UBP11)5.712ON71772326830.0
Skud_11.3385.712ON71272226270.0
Suva_11.3355.712ON72472123610.0
NDAI0F002005.712ON110544512421e-156
NCAS0G001705.712ON103044012191e-153
TDEL0B020805.712ON102543611961e-150
SAKL0E15136g5.712ON103744111801e-148
Kpol_2001.785.712ON40340310951e-143
Kwal_55.196455.712ON97043811061e-137
KLTH0E00814g5.712ON97443811031e-137
KLLA0A00396g5.712ON101244010811e-133
TPHA0D046605.712ON104543910551e-129
Ecym_40095.712ON151743310581e-126
KAFR0D021605.712ON8464368981e-108
CAGL0G02563gsingletonON6314398651e-106
KNAG0L022005.712ON11612497645e-87
TBLA0E017605.712ON12122497621e-86
Skud_9.125.712ON10642527552e-86
Suva_9.305.712ON10622497511e-85
YIL156W (UBP7)5.712ON10712527422e-84
CAGL0H06721g5.712ON10812527282e-82
Smik_9.135.712ON10602507253e-82
ZYRO0B16544g5.712ON10442526701e-74
AFR296C5.712ON11692506624e-73
KAFR0H001505.712ON6562516125e-69
TDEL0B042208.188ON8254663378e-32
Kpol_1032.288.188ON8824423342e-31
Skud_4.3238.188ON9264443333e-31
KAFR0C025908.188ON9784513272e-30
Suva_2.2288.188ON9274643244e-30
KNAG0D019308.188ON9864473192e-29
Ecym_61848.188ON8514443182e-29
TPHA0C027708.188ON9704473164e-29
YDR069C (DOA4)8.188ON9264403121e-28
ZYRO0G06798g8.188ON8774413092e-28
Smik_4.3078.188ON9294403075e-28
CAGL0G05247g8.188ON9474403066e-28
CAGL0I06765g8.188ON8874433031e-27
NDAI0A036808.188ON11164503003e-27
SAKL0H18986g8.188ON8934502977e-27
Kwal_14.20088.188ON4244452888e-27
NCAS0B042808.188ON9224412923e-26
AFR007W8.188ON8484142772e-24
KLTH0H07678g8.188ON8614432753e-24
YER144C (UBP5)8.188ON8052612611e-22
Kpol_304.65.712ON5621282511e-21
TBLA0F036108.188ON11442512541e-21
Smik_5.3098.188ON8052622522e-21
NDAI0C059008.188ON8262662451e-20
Suva_5.2728.188ON7882632405e-20
KLLA0E10275g8.188ON7962462387e-20
Skud_5.2818.188ON8232492333e-19
NCAS0I031401.137ON12012211834e-13
KNAG0G015908.188ON6712351799e-13
NCAS0A039108.188ON7952571744e-12
AFR627C1.137ON12872141593e-10
TDEL0C056401.137ON11782001584e-10
KNAG0C021801.137ON12312261559e-10
KAFR0F015601.137ON11712011531e-09
NDAI0B004801.137ON12532071512e-09
ZYRO0C17908g1.137ON12042081513e-09
TPHA0A025401.137ON12862031494e-09
CAGL0L01639g1.137ON11472191485e-09
Kpol_2001.541.137ON12232171486e-09
Smik_10.371.137ON12472051477e-09
Suva_6.2761.137ON12562121477e-09
Kwal_33.136281.137ON11602011477e-09
Skud_10.221.137ON12552061478e-09
YJL197W (UBP12)1.137ON12542101432e-08
Ecym_81401.137ON12642001371e-07
SAKL0C04246g1.137ON12972091352e-07
KLTH0F03674g1.137ON11982071334e-07
TBLA0J006001.137ON14622411316e-07
KLLA0C03476g1.137ON12522041308e-07
TBLA0D010708.742ON4834241262e-06
KAFR0A042108.742ON4401191233e-06
KNAG0C035807.390ON7761281243e-06
KNAG0B023707.390ON7531261234e-06
Suva_2.507.390ON7501221201e-05
NCAS0E026107.390ON7171471201e-05
YBL067C (UBP13)7.390ON7471221191e-05
NCAS0A143707.390ON7291281182e-05
AEL029W1.369ON4461041172e-05
ZYRO0B03300g7.390ON8131241163e-05
Ecym_46857.390ON7781231164e-05
Smik_2.497.390ON7451221154e-05
NCAS0C021108.540ON4943731145e-05
KLTH0B07150g2.69ON7561091146e-05
KLLA0D08459g2.69ON7501081128e-05
KAFR0A069102.307ON6783631111e-04
KLLA0C06974g8.742ON4464401101e-04
AEL242W8.540ON613821101e-04
Skud_2.387.390ON7481201101e-04
NDAI0A016707.390ON8461241092e-04
TPHA0G005608.742ON4632401082e-04
CAGL0M11198g8.742ON4611221082e-04
SAKL0H04994g8.742ON4541341073e-04
YER098W (UBP9)7.390ON7541341083e-04
Smik_14.1442.69ON7631291083e-04
NCAS0B005808.742ON4661211073e-04
KAFR0A075802.69ON8021331083e-04
Ecym_27171.369ON4831041073e-04
NDAI0E041807.390ON8271291074e-04
TPHA0E008707.390ON7151311074e-04
NCAS0I016203.270ON7952381074e-04
Ecym_62488.742ON4661101064e-04
CAGL0I05522g7.390ON7241241065e-04
Suva_14.1562.69ON7881291065e-04
ZYRO0C09812g2.69ON7021341056e-04
TPHA0P006807.390ON7271251056e-04
KAFR0E009308.540ON4981271046e-04
Kpol_534.231.369ON4961201047e-04
TDEL0C015707.390ON7651311048e-04
Kwal_34.162681.369ON4491241030.001
Skud_14.1482.69ON7761291030.001
Kpol_1045.417.390ON7121261030.001
TDEL0A011002.69ON6611371020.001
Smik_5.2447.390ON7491221020.002
ABL145W2.69ON7491081010.002
YNL186W (UBP10)2.69ON7921011010.002
SAKL0E13002g2.69ON7391031000.002
TPHA0A025101.369ON505113990.003
CAGL0A04477g7.390ON7701221000.003
KNAG0F012202.69ON784136990.003
ZYRO0A05962g8.742ON465118980.003
CAGL0J11352g2.69ON771103990.003
Kwal_33.144302.69ON511107980.004
Kwal_26.91518.742ON454129960.005
TBLA0C070205.18ON1247262970.005
Suva_4.2953.270ON782192970.006
TBLA0B097602.69ON898105960.007
Suva_5.2177.390ON754124960.007
KNAG0E012905.18ON1196102960.007
KNAG0J008003.270ON765116960.007
Suva_13.4078.742ON471127940.011
NCAS0D023905.18ON1211101950.011
Skud_5.2237.390ON748122940.012
Skud_13.3928.742ON473129930.013
TBLA0H036008.540ON482385930.014
KNAG0G029308.742ON45994930.014
Smik_16.1638.540ON501132930.014
KAFR0L017307.390ON701128930.015
TDEL0G004105.18ON1186114940.015
CAGL0I06600g8.202ON816150930.017
Smik_13.4318.742ON471127920.017
TPHA0J026205.443ON122533930.018
YMR223W (UBP8)8.742ON471127920.019
TBLA0B019308.202ON1019143930.020
KLTH0D12760g8.742ON453129920.021
NDAI0H035501.369ON502106920.022
Kpol_513.255.18ON1190230920.022
TBLA0D006207.390ON1171120920.025
NDAI0F034102.69ON870105910.026
SAKL0H00418g5.18ON1190235920.027
Kpol_1018.937.390ON755126910.027
CAGL0K10494g1.369ON495141910.029
NCAS0G018002.69ON875107910.032
ZYRO0D03982g8.540ON821218900.036
KNAG0A054502.307ON764116900.037
NDAI0A074103.270ON810229900.042
Ecym_56715.18ON1176103900.045
Klac_YGOB_Anc_5.18b5.18ON1166263890.054
NCAS0D006001.369ON49329880.057
ZYRO0F01276g3.270ON776193880.065
KLLA0E23387g8.540ON78281880.065
Kwal_26.95985.18ON1191237880.072
TDEL0B030608.540ON73481870.077
KLTH0H13354g1.369ON495116870.078
AGR139C8.202ON789143870.084
KLTH0H07370g8.202ON781133870.088
SAKL0F12430g7.390ON754125870.098
TBLA0C012001.369ON50332860.11
KAFR0I026005.18ON1213237860.11
Ecym_11668.540ON69683860.11
CAGL0M13783g5.18ON1196100860.11
KLTH0B09944g5.18ON1189237860.12
TPHA0L022905.18ON1193230860.13
AGL357W5.18ON1166236850.16
AGR370W7.390ON74081850.16
Kwal_14.19578.202ON444142840.17
YPL072W (UBP16)8.540ON49982840.18
ZYRO0D07062g5.18ON1193241840.22
TDEL0B036708.742ON463122820.27
KNAG0A019708.540ON471143820.30
SAKL0H10076g8.540ON76781820.30
KAFR0C004103.270ON769190820.33
SAKL0D10120g1.369ON492137810.35
Kpol_1064.488.742ON466245810.41
KLLA0E20351g7.390ON69731810.41
NDAI0I025305.18ON1197101810.42
Suva_13.4955.18ON1230107810.44
Skud_16.2098.540ON50382810.45
Kwal_27.120308.540ON74981810.50
Kpol_1024.448.540ON496198800.53
ZYRO0G01188g1.369ON50030800.54
NDAI0E008108.742ON493130800.58
KNAG0C019401.369ON499114790.67
TDEL0D024001.369ON49429790.67
KAFR0K018107.390ON71427790.72
SAKL0G02728g5.443ON123730780.98
KLTH0E12540g8.540ON75268781.0
YMR304W (UBP15)5.18ON1230235781.0
TDEL0D035503.270ON780102781.1
TBLA0A064705.443ON1320107781.1
YFR010W (UBP6)1.369ON49942771.2
TPHA0E017105.443ON128327781.2
Smik_13.5215.18ON1231109771.3
CAGL0H05335g8.540ON48387771.4
Ecym_45145.443ON124640761.8
ZYRO0G01606g5.443ON130580761.8
Skud_13.4785.18ON1231108761.9
Suva_16.2408.540ON523105752.3
KAFR0C045201.369ON499105742.9
Kpol_251.73.270ON480128733.7
SAKL0B03036g8.97ON472116734.0
AFR551W8.742ON469110734.0
TPHA0H002108.165ON53467724.2
YDL122W (UBP1)2.307ON809187734.4
NCAS0B061302.307ON770288724.9
NDAI0C015505.443ON129550725.5
NCAS0A008802.6ON83367725.6
NDAI0E028208.540ON495195715.9
NDAI0B034302.307ON856125716.6
KLLA0E01013g8.202ON774144717.7
Suva_8.1765.443ON127041718.0
KAFR0D050705.443ON122732718.2
CAGL0I03718g7.322ON1201114709.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_11.362
         (721 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...  1339   0.0  
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...  1038   0.0  
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...  1016   0.0  
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   914   0.0  
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     483   e-156
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     474   e-153
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   465   e-150
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   459   e-148
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   426   e-143
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   430   e-137
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   429   e-137
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   421   e-133
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   410   e-129
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   412   e-126
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   350   e-108
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   337   e-106
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   298   5e-87
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   298   1e-86
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   295   2e-86
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   293   1e-85
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   290   2e-84
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   285   2e-82
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   283   3e-82
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   262   1e-74
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   259   4e-73
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   240   5e-69
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   134   8e-32
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   133   2e-31
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   132   3e-31
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   130   2e-30
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   129   4e-30
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   127   2e-29
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   127   2e-29
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...   126   4e-29
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...   124   1e-28
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...   123   2e-28
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   122   5e-28
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...   122   6e-28
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...   121   1e-27
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}             120   3e-27
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...   119   7e-27
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   115   8e-27
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188    117   3e-26
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   111   2e-24
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...   110   3e-24
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   105   1e-22
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   101   1e-21
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   102   1e-21
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...   101   2e-21
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    99   1e-20
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    97   5e-20
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...    96   7e-20
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    94   3e-19
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    75   4e-13
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    74   9e-13
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     72   4e-12
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    66   3e-10
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    65   4e-10
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    64   9e-10
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    64   1e-09
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    63   2e-09
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    63   3e-09
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    62   4e-09
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    62   5e-09
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    62   6e-09
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    61   7e-09
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    61   7e-09
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    61   7e-09
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    61   8e-09
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    60   2e-08
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    57   1e-07
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    57   2e-07
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    56   4e-07
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    55   6e-07
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    55   8e-07
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    53   2e-06
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    52   3e-06
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    52   3e-06
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    52   4e-06
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    51   1e-05
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    51   1e-05
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    50   1e-05
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    50   2e-05
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    50   2e-05
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    49   3e-05
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    49   4e-05
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    49   4e-05
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    49   5e-05
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    49   6e-05
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    48   8e-05
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    47   1e-04
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    47   1e-04
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    47   1e-04
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    47   1e-04
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    47   2e-04
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    46   2e-04
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    46   2e-04
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    46   3e-04
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    46   3e-04
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    46   3e-04
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       46   3e-04
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    46   3e-04
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    46   3e-04
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    46   4e-04
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    46   4e-04
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    46   4e-04
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    45   4e-04
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    45   5e-04
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    45   5e-04
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    45   6e-04
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    45   6e-04
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    45   6e-04
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    45   7e-04
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    45   8e-04
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    44   0.001
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    44   0.001
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    44   0.001
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    44   0.001
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    44   0.002
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    44   0.002
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    44   0.002
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    43   0.002
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    43   0.003
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    43   0.003
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    43   0.003
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    42   0.003
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    43   0.003
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    42   0.004
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    42   0.005
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    42   0.005
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    42   0.006
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    42   0.007
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    42   0.007
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    42   0.007
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    42   0.007
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    41   0.011
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    41   0.011
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    41   0.012
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    40   0.013
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    40   0.014
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    40   0.014
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    40   0.014
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    40   0.015
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    41   0.015
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    40   0.017
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    40   0.017
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    40   0.018
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    40   0.019
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    40   0.020
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    40   0.021
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    40   0.022
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    40   0.022
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    40   0.025
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    40   0.026
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    40   0.027
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    40   0.027
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    40   0.029
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      40   0.032
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    39   0.036
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    39   0.037
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    39   0.042
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    39   0.045
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    39   0.054
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    39   0.057
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    39   0.065
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    39   0.065
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    39   0.072
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    38   0.077
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    38   0.078
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    38   0.084
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    38   0.088
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    38   0.098
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    38   0.11 
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    38   0.11 
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    38   0.11 
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    38   0.11 
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    38   0.12 
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    38   0.13 
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    37   0.16 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    37   0.16 
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    37   0.17 
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    37   0.18 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    37   0.22 
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    36   0.27 
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    36   0.30 
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    36   0.30 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    36   0.33 
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    36   0.35 
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    36   0.41 
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    36   0.41 
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    36   0.42 
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    36   0.44 
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    36   0.45 
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    36   0.50 
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    35   0.53 
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    35   0.54 
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    35   0.58 
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    35   0.67 
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    35   0.67 
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    35   0.72 
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    35   0.98 
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    35   1.0  
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    35   1.0  
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    35   1.1  
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    35   1.1  
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    34   1.2  
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    35   1.2  
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    34   1.3  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    34   1.4  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    34   1.8  
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    34   1.8  
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    34   1.9  
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    33   2.3  
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    33   2.9  
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    33   3.7  
SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {...    33   4.0  
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    33   4.0  
TPHA0H00210 Chr8 (29532..31136) [1605 bp, 534 aa] {ON} Anc_8.165...    32   4.2  
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...    33   4.4  
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    32   4.9  
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    32   5.5  
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    32   5.6  
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    32   5.9  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     32   6.6  
KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some s...    32   7.7  
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    32   8.0  
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    32   8.2  
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    32   9.5  

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score = 1339 bits (3466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 660/721 (91%), Positives = 660/721 (91%)

Query: 1   MLLNPDQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALT 60
           MLLNPDQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALT
Sbjct: 1   MLLNPDQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALT 60

Query: 61  AFIIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRY 120
           AFIIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRY
Sbjct: 61  AFIIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRY 120

Query: 121 LSDSNRISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSAKSINDTSVKDI 180
           LSDSNRISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSAKSINDTSVKDI
Sbjct: 121 LSDSNRISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSAKSINDTSVKDI 180

Query: 181 PGERNQAHFSKKLGADSESTENTSKVFLSMPSYSKLNTGKDFLFKTLSSPATAPTVHSFE 240
           PGERNQAHFSKKLGADSESTENTSKVFLSMPSYSKLNTGKDFLFKTLSSPATAPTVHSFE
Sbjct: 181 PGERNQAHFSKKLGADSESTENTSKVFLSMPSYSKLNTGKDFLFKTLSSPATAPTVHSFE 240

Query: 241 VSSQVEDSTEDLSSISXXXXXXXXXXXXXXXXXXXXXTVRSSALNKLPTIEDSTSLLSQL 300
           VSSQVEDSTEDLSSIS                     TVRSSALNKLPTIEDSTSLLSQL
Sbjct: 241 VSSQVEDSTEDLSSISKVEKQKEEEEKEDIDKEREKKTVRSSALNKLPTIEDSTSLLSQL 300

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFK 360
           SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFK
Sbjct: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFK 360

Query: 361 KMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYP 420
           KMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYP
Sbjct: 361 KMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYP 420

Query: 421 DLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTF 480
           DLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTF
Sbjct: 421 DLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTF 480

Query: 481 YVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEX 540
           YVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINE 
Sbjct: 481 YVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINES 540

Query: 541 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPP 600
                                                  KKWNSRKLTTVKSSDFIVLPP
Sbjct: 541 TSQKKKSTFFSFHSRSRSKSPHHHHHHHHHSHDNTEKHSKKWNSRKLTTVKSSDFIVLPP 600

Query: 601 ILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDV 660
           ILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDV
Sbjct: 601 ILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDV 660

Query: 661 NKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYERMDESEYKEEC 720
           NKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYERMDESEYKEEC
Sbjct: 661 NKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYERMDESEYKEEC 720

Query: 721 F 721
           F
Sbjct: 721 F 721

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 1038 bits (2683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/723 (73%), Positives = 577/723 (79%), Gaps = 12/723 (1%)

Query: 1   MLLNPDQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALT 60
           MLLNPDQ++NLVR VYEVDIKQFYSQLRLKNLRGLLDHAAHLF VYLRD EINQEMEALT
Sbjct: 1   MLLNPDQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALT 60

Query: 61  AFIIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRY 120
           AFIIG YYLYL+IPQSLQFQTRNNLYSSYAKLKNDYQDE +M YVLK+V++ES +IVDRY
Sbjct: 61  AFIIGCYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRY 120

Query: 121 LSDSNRISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSAKSINDTSVKDI 180
           L++SN I RTI RKRAYSLPLRPLPVHMASLSI N+ +   HE P    K  ND S +DI
Sbjct: 121 LAESNGICRTIKRKRAYSLPLRPLPVHMASLSIHNKFDGSLHEIPNELTKPTNDNSKEDI 180

Query: 181 PGERNQAHFSKKLGADSESTENTSKVFLSMPSYSKLNTGKDFLFKTLSSPATAPTVHSFE 240
             E NQ   S KL A SE    TSK  LS PSY KL+TGKD LFKTLSSPATAP VHS E
Sbjct: 181 VRESNQIASSNKLEAGSEVAYYTSKEALSKPSYLKLSTGKDALFKTLSSPATAPPVHSLE 240

Query: 241 VSSQVEDSTEDLSSISXXXXXXXXXXXXXXXXXXXXXTVRSSALNK--LPTIEDSTSLLS 298
           VSSQ+ DS++D SS                        + SSA     LP IEDS  LLS
Sbjct: 241 VSSQIRDSSQDSSSSLSKVEKPKEEEGKIE-------AIESSAPKAYNLPVIEDSNDLLS 293

Query: 299 QLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVL 358
           +LSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFL T+KYP+EVQLSRSIYVL
Sbjct: 294 ELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVL 353

Query: 359 FKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEY 418
           FKKMYLNGG AI PN FLKMCKKLRPDLNIPDDQQDTQEFLLI+LAR+HEELSN  V +Y
Sbjct: 354 FKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQEFLLIVLARIHEELSNENVVKY 413

Query: 419 YPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYS 478
           YPDLVSYDANA QVNPSKY+KWYE +V+TDGLSPID+I+RGQ+ENILKCQRCGNSS+SYS
Sbjct: 414 YPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDHIYRGQLENILKCQRCGNSSYSYS 473

Query: 479 TFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKIN 538
           TFYVLSLAIPK+SLYSFTSKS+KIKLEDCINLFT DEELSGDN+WDCPNC  TD K+K  
Sbjct: 474 TFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDEELSGDNAWDCPNCRITDSKSK-K 532

Query: 539 EXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVL 598
           E                                        KK NS+KLTT+KS DFIVL
Sbjct: 533 EEITSQKKKSTIFGFHSRSRSKSPHHHHHHHHSSDDSTKNAKKRNSKKLTTIKSLDFIVL 592

Query: 599 PPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTS 658
           PPILVIHLSRFYYDLT+KN+TVITYPLILN+ILKN KV+RYKLYGTVNH GNL+NGHYTS
Sbjct: 593 PPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIRYKLYGTVNHSGNLINGHYTS 652

Query: 659 DVNKEKNHEIGLNRQVWITFDDDYIKQHHHD--DFEAGKTEVSSSEVYVLFYERMDESEY 716
            VNKEK+HEIGLNRQVW+TFDDDYI+QH  D  +FEAGKTE+SS EVYVLFYERMDE  Y
Sbjct: 653 VVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTEMSSDEVYVLFYERMDEENY 712

Query: 717 KEE 719
           +EE
Sbjct: 713 EEE 715

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/722 (70%), Positives = 570/722 (78%), Gaps = 13/722 (1%)

Query: 1   MLLNPDQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALT 60
           MLLNPDQ++NLVR+VYEVDIKQFYSQLRLKNLRGL+DH +HLF+VYLRD EIN+E+EALT
Sbjct: 1   MLLNPDQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALT 60

Query: 61  AFIIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRY 120
           AFIIGGYYLYL+IPQSLQFQTR+NLYSSYAKLKN YQDEQ+MSYVL++V++ES  IVD+Y
Sbjct: 61  AFIIGGYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQY 120

Query: 121 LSDSNRISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSAKSINDTSVKDI 180
           LSDSNRI+ TITRKRAYSLPLRPLPVHMASLSI NQ ++P  E P   AK INDTS KD+
Sbjct: 121 LSDSNRITVTITRKRAYSLPLRPLPVHMASLSIHNQSDDPPREMPNYLAKPINDTSGKDL 180

Query: 181 PGERNQAHFSKKLGADSESTENTSKVFLSMPSYSKLNTGKDFLFKTLSSPATAPTVHSFE 240
             E N+     K    +E  ++TS+  LS+PSYSKLNTGKD LFKT SSPA A T HS +
Sbjct: 181 RRENNEIRLCSKHDVSAEDIDSTSRESLSIPSYSKLNTGKDTLFKTHSSPAAASTAHSCD 240

Query: 241 VSSQVEDSTEDLSSISXXXXXXXXXXXXXXXXXXXXXTVRSSALNKLPTIEDSTSLLSQL 300
            SSQ   S++D SS S                         S   + PTIEDS  LLS+L
Sbjct: 241 TSSQAAVSSQDSSSQSKKAKQKEEAASSFI-----------SETFEPPTIEDSKGLLSKL 289

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFK 360
           SITGLQNPCNTCYINSIIQCLFG+T FRDLFLTKKYRLFL+T++YP+EVQLSRSIY LFK
Sbjct: 290 SITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKKYRLFLKTEEYPKEVQLSRSIYSLFK 349

Query: 361 KMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYP 420
           KMY NGG AI PNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILAR+HEELSN  VT+YY 
Sbjct: 350 KMYANGGSAIVPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARIHEELSNENVTKYYC 409

Query: 421 DLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTF 480
           DLVSYD NA QVNP KYQKWYE ++L DGLSPID+IFRGQMENILKCQRCGNSS SYSTF
Sbjct: 410 DLVSYDTNALQVNPIKYQKWYEETILADGLSPIDHIFRGQMENILKCQRCGNSSFSYSTF 469

Query: 481 YVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEX 540
           YVLSLAIPK S++SFTSKSKKIKLEDCINLFTSDEEL+GDN+WDCP C   D K K  E 
Sbjct: 470 YVLSLAIPKNSVHSFTSKSKKIKLEDCINLFTSDEELTGDNAWDCPECRIDDSKLKTGEN 529

Query: 541 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPP 600
                                                   KW S++LTT+KS DFI LPP
Sbjct: 530 SSQKKRSPLFSFHSRSRSKSPHHHHHYHHHGSDNTTKNSNKWKSKRLTTIKSLDFIFLPP 589

Query: 601 ILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDV 660
           ILVIHLSRFYYDLT+KNN VITYPLILN+ILKNNKVVRYKLYGTVNH GNL+ GHYTS V
Sbjct: 590 ILVIHLSRFYYDLTKKNNAVITYPLILNIILKNNKVVRYKLYGTVNHSGNLITGHYTSVV 649

Query: 661 NKEKNHEIGLNRQVWITFDDDYIKQHH--HDDFEAGKTEVSSSEVYVLFYERMDESEYKE 718
           NKE++HEIGLN+QVW+TFDDD+I QHH   D FEAGKT++SSSEVYVLFYERMDE +YKE
Sbjct: 650 NKERSHEIGLNKQVWVTFDDDFIIQHHKDRDGFEAGKTKMSSSEVYVLFYERMDEEDYKE 709

Query: 719 EC 720
           +C
Sbjct: 710 DC 711

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/721 (66%), Positives = 553/721 (76%), Gaps = 23/721 (3%)

Query: 1   MLLNPDQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALT 60
           M LNP+Q+++LVR VY+VDIK  YSQLRLK L+ LL+HAA+LF+VY+RD + NQ+  ALT
Sbjct: 1   MFLNPNQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALT 60

Query: 61  AFIIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRY 120
           AFI+GG+YLYLVIP SLQFQTRNN+YSSYAKLKN YQDEQ MSYVLK+VK+ES +IVD+ 
Sbjct: 61  AFIVGGFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQC 120

Query: 121 LSDSNRISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSAKSINDTSVKDI 180
           LSDS RISR++ RKRAYSLPLRPLPVHMASLSI NQL+ P  E P   +K INDT VK +
Sbjct: 121 LSDSKRISRSMKRKRAYSLPLRPLPVHMASLSIHNQLDVPLREMPIEISKPINDTLVKGL 180

Query: 181 PGERNQAHFSKKL--GADSESTENTSKVFLSMPSYSKLNTGKDFLFKTLSSPATAP-TVH 237
             E N+  FS +L  G D+E  ++TS   LS+PSY +L+TGKD LFKTLSSPA A  T  
Sbjct: 181 AKEENELKFSNELEEGTDTEGRDSTSTEPLSIPSYLRLDTGKDSLFKTLSSPAAAASTRD 240

Query: 238 SFEVSSQVEDSTEDLSSISXXXXXXXXXXXXXXXXXXXXXTVRSSALNKLPTIEDSTSLL 297
           S +V  Q E+ ++D SSI                      +  +S   KLP IE+S +LL
Sbjct: 241 SLDVLLQFEEPSQDSSSI----------LKSKEQEEEETVSASTSKTFKLPVIENSDNLL 290

Query: 298 SQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYV 357
           S+LSITGL+NPCNTCYINS++QCLF TTLFRDLFLTKKY+LFL+ +KYP+ +QLS SIYV
Sbjct: 291 SELSITGLRNPCNTCYINSMVQCLFSTTLFRDLFLTKKYKLFLENEKYPKGLQLSHSIYV 350

Query: 358 LFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTE 417
           LFKKMYLNGG AI PNGFLK+CKKLRPDLNIPDDQQDTQEFL+IILAR+HEELSN  VT+
Sbjct: 351 LFKKMYLNGGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMIILARIHEELSNNNVTK 410

Query: 418 YYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSY 477
           YY DL+  DA A QVNPSKYQKW E +VL+DGLSPID+IF+GQMENILKCQRCGNSS+SY
Sbjct: 411 YYSDLILNDATALQVNPSKYQKWCEETVLSDGLSPIDHIFQGQMENILKCQRCGNSSYSY 470

Query: 478 STFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTT------ 531
           STFYVLSLAIPK SLYSFTSKSKKIKLEDCIN FTSDEELS DN+WDCP C T       
Sbjct: 471 STFYVLSLAIPKASLYSFTSKSKKIKLEDCINFFTSDEELSDDNAWDCPKCRTAEYKLKK 530

Query: 532 --DLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTT 589
             +L  K                                           KKW S+KLTT
Sbjct: 531 DENLSQKKRSILFNLHSRPRSKSPRHRHHHHHHRHKNDDAKKNDDATKNSKKWKSKKLTT 590

Query: 590 VKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIG 649
           +KS DFIVLPPILVIHLSRFYYDLT+KNNTVITYPLILN+ILKNNKVVRYKLY TVNH G
Sbjct: 591 IKSLDFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNKVVRYKLYATVNHSG 650

Query: 650 NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHH--HDDFEAGKTEVSSSEVYVLF 707
           NL+NGHYTS VNKEK+HEIGLNRQVW+TFDDD IKQHH   DDFE G+TE+SS+EVYVLF
Sbjct: 651 NLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDVIKQHHKDRDDFETGRTEISSNEVYVLF 710

Query: 708 Y 708
           Y
Sbjct: 711 Y 711

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  483 bits (1242), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 240/445 (53%), Positives = 307/445 (68%), Gaps = 19/445 (4%)

Query: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
            +PTIE S +L   LSITGL+N  NTCYINS++QCLF T LFRDLF++ K++ F+   K+P
Sbjct: 662  IPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFINDSKFP 721

Query: 347  REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
               ++S S  +LFKKMYLNGG ++ P  FLK C  LRPDL IPDDQQDTQEFL+IIL RL
Sbjct: 722  NTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLMIILDRL 781

Query: 407  HEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
            H+ELSN   V   YP+L+ YD N  +V   +Y+ W++ +V+ +GLSPID+IF GQMEN L
Sbjct: 782  HDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSGQMENSL 841

Query: 466  KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
            +CQRCGNSS++YSTFYVLSLAIPK S  +F S+SK++KLE+CIN+FTSDE LSG+N+WDC
Sbjct: 842  QCQRCGNSSYNYSTFYVLSLAIPKPSSTTF-SRSKRVKLEECINMFTSDEVLSGENAWDC 900

Query: 526  PNCG----------------TTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 569
            P CG                T+  K  ++                               
Sbjct: 901  PKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSISPFRKKTS 960

Query: 570  XXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV 629
                      + W S+KL T+K+ +FIVLPPILVIHLSRFYYDLT+KNNTVITYPLILN+
Sbjct: 961  PAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNI 1020

Query: 630  ILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIK-QHHH 688
            +LKNN+V +Y+LYG VNH GNL++GHYTS VNKE NH++G  +Q W  FDD+ +K + +H
Sbjct: 1021 VLKNNEVAKYRLYGIVNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNH 1080

Query: 689  DDFEAGKTEVSSSEVYVLFYERMDE 713
             D + G  +VSS +VYVLFYER+ E
Sbjct: 1081 GDMDKGILQVSSRDVYVLFYERIYE 1105

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 102/158 (64%), Gaps = 7/158 (4%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEM-EALTAFII 64
           ++++  V+++Y  DIK +Y QL+L+ L  LL+H  +L E++   ++ N    + LTAFI+
Sbjct: 15  NELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKDVLTAFIV 74

Query: 65  GGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDS 124
           G YYL+L+IPQS+QFQ++N  Y  Y +LK  Y++E  M+ VL +VK+E   ++D  + ++
Sbjct: 75  GCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVLD--MDEN 132

Query: 125 NRIS----RTITRKRAYSLPLRPLPVHMASLSILNQLE 158
           N  S    R I R+RAYS+ +  L   + SLSI N ++
Sbjct: 133 NNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSID 170

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  474 bits (1219), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 241/440 (54%), Positives = 302/440 (68%), Gaps = 14/440 (3%)

Query: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
            +PTIE S +L   LSITGL+N  NTCYINS++QCLF T  FRDLFLT KY  FL   K+P
Sbjct: 592  IPTIERSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRRFRDLFLTSKYSSFLNGSKFP 651

Query: 347  REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
                +S S  +LFKKMYLNGG ++ P  FLK C  LRPDL IPDDQQDTQEFL+IIL RL
Sbjct: 652  NSPMISNSFNLLFKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMIILDRL 711

Query: 407  HEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
            H+ELSN   V   YP L+ YD N  +V   +Y+ W+E SV+ +GLSPID IF+GQ+EN L
Sbjct: 712  HDELSNQQEVVNEYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDEIFQGQIENGL 771

Query: 466  KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
            +CQRCG+SS +YSTFYVLSLAIPK S   F S+SK++KLEDCIN+FT+DE LSG+N+WDC
Sbjct: 772  QCQRCGHSSFNYSTFYVLSLAIPKPSPTGF-SRSKRVKLEDCINMFTNDEMLSGENAWDC 830

Query: 526  PNCGT---------TD--LKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 574
            PNCG+         TD  +K K                                      
Sbjct: 831  PNCGSNAQDRVRVNTDQSVKKKRQGEEHRHKSRFFGLPTRPHRSLSPFRKSGSSSTNSTS 890

Query: 575  XXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNN 634
                 ++W ++KL T+K+ +FI+LPP+LVIHLSRF+YDLT+KN TVITYPLILN++LKNN
Sbjct: 891  KIKHEQQWKTKKLITIKTLNFIMLPPVLVIHLSRFFYDLTKKNKTVITYPLILNIVLKNN 950

Query: 635  KVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIK-QHHHDDFEA 693
            +V +YKLYG VNH GNL++GHYTS VNKE  H +  N+Q W  FDD+ +K + +H D + 
Sbjct: 951  EVAKYKLYGIVNHTGNLISGHYTSLVNKEPGHNLNHNQQRWYYFDDEVVKAEGNHGDIDN 1010

Query: 694  GKTEVSSSEVYVLFYERMDE 713
            G ++VSS +VYVLFYER+ E
Sbjct: 1011 GISKVSSKDVYVLFYERLYE 1030

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 92/136 (67%), Gaps = 1/136 (0%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65
           ++++  +++VY+ DIK +Y QL+L+ L  LL+H  +LFE++L         +ALT+FI+G
Sbjct: 16  NELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDALTSFIVG 75

Query: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLS-DS 124
            YYL+L++PQS+QFQ+RN  Y  Y+ LK  Y+++  M+ VL +VK+E   I+++    + 
Sbjct: 76  CYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILEKTAEREI 135

Query: 125 NRISRTITRKRAYSLP 140
           N  +  I R+RAYS+P
Sbjct: 136 NETNNRIVRQRAYSVP 151

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  465 bits (1196), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 231/436 (52%), Positives = 304/436 (69%), Gaps = 12/436 (2%)

Query: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
            +PTIE S++    LSITGL+N  NTCYINS++QCLF TT FRDLF++ K+  F   + Y 
Sbjct: 592  IPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEFFNQN-YS 650

Query: 347  REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
               QLS+S  +LF+KMY+NGG ++ P  FLK+   LRPDL IPDDQQDTQEFL++ L RL
Sbjct: 651  NRPQLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQDTQEFLMVTLDRL 710

Query: 407  HEELSN-GTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
            H+ELSN   V   YPDL+ YD +   VN  +Y+KW+E SV+ +GL+PID+IF+GQ+ENIL
Sbjct: 711  HDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPIDHIFQGQIENIL 770

Query: 466  KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
            +CQRCGNSS SYSTFYVLSLAIPK S  +F S++K++KLEDCIN+FT+DE LSG+N+WDC
Sbjct: 771  ECQRCGNSSFSYSTFYVLSLAIPKPSTSTF-SRAKRVKLEDCINMFTNDEILSGENAWDC 829

Query: 526  PNCGT--TDL------KTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 577
            P CG+  TD+      K+K  +                                      
Sbjct: 830  PKCGSAVTDMGPNHLKKSKKKKKSELGEERRSKSGFFRIHSKSKRSKSPFRMLGSTKFPL 889

Query: 578  XXKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVV 637
              + W S++L+T K+ +FI LPP+L+IHLSRFYYDLT+KN+T++TYPL+LN+ILKNN+  
Sbjct: 890  AMEDWKSKELSTKKTLNFIFLPPVLIIHLSRFYYDLTKKNDTIVTYPLVLNIILKNNETA 949

Query: 638  RYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQH-HHDDFEAGKT 696
            RY+LY  VNH GNL++GHYTS VNKE  H++   RQ W  FDD+ +K+   H + + G  
Sbjct: 950  RYRLYAVVNHTGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDDEVVKEETKHGNIDQGIL 1009

Query: 697  EVSSSEVYVLFYERMD 712
            +VSSS+VYVLFYER+D
Sbjct: 1010 KVSSSDVYVLFYERLD 1025

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/155 (42%), Positives = 98/155 (63%), Gaps = 2/155 (1%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65
           ++++  V+N+YE DIK +++Q +L+ L  LL+H  +LFE YL+        +ALTAFIIG
Sbjct: 14  NELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNNQDALTAFIIG 73

Query: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125
            YYLYL++PQS++FQTRN  YS +  L   YQ++  M+ VL +VK+E + I+DR   +  
Sbjct: 74  CYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDSILDRNAREFK 133

Query: 126 RISRTITRKRAYSLPLRPLPVHMASLSILNQLENP 160
                  R RAYS+P R     + +L+I N  ENP
Sbjct: 134 EFEHQKARTRAYSVPDRNFESRLTNLNIHN--ENP 166

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
            {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  459 bits (1180), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 302/441 (68%), Gaps = 18/441 (4%)

Query: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
            +PTIE S+++   LSITGL+N  +TCYINS++QCLF T  FRD+FL+ KY  ++ +  Y 
Sbjct: 597  VPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLFATRKFRDIFLSPKYHDYI-SKGYI 655

Query: 347  REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
               Q+SRS ++LFKKMY+NGG ++ P+GFLK C  +RPD  IP+DQQDTQEFLL +L +L
Sbjct: 656  HRAQISRSFHMLFKKMYMNGGCSVVPSGFLKACNSMRPDFKIPNDQQDTQEFLLFLLDQL 715

Query: 407  HEELSNG-TVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
            H+ELS+   V   YP L+ +D +  QV+  +Y KW+E S+  +GLSPID IF+GQMEN L
Sbjct: 716  HDELSDPEQVANDYPQLLLHDDDNLQVDGKEYDKWFEDSISKNGLSPIDSIFQGQMENCL 775

Query: 466  KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
            +CQRCG+SS++YSTFYVLSLAIP     +F  K+KK+ LEDCINLFTSDE LSG+N+WDC
Sbjct: 776  QCQRCGHSSYNYSTFYVLSLAIPTPGTSTF-GKTKKVLLEDCINLFTSDEVLSGENAWDC 834

Query: 526  PNC-----------GTTDLKTKI---NEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 571
            P C           G    K K    ++                                
Sbjct: 835  PRCGTSMSGSGPGEGKAKKKRKFLLPHDHVNNNRTSRFFKFRSKSRSRSSSPFNSSNGHN 894

Query: 572  XXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVIL 631
                    +KW S+KLTT+K+ +FI +PPILVIHLSRF+YDLT+KN+TVITYPLILN++L
Sbjct: 895  SGSSMPGSEKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVL 954

Query: 632  KNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ-HHHDD 690
            KNN+V +Y+LYG VNH GNL++GHYTS VNK+  HEI   +Q W  FDD+ +KQ ++H D
Sbjct: 955  KNNEVAKYRLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGD 1014

Query: 691  FEAGKTEVSSSEVYVLFYERM 711
            F+AG   VSSS+VYVLFYER+
Sbjct: 1015 FDAGIASVSSSDVYVLFYERI 1035

 Score =  119 bits (297), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 110/176 (62%), Gaps = 9/176 (5%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVY-LRDSEINQEMEALTAFII 64
           ++++  V++VY  DIK +Y +L+L+ L  LL+HA +LFE Y +   + NQE +ALTAFII
Sbjct: 11  NELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQE-DALTAFII 69

Query: 65  GGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDS 124
           G +Y+YL+IPQS+QF TRN  Y  Y  L+  YQDE  M+ VL +V ++    VD  L  S
Sbjct: 70  GSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKK----VDAILCKS 125

Query: 125 NRISRT-ITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSAKSINDTSVKD 179
                T ITRKRAYS+P + L   + SL++ N   +   + P+VS +S   T+  D
Sbjct: 126 RDFDDTKITRKRAYSVPSQALANQLRSLTLNN--TDGLEQLPEVSKESDTLTNYAD 179

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa]
           {ON} complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  426 bits (1095), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 211/403 (52%), Positives = 278/403 (68%), Gaps = 10/403 (2%)

Query: 317 IIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFL 376
           ++QCLFGT L RDLF++ KY  +L + +  R   LSRS  +LFKKMYLNGG ++ P  FL
Sbjct: 1   MVQCLFGTKLLRDLFISSKYEKYL-SKRIDRSSNLSRSFSILFKKMYLNGGCSVVPTSFL 59

Query: 377 KMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNG-TVTEYYPDLVSYDANAFQVNPS 435
           K C +LRPDL IPDDQQDTQEFL+++L RLH+ELSN  TV   YPDLV YD    +VN  
Sbjct: 60  KTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVNNK 119

Query: 436 KYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSF 495
           +Y KW++ ++  +GLSPID+IF+GQ+EN L CQRCG  S++YSTFYVLSLAIPK S  +F
Sbjct: 120 EYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGTF 179

Query: 496 TSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDL------KTKINEXXXXXXXXXX 549
            S+SK++KLEDCIN+FT+DE LSG+N+WDC NCG++ +      K K             
Sbjct: 180 -SRSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVHNVEQRKDKTTGNGEEKKRSRK 238

Query: 550 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRF 609
                                         +K   +KL T+KS +FI LPP LVIHLSRF
Sbjct: 239 SRLFLLPNINGRSSRSISPFRKSASPRPPHEKLKHKKLVTIKSMNFISLPPTLVIHLSRF 298

Query: 610 YYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIG 669
           YYDL++KN T++TYPLILN++L NN+  +Y+LYG VNH GNL++GHYT+ VNKEKNHE+ 
Sbjct: 299 YYDLSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGNLISGHYTTLVNKEKNHELK 358

Query: 670 LNRQVWITFDDDYIK-QHHHDDFEAGKTEVSSSEVYVLFYERM 711
            ++Q W  FDD+ +K +++H + + G  +VSSS+VYVLFYER+
Sbjct: 359 KDKQKWYYFDDEVVKEENNHGNIDEGVIKVSSSQVYVLFYERV 401

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  430 bits (1106), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 220/438 (50%), Positives = 290/438 (66%), Gaps = 12/438 (2%)

Query: 283 ALNKLPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQT 342
           A   +PTIE S++    LSITGL+N  NTCYINS++QCLF T  FRDLFL+ KY  +  +
Sbjct: 536 AEGTIPTIEQSSNEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYF-S 594

Query: 343 DKYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLII 402
            +Y    QLS+   +LFKKMY+NGG ++ P GFLK C  LRPDL IP +QQDTQEFLL +
Sbjct: 595 KRYSNPHQLSKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQEFLLFL 654

Query: 403 LARLHEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQM 461
           L++LH+ELS    V   YP+L+ +D  +  V+  +Y KW+E ++  +G+SPID IF+GQM
Sbjct: 655 LSQLHDELSESNHVANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISPIDAIFQGQM 714

Query: 462 ENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDN 521
           EN L CQRCG+SS++YS FYVLSLAIP  S+ SF  K KK++LEDCINLFTSDE+L+ +N
Sbjct: 715 ENGLLCQRCGHSSYNYSMFYVLSLAIPA-SMSSFGQK-KKMRLEDCINLFTSDEKLTNEN 772

Query: 522 SWDCPNCGTT-------DLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 574
           +WDCP CG+          K K                                      
Sbjct: 773 AWDCPKCGSAVSGNGPDGDKKKRKFLSTSDNSNGRSRSRFFKLRSKSRSRSVSPFHKPSS 832

Query: 575 XXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNN 634
                +KW S+KL+T+K+ +F+ LP +L IHLSRF YDLT KNN VITYPL L+++LKNN
Sbjct: 833 QSPASEKWKSKKLSTIKTLNFVSLPSVLTIHLSRFLYDLTNKNNKVITYPLTLSIVLKNN 892

Query: 635 KVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQH-HHDDFEA 693
           +VV Y+LY   NH GNL++GHYTS VNK+ +H++G  RQ W  FDD+  K+  +H + +A
Sbjct: 893 EVVNYRLYAIANHFGNLISGHYTSLVNKDLSHDLGNGRQKWYYFDDEVAKRDLNHGNIDA 952

Query: 694 GKTEVSSSEVYVLFYERM 711
           G T VSSS+VYVLFYE++
Sbjct: 953 GITSVSSSDVYVLFYEKI 970

 Score =  116 bits (291), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 105/190 (55%), Gaps = 7/190 (3%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65
           ++++  V+ VY  DI  +Y +LRL+ L  LL+HA +LFE Y R  E  Q  E LTAF++G
Sbjct: 11  NELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNSELLTAFVVG 70

Query: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125
            +Y+YL+IP S+QF +R+  Y+ YA L+  YQDE  M+ VL +V       V   +S   
Sbjct: 71  CFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTG-----VIESVSRDE 125

Query: 126 RISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSAKSINDTSVKDIPGERN 185
             S  I RKRAYS+P + L   M +L++  +  +  +  P+   +  ND+++   P    
Sbjct: 126 LESAKIMRKRAYSVPHKKLSDKMQALTLSPETASSTNAGPETDNE--NDSTMWTAPELEP 183

Query: 186 QAHFSKKLGA 195
             H    LG 
Sbjct: 184 NDHLKVNLGG 193

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score =  429 bits (1103), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 218/438 (49%), Positives = 287/438 (65%), Gaps = 12/438 (2%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
           +PTIE S +    LSITGL+N   TCY+NS++QCLF T  FRDLFL+ KY  +  + KY 
Sbjct: 540 IPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYF-SRKYT 598

Query: 347 REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
              QLS+   VLFKKMY+NGG ++ P GFLK C  LRPD  IP DQQDTQEFLL +L++L
Sbjct: 599 NPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQL 658

Query: 407 HEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
           H+ELS    V   YP L+ +D     V+  +Y  W+E  +  +G+SPID IF+GQMEN L
Sbjct: 659 HDELSESNRVANDYPGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQMENGL 718

Query: 466 KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
            CQRCG+SS +YS FYVLSLAIP  S  S  S+ KK++LEDCINLFTSDE+L+ +N+WDC
Sbjct: 719 FCQRCGHSSFNYSVFYVLSLAIP--SSTSTFSQRKKVRLEDCINLFTSDEQLTNENAWDC 776

Query: 526 PNCGTTDLKTKINEXXXXX-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 578
           P CGT+   T   E                                              
Sbjct: 777 PKCGTSASGTGPEEEKKKKRFLLNPDTRASGNRSRFFKLRSKSRSRSVSPFRKQSSQQQN 836

Query: 579 XKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVR 638
            +K  S+KLTT+K+ +FI LP +L IHLSRF+YDLT+KNN VITYPLIL+++LKN ++++
Sbjct: 837 LEKLKSKKLTTIKTLNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQIMK 896

Query: 639 YKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQH-HHDDFEAGKTE 697
           Y+LY   NH GNL++GHYTS VNK+ +H++   +Q W  FDD+ +K+  +H D +AG T 
Sbjct: 897 YRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAGITS 956

Query: 698 VSSSEVYVLFYERMDESE 715
           +SSS+VYVLFYE++DES+
Sbjct: 957 ISSSDVYVLFYEKIDESQ 974

 Score =  115 bits (289), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 93/150 (62%), Gaps = 5/150 (3%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65
           ++++  V++VY  DI  ++ +LRL+ L  LL+HA +LFE Y      NQ  + LTAF+ G
Sbjct: 11  NELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLLTAFVAG 70

Query: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125
            +Y+YL+IP S+QFQ+R+  Y+ YA LK  YQDE  M+ VL +V E    +++    D  
Sbjct: 71  CFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTE----VIESMSKDEV 126

Query: 126 RISRTITRKRAYSLPLRPLPVHMASLSILN 155
             +R I RKRAYS+P    PV + +LS  N
Sbjct: 127 ETAR-IMRKRAYSVPYGKSPVTIQALSKAN 155

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  421 bits (1081), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 221/440 (50%), Positives = 285/440 (64%), Gaps = 17/440 (3%)

Query: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
            +PTIE S +    LSITGL+N  NTCYINS++QCLFG + FRDLFL  KY  +L   +  
Sbjct: 572  IPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRYLNPKR-- 629

Query: 347  REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
                +S+   +LF+KMYLNGG ++ PNGFLK C  LRPD +IP DQQDTQEFLL +L  L
Sbjct: 630  SNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFLLFLLDTL 689

Query: 407  HEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
            H+ELS  T V   YP+L+ +D     V+  +Y KW++  +  +GLSPID IF+GQMEN L
Sbjct: 690  HDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDIFQGQMENSL 749

Query: 466  KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKK-IKLEDCINLFTSDEELSGDNSWD 524
            KCQRCG +S++YSTFYVLSLAIP +      S+SKK I+LEDCINL+T DE L+G+N+WD
Sbjct: 750  KCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQDELLTGENAWD 809

Query: 525  CPNCGTTDLKT--KINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKW 582
            CP CGT    +   +N                                          K 
Sbjct: 810  CPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHKSRSKFFKLSSSRSGKRSLSPFKS 869

Query: 583  NSRK----------LTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILK 632
            NS K          +TT+K+ +FI +P ILVIHLSRF+YDLT+KN T+I YPLIL+V+LK
Sbjct: 870  NSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINYPLILDVVLK 929

Query: 633  NNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQH-HHDDF 691
            NN++ RY+LYG +NH GNLV+GHYTS VNK  +HEI   +Q W  FDD+ +K+  +H DF
Sbjct: 930  NNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVVKKEFNHGDF 989

Query: 692  EAGKTEVSSSEVYVLFYERM 711
            + G T +SS +VYVLFYER+
Sbjct: 990  DRGITSISSGDVYVLFYERI 1009

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 83/134 (61%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65
           D++++ V+ VY  D+K +Y++L+L+ L  LL+ A  LFE Y     + +  + L  ++IG
Sbjct: 11  DELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKYEDCLCEYVIG 70

Query: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125
            +Y++L+IP S+QF  RN  YS Y+ LK  YQDE  MS VL +V  + + ++++ +    
Sbjct: 71  SFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQNMEILA 130

Query: 126 RISRTITRKRAYSL 139
           +     +RKRA+S+
Sbjct: 131 KQHLDPSRKRAFSV 144

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1045

 Score =  410 bits (1055), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 292/439 (66%), Gaps = 15/439 (3%)

Query: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
            +PTIE + +    LSITGL+N  NTCYI+S++QCLF TT  RDLF+T KY  ++   K  
Sbjct: 609  VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYI-NHKVT 667

Query: 347  REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
             ++ LSRS  +LF+KMYLNGG ++ P  FLK C +LRPDL IPDDQQDTQEFL+++L RL
Sbjct: 668  DKINLSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLMLVLDRL 727

Query: 407  HEELSN-GTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
            H+ELS   TV   Y +L+ YDA    V   +Y+KW+E S L+ G+SPID IF+GQ+EN +
Sbjct: 728  HDELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQGQIENSI 787

Query: 466  KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWD- 524
             CQRCG SS +YS+FYVLSLAIPKIS+ SF S++ ++KLEDCIN+FT DE LSG+N+WD 
Sbjct: 788  NCQRCGYSSFNYSSFYVLSLAIPKISVMSF-SRTNRVKLEDCINMFTRDEVLSGENAWDC 846

Query: 525  --CPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXX-------XXXXXXXXXXXXXXX 575
              C +     +KT  N+                                           
Sbjct: 847  SRCGSQSDNFVKTSHNDHHKEHTSETTDDSKQNRKSRLFLLPKKYNPTSRSLSPFGRHSS 906

Query: 576  XXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNK 635
                +KW S+K+ T+KS +FI +P ILVIHLSRF+YD+++KN TV+ YPLILN++LKN +
Sbjct: 907  HKSSEKWKSKKMETIKSLNFIKMPKILVIHLSRFFYDMSKKNETVVAYPLILNIVLKNEE 966

Query: 636  VVRYKLYGTVNHIGNLV-NGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQH-HHDDFEA 693
            V +Y+LY  VNH+GN V +GHYT+ VNK +NH++G N Q W  FDD+ +K   +H + + 
Sbjct: 967  VCKYRLYAIVNHMGNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDEVVKHELNHGNIDE 1026

Query: 694  GKTEVSSSEVYVLFYERMD 712
            G  +VSSS VYVLFYE++D
Sbjct: 1027 GVNKVSSSHVYVLFYEKID 1045

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 81/135 (60%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65
           ++++  V + Y  +IK  + QLRL  L  +L+H A+L E YL      +  E L+A+I+G
Sbjct: 13  NELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDECLSAYIVG 72

Query: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125
            +YLYL+IP S QFQ RN  +  Y +LK  YQ++  M+ VL IVK E + I+D  + +  
Sbjct: 73  CFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSILDESILELE 132

Query: 126 RISRTITRKRAYSLP 140
            I + I R RAYS P
Sbjct: 133 GIEKVIKRDRAYSSP 147

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  412 bits (1058), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 215/433 (49%), Positives = 283/433 (65%), Gaps = 14/433 (3%)

Query: 287  LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
            +PTIE+S +    LSITGL+N  NTCYINS++QCLF T+ FR+LFL+ KY  +L   K P
Sbjct: 1089 IPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYL---KSP 1145

Query: 347  REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
                +SRS Y+LF+KMY+NGG ++ P+GFLKMC  L+PDL IP  QQDTQEFLL +L +L
Sbjct: 1146 EMDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFLLFLLDKL 1205

Query: 407  HEELSN-GTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
            H+ELS+  +V+  Y  L+ +D     V+ ++Y KW++ ++  +GLSPID +F+GQMEN L
Sbjct: 1206 HDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQGQMENQL 1265

Query: 466  KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
             CQRCG SS++YSTFYVLSLA+P     +F  K+KK++LEDCIN FT DE LS  N+WDC
Sbjct: 1266 SCQRCGYSSYTYSTFYVLSLALPNPVAKAF-GKTKKLRLEDCINFFTCDEVLSDQNAWDC 1324

Query: 526  PNCGTT------DLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 579
            P C +       D K K                                           
Sbjct: 1325 PRCCSPSDYMSYDHKGK--RKISTSFESLNGGNSSRSKLFKFGYKMRSRSEAPKFSSKLS 1382

Query: 580  KKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRY 639
             K ++ K  TVKS +FI +P ILVIHLSRF YDLT+KNN V++YPLILN++LKN++V ++
Sbjct: 1383 DKVSNGKPATVKSLNFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKF 1442

Query: 640  KLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIK-QHHHDDFEAGKTEV 698
            +LY  VNH G L++GHYTS VNKE NHEI   +Q W  FDD+ +K   +H D++ G   V
Sbjct: 1443 RLYSIVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASV 1502

Query: 699  SSSEVYVLFYERM 711
            SSS VYVLFYER+
Sbjct: 1503 SSSNVYVLFYERI 1515

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 75/132 (56%), Gaps = 3/132 (2%)

Query: 11  LVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIGGYYLY 70
            V  VY  +++  Y +LRL+ L  LL+H A+L E Y       Q    +TA+++G +YLY
Sbjct: 16  FVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGITAYVVGAFYLY 75

Query: 71  LVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLS---DSNRI 127
           L+IPQS++F TRN  YS Y  LK  Y+ +  M  V+ +V  +   ++  YLS   D    
Sbjct: 76  LIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQLYLSGEGDEKYG 135

Query: 128 SRTITRKRAYSL 139
           +R   RKRAYS+
Sbjct: 136 ARFTGRKRAYSM 147

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score =  350 bits (898), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/436 (44%), Positives = 266/436 (61%), Gaps = 28/436 (6%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
           LP +  S++L  QLSI+GL+N  NTCYINS++QCLF TT FR+LFL+ +Y+ ++ T   P
Sbjct: 430 LPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYIGTKVDP 489

Query: 347 REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
               LS S ++LF+KMYLNGG A+ P  FLK C  LRPDL IPD QQDTQEFL+++L +L
Sbjct: 490 ---HLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFLILLLDQL 546

Query: 407 HEELSNGT--VTEYYPDLVSYDANAFQV-NPSKYQKWYEGSVLTDGLSPIDYIFRGQMEN 463
           H EL +    +   +PDL+ YD ++  V N ++Y+KW+  S+  +GLS I  IF+GQ+EN
Sbjct: 547 HNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEIFQGQLEN 606

Query: 464 ILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIK----LEDCINLFTSDEELSG 519
            L+CQRC  +S +YS F  LSL+IP        +K +K +    LEDCI+LF  +E L+G
Sbjct: 607 SLECQRCNYTSTNYSNFCTLSLSIP--------NKRRKFRKLVDLEDCISLFIENEMLTG 658

Query: 520 DNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 579
           +N+W+CP C ++                                                
Sbjct: 659 ENAWNCPKCSSSSNNNTSKRKSRGFFKFSKHKNRSHNDLTFSEYNHNSSSDDV------- 711

Query: 580 KKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYD-LTRKNNTVITYPLILNVILKNNKVVR 638
            K++ +KL T KS+ FI LP +L+IHLSRF    L  KNNT I YP IL + LKN +  R
Sbjct: 712 -KFSKKKLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCR 770

Query: 639 YKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQH-HHDDFEAGKTE 697
           +KLYG VNH GNL NGHYTS +NKE +H++   RQ W  FDD+ +KQ  ++ D +     
Sbjct: 771 FKLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNR 830

Query: 698 VSSSEVYVLFYERMDE 713
           +SSS+VYVLFYE++ E
Sbjct: 831 ISSSDVYVLFYEKIIE 846

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 69/126 (54%), Gaps = 7/126 (5%)

Query: 1   MLLNPDQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALT 60
           ++ N D++  LV ++Y   IK  Y QL       LL++   LFE +L+ +      ++L 
Sbjct: 9   LVANSDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLKGN-----TDSLD 63

Query: 61  AFIIGGYYLYLVIPQS-LQFQTRNNLY-SSYAKLKNDYQDEQIMSYVLKIVKEESNMIVD 118
           +FIIG +Y+ LVIP S    ++ NN Y + Y  LK  Y+ +  +S +L I++ ES  I+ 
Sbjct: 64  SFIIGYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQ 123

Query: 119 RYLSDS 124
            +  D+
Sbjct: 124 SFDVDA 129

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  337 bits (865), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/439 (42%), Positives = 259/439 (58%), Gaps = 18/439 (4%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
           LP I ++ +   +LS+ G++N  NTCY+NS++QCLFG+T FRDLFLT K+ +F + +   
Sbjct: 197 LPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDKFEMF-KAETNS 255

Query: 347 REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
             + ++  + +LFKKMY NGG AI P  F++ CK+LRPD  IP  QQDTQEFL+ +L RL
Sbjct: 256 ESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMFVLERL 315

Query: 407 HEELSNGTVTEYYPDLVSYDANAFQVNPSK-YQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
             EL+N + T     L++  +N   +  +K Y +WY   +  + LSPID +FRG +E+ L
Sbjct: 316 RVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFRGDVESKL 375

Query: 466 KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
            C+ C  S+ ++S+FY+LSL IPK    S   KSK I+LEDCINLFT  E L+G+NSW C
Sbjct: 376 ICKHCNESASTFSSFYILSLNIPK-EKSSLFFKSKTIRLEDCINLFTRKEILTGENSWAC 434

Query: 526 PNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNS- 584
           P+C T      I+                                          K+++ 
Sbjct: 435 PSCETKARYNVIDNDKTYQQKHTNIGKHSKFPRFFSHIEAGKTERNSGANKFSQLKYDNL 494

Query: 585 ---------RKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNK 635
                    +K  T+ S  F+ LPPILVIHLSRF YD+++KN + I+YP+ L V   +N 
Sbjct: 495 ENEQRHRQQKKSETILSVSFVSLPPILVIHLSRFCYDISKKNTSNISYPMSLTVETLDNS 554

Query: 636 VVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGK 695
            V Y+LYGT+NHIG+   GHYT+ VNKEKNH   L  Q W+ FDDD +   +  DF   K
Sbjct: 555 SVTYRLYGTINHIGSPRGGHYTALVNKEKNHFTDLELQKWVEFDDDLV--FNRTDFFKSK 612

Query: 696 TEVSS---SEVYVLFYERM 711
           TE++S   ++ YVLFYER+
Sbjct: 613 TEINSITNNDAYVLFYERI 631

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 63/120 (52%), Gaps = 12/120 (10%)

Query: 1   MLLNPDQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALT 60
           ++ N + + +LV  V+E  IK+ Y  L L  +  LL  AA     YL  +E   + + L 
Sbjct: 6   VICNTEILKSLVSQVFETSIKKQYWVLTLCKVSQLLGQAAK----YLDKTETLGQEKLLE 61

Query: 61  A----FIIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDY----QDEQIMSYVLKIVKEE 112
           +    +  G +Y+YL++P + QFQ  +  Y +Y +LKN+Y    + +    Y+L  V+E+
Sbjct: 62  SSYMNYAAGCFYIYLLVPNANQFQLEDTEYGTYLQLKNNYLVKGEGDLTFQYLLDRVREK 121

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score =  298 bits (764), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 144/249 (57%), Positives = 187/249 (75%), Gaps = 9/249 (3%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
           +PTIE + ++   LSITGL+N  NTCYINS+IQCLF T  FR+LF++ KY+ FL+ +  P
Sbjct: 675 IPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLK-EVAP 733

Query: 347 R------EVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLL 400
           +      +  +SR+ Y+LFKKMYLNGG ++ P  FLK C  LRPD  IPDDQQDT EFL+
Sbjct: 734 KPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLM 793

Query: 401 IILARLHEELSN-GTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRG 459
           +IL RLH+ELSN   V   YPDL+ YD     V   +Y+KW++ SV+ +GLSPID IF+G
Sbjct: 794 LILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQG 853

Query: 460 QMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSG 519
           QMEN L CQRCG+SS +YSTFYVLSLAIPK +  +F S+SK++ LE+C+N++TSDE LSG
Sbjct: 854 QMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTF-SRSKRVSLEECLNMYTSDEVLSG 912

Query: 520 DNSWDCPNC 528
           +N+WDCPNC
Sbjct: 913 ENAWDCPNC 921

 Score =  168 bits (425), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 106/133 (79%), Gaps = 1/133 (0%)

Query: 580  KKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRY 639
            K+W S+KL T+K+ +FI +P  L+IHLSRFYYDLT+KN+T++TYPLILN++LK+N+VV+Y
Sbjct: 1029 KQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKY 1088

Query: 640  KLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQH-HHDDFEAGKTEV 698
            KLYG VNH GNL++GHYTS V+K+ +H +  N   W  FDD+ +K+   H D + G  ++
Sbjct: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKI 1148

Query: 699  SSSEVYVLFYERM 711
            SSS+VYVLFYER+
Sbjct: 1149 SSSDVYVLFYERI 1161

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 84/135 (62%), Gaps = 1/135 (0%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65
           D++   V  VY  DI     QLRL+ L  LL+H   L+E+YL     +Q M+AL +FI G
Sbjct: 20  DELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDALGSFING 79

Query: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125
            +Y+YLV+PQS+QF TRN  ++ Y+ ++  Y+ +  M+ VL +VKEE  ++++    DS 
Sbjct: 80  CFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLESQW-DSA 138

Query: 126 RISRTITRKRAYSLP 140
            ++  I R RAYS+P
Sbjct: 139 SLNERIPRNRAYSVP 153

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score =  298 bits (762), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 144/249 (57%), Positives = 183/249 (73%), Gaps = 3/249 (1%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
           +P +E S +    LSITGL+N  NTCYINS++QCLF TT FR++FL+ KY  ++  D  P
Sbjct: 737 IPILEKSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYMDHD-IP 795

Query: 347 REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
              +LS+S  +LFKKMY+NGG ++ P GFLK C  LRPDL IPDDQQDTQEFL++IL RL
Sbjct: 796 TNQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEFLMLILDRL 855

Query: 407 HEELSNG-TVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
           H+ELSN   V   YPDLV YD +  +V P +Y KWY  SV ++GLSPID++F+GQ E+ L
Sbjct: 856 HDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDHVFQGQTEDGL 915

Query: 466 KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
            CQRCG SS +YSTFY+LSLAIPK S  +F  K K++ LEDCI +FT+DE LS +N+WDC
Sbjct: 916 VCQRCGCSSFTYSTFYILSLAIPKASTNAF-GKIKRVNLEDCIKMFTNDEILSDENAWDC 974

Query: 526 PNCGTTDLK 534
           P CG+   K
Sbjct: 975 PRCGSAAPK 983

 Score =  168 bits (426), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 81/129 (62%), Positives = 100/129 (77%), Gaps = 1/129 (0%)

Query: 584  SRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYG 643
            S K+ T+KS +F+  P ILVIHLSRFYYDLT+KNNTVITYPL LN+ LKN +V RYKLYG
Sbjct: 1083 SGKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNISLKNGEVARYKLYG 1142

Query: 644  TVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQH-HHDDFEAGKTEVSSSE 702
             VNH G LV+GHYTS VNK+ +HE+G  +Q W  FDD+ +K+  +H D E G T +SSS 
Sbjct: 1143 LVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNHGDIEGGVTSISSSH 1202

Query: 703  VYVLFYERM 711
            VYVLFY+R+
Sbjct: 1203 VYVLFYQRI 1211

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 97/165 (58%), Gaps = 14/165 (8%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVY---LRDSEINQEMEALTAF 62
           D+++  V+ +Y  + K  Y QL+L+ L  LLDH++ LFE Y   LRDS  +   +AL+AF
Sbjct: 16  DELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFD---DALSAF 72

Query: 63  IIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLS 122
           I+G +Y+Y +IPQS QF T+N  Y  Y +LKN Y+DE  M+ VL +VK E   I+D    
Sbjct: 73  IVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDSNYK 132

Query: 123 DSNRI-------SRTITRKRAYSLPLRPLPVH-MASLSILNQLEN 159
             N         S+ I R+RA+S+P    P   M   S+ +QL+N
Sbjct: 133 SQNESSNNLFVDSKFIRRERAFSVPNASNPFSLMNDTSLDSQLDN 177

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score =  295 bits (755), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 141/252 (55%), Positives = 190/252 (75%), Gaps = 7/252 (2%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
           +PTIE S+++   LSITGL+N  NTCYINS+IQCLF   +FR LF++  Y+ +LQ  K  
Sbjct: 585 IPTIEQSSNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQPPKGS 644

Query: 347 REV---QLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIIL 403
           R     +LS S+ +LF KMYLNGG ++ P GFLK+  +LRPDL IPDDQQDTQEFL+I+L
Sbjct: 645 RSAHSSKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILL 704

Query: 404 ARLHEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQME 462
            RLH+ELSN   V   YP+L+ Y+A+A +V+ ++Y+ W++ +V+ +G+SPID IF+GQME
Sbjct: 705 DRLHDELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQME 764

Query: 463 NILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFT---SKSKKIKLEDCINLFTSDEELSG 519
           N L+C+RCG ++ +YSTFYVLSLAIP+ S+       S  K++KLEDCIN+FT DE LSG
Sbjct: 765 NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSG 824

Query: 520 DNSWDCPNCGTT 531
           +N+WDCP CG T
Sbjct: 825 ENAWDCPRCGPT 836

 Score =  157 bits (397), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 103/135 (76%), Gaps = 7/135 (5%)

Query: 582  WNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKL 641
            + ++KLTTVK+ +F+ LP ILVIHLSRFYYDLT+KN+TVITYPLILN+ILKNN+ ++Y+L
Sbjct: 933  FKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRL 992

Query: 642  YGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIK---QHHHDDFEAGKTEV 698
            +G VNH G LV+GHYTS VNK+  H + + R  W  FDD+ +K   +H  D       ++
Sbjct: 993  FGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDK----NLKI 1048

Query: 699  SSSEVYVLFYERMDE 713
            SSS+VYVLFYER+ +
Sbjct: 1049 SSSDVYVLFYERVHD 1063

 Score =  117 bits (292), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 102/150 (68%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65
           ++++  V+++Y  DIK +Y QL+L+ L  LL+H  +L+E+YL     N+  +ALTAFIIG
Sbjct: 14  NELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPNDALTAFIIG 73

Query: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125
            YY++L+IPQSLQFQTRN  YS Y  LK  Y++E  M+ V+ +VK+E  +++D  +  + 
Sbjct: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHAV 133

Query: 126 RISRTITRKRAYSLPLRPLPVHMASLSILN 155
            I   IT+KRA+S+P   L   +ASLS+ N
Sbjct: 134 GIEHRITKKRAFSVPANDLSGQVASLSLEN 163

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score =  293 bits (751), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 187/249 (75%), Gaps = 6/249 (2%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
           +PTIE S++    LSITGL+N  NTCYINS+IQCLF   +FR LF++ KY+ +LQ  +  
Sbjct: 586 IPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQSRGN 645

Query: 347 R--EVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILA 404
           R    +LS S+ +LF KMYLNGG ++ P GFLK+  +LRPDL IPDDQQDTQEFL+I+L 
Sbjct: 646 RLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLD 705

Query: 405 RLHEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMEN 463
           RLH+ELSN   V   YP+L+ YDA+  +V+  +Y+ W++ +V+ +G+SPID IF+GQMEN
Sbjct: 706 RLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIFQGQMEN 765

Query: 464 ILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFT---SKSKKIKLEDCINLFTSDEELSGD 520
            L+C+RCG ++ +YSTFYVLSLAIP+ S+          K++KLEDCIN+FTSDE LSG+
Sbjct: 766 SLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSDEVLSGE 825

Query: 521 NSWDCPNCG 529
           N+WDCP CG
Sbjct: 826 NAWDCPRCG 834

 Score =  157 bits (396), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 76/134 (56%), Positives = 101/134 (75%), Gaps = 5/134 (3%)

Query: 582  WNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKL 641
            + ++KLTTVK+ +F+ LP ILVIHLSRFYYDLT+KNNTVITYPLILN+ILKNN  ++Y+L
Sbjct: 932  FKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRL 991

Query: 642  YGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIK--QHHHDDFEAGKTEVS 699
            +G VNH G L++GHYTS VNK+  H + + R  W  FDD+ +K  + H  D      ++S
Sbjct: 992  FGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSD---KSLKIS 1048

Query: 700  SSEVYVLFYERMDE 713
            SS+ YVLFYER+ +
Sbjct: 1049 SSDAYVLFYERVHD 1062

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/164 (42%), Positives = 105/164 (64%), Gaps = 2/164 (1%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65
           ++++  VR++Y  DIK +Y QL+L+ L  LL+H  +LFE+YL      +  +ALTAF+IG
Sbjct: 14  NELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPNDALTAFVIG 73

Query: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125
            YY++L+IPQSLQFQTRN  YS Y+ LK  Y++E  M+ V+ +VK+E  +++D  +    
Sbjct: 74  CYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDDSVKHVV 133

Query: 126 RISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSA 169
            I   IT+KRA+S+P   L   +ASLS+      PR    K S+
Sbjct: 134 GIEHRITKKRAFSVPGIDLSDQLASLSL--DAAGPRGHLHKTSS 175

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score =  290 bits (742), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 140/252 (55%), Positives = 190/252 (75%), Gaps = 7/252 (2%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQ---TD 343
           +PTIE S ++   LSITGL+N  NTCYINS+IQCLF    FR LF++ KY+ +LQ   ++
Sbjct: 593 IPTIERSPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIRSN 652

Query: 344 KYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIIL 403
                 +LS S+ +LF KMYLNGG ++ P GFLK+  +LRPDL IPDDQQDTQEFL+I+L
Sbjct: 653 GSHYSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILL 712

Query: 404 ARLHEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQME 462
            RLH+ELS+   V   YP+L+ Y+A+A +V+ ++Y+ W++ +V+ +G+SPID IF+GQME
Sbjct: 713 DRLHDELSDQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQME 772

Query: 463 NILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFT---SKSKKIKLEDCINLFTSDEELSG 519
           N L+C+RCG ++ +YSTFYVLSLAIP+ S+       S  K++KLEDCIN+FTSDE LSG
Sbjct: 773 NSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSG 832

Query: 520 DNSWDCPNCGTT 531
           +N+WDCP CG T
Sbjct: 833 ENAWDCPRCGPT 844

 Score =  159 bits (402), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 101/132 (76%), Gaps = 5/132 (3%)

Query: 582  WNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKL 641
            + ++KLTTVK+ +F+ LP ILVIHLSRFYYDLT+KNNTV+TYPLILN+ILKNN  ++YKL
Sbjct: 941  YKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVVTYPLILNIILKNNDTMKYKL 1000

Query: 642  YGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIK--QHHHDDFEAGKTEVS 699
            +G VNH G L++GHYTS VNK+  H + + R  W  FDD+ +K  + H  D      ++S
Sbjct: 1001 FGVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSD---KNLKIS 1057

Query: 700  SSEVYVLFYERM 711
            SS+VYVLFYER+
Sbjct: 1058 SSDVYVLFYERV 1069

 Score =  115 bits (288), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 66/148 (44%), Positives = 100/148 (67%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65
           ++++  V+++Y  DIK +Y QL+L+ L  LL+H  +LFE+YL     ++  +ALTAFIIG
Sbjct: 23  NELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHHDRPNDALTAFIIG 82

Query: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125
            YY++L+IPQSLQFQTRN  YS Y  LK  Y++E  M+ V+ +VK+E  +++D  +    
Sbjct: 83  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHGA 142

Query: 126 RISRTITRKRAYSLPLRPLPVHMASLSI 153
            I   IT+KRA+S+P   L   +ASLS+
Sbjct: 143 GIEHRITKKRAFSVPADDLSGQVASLSL 170

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score =  285 bits (728), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 134/252 (53%), Positives = 182/252 (72%), Gaps = 2/252 (0%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
           +PTIE +++     S+TGL+N  NTCYIN ++Q LF T   ++LF++ KYR +       
Sbjct: 632 IPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYREYQMKPNDN 691

Query: 347 REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
           +E  +S +   LF KMY+NGG  + P+GFLK+C  LRPDL IPDDQQDTQEFLL IL RL
Sbjct: 692 KESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRL 751

Query: 407 HEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
           H+ELSN   V   YP+L+ YD +   V+  KY+KW++ +V+ +GLSP+D +F+GQMEN L
Sbjct: 752 HDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENAL 811

Query: 466 KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
           +CQRCG  S +YSTFYVLSLA+PK S  +F  KS ++KLEDCIN+FTSDE L+G+N+WDC
Sbjct: 812 QCQRCGYESVNYSTFYVLSLALPKPSAPAFY-KSGRVKLEDCINMFTSDEVLTGENAWDC 870

Query: 526 PNCGTTDLKTKI 537
           P CG+  ++ + 
Sbjct: 871 PKCGSKAVEPRF 882

 Score =  165 bits (418), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 103/133 (77%), Gaps = 1/133 (0%)

Query: 581  KWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYK 640
            K  S+KL T+K+ +FI LP +L+IHLSRFYYDLT+KN+ V++YPL+LN++LKN ++VRYK
Sbjct: 949  KMKSKKLVTIKTINFISLPKVLIIHLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYK 1008

Query: 641  LYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIK-QHHHDDFEAGKTEVS 699
            LY  VNH GNL++GHYTS VNK+ +H +G   Q W  FDD+ +K +  H + + G T+VS
Sbjct: 1009 LYSIVNHTGNLISGHYTSLVNKDPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVS 1068

Query: 700  SSEVYVLFYERMD 712
            S  VYVLFYER+D
Sbjct: 1069 SKNVYVLFYERVD 1081

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 99/179 (55%), Gaps = 26/179 (14%)

Query: 7   QVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIGG 66
           Q++  ++ +Y  +I+  + QL+L+ L  LL+ A  + E Y+   +++   +A+  FI G 
Sbjct: 11  QLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDTS-KAVRVFITGC 69

Query: 67  YYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRY------ 120
           +Y+YLV+P+S+QFQTR+  YS Y +L++ Y+ +  M+ V+ +VKEE   I ++       
Sbjct: 70  FYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQCDNFQDN 129

Query: 121 --LSDS--------------NRISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHE 163
             + DS              N+  R ITR+ AYS+     P  M++LS+ ++L   R E
Sbjct: 130 EGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSI---SSPSGMSTLSLHDELPEHRSE 185

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score =  283 bits (725), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 187/250 (74%), Gaps = 7/250 (2%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQ---TD 343
           +PTIE + ++   LSITGL+N  NTCYINS+IQCLF    FR LF++  Y+ +L+   ++
Sbjct: 582 IPTIERNPNVYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASN 641

Query: 344 KYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIIL 403
           +     +LS S+ +LF KMYLNGG ++ P GFLK+  +LRPDL IPDDQQDTQEFL+I+L
Sbjct: 642 RPHHSPKLSNSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILL 701

Query: 404 ARLHEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQME 462
            RLH+ELSN   V   YP+L+ Y+A+  +V+ ++Y+ W++ +V+ +G+SPID IF+GQME
Sbjct: 702 DRLHDELSNQQHVANDYPNLLLYNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQME 761

Query: 463 NILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFT---SKSKKIKLEDCINLFTSDEELSG 519
           N L+C+RCG ++ +YSTFYVLSLAIP  S+       S  K++KLEDCIN+FTSDE LSG
Sbjct: 762 NSLQCKRCGYTTFNYSTFYVLSLAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSG 821

Query: 520 DNSWDCPNCG 529
           +N+WDCP CG
Sbjct: 822 ENAWDCPRCG 831

 Score =  157 bits (398), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 76/132 (57%), Positives = 101/132 (76%), Gaps = 5/132 (3%)

Query: 582  WNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKL 641
            + ++K+TTVK+ +F+ LP ILVIHLSRFYYDLT+KNNTVITYPLILN+ILKNN  ++Y+L
Sbjct: 930  FKNKKMTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRL 989

Query: 642  YGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIK--QHHHDDFEAGKTEVS 699
            +G VNH G L++GHYTS VNK+  H + + R  W  FDD+ +K  + H  D      ++S
Sbjct: 990  FGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSD---KNLKIS 1046

Query: 700  SSEVYVLFYERM 711
            SS+VYVLFYER+
Sbjct: 1047 SSDVYVLFYERV 1058

 Score =  114 bits (284), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 98/148 (66%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65
           D+++  V+++Y  DIK +Y QL+L+ L  LL+H  +LFE+YL      +  +ALTAF+IG
Sbjct: 14  DELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPNDALTAFVIG 73

Query: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125
            YY++L+IPQSLQFQTRN  YS Y  LK  Y++E  M+ V+ +VK+E  +++D  +    
Sbjct: 74  CYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDESVKHVV 133

Query: 126 RISRTITRKRAYSLPLRPLPVHMASLSI 153
            I   I +KRA+S+P   L   +ASLS+
Sbjct: 134 GIEHRINKKRAFSVPANDLSGQVASLSL 161

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score =  262 bits (670), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 135/252 (53%), Positives = 176/252 (69%), Gaps = 3/252 (1%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346
           +PTIE S +    LSITGL+N   TCYINS++QCLF T +FRDLF    Y  F   +   
Sbjct: 583 VPTIERSNNKYVALSITGLRNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPE-LE 641

Query: 347 REVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
              +LS+S  VL +KMY+NGG ++ P  FLK+C  LRPD NIPDDQQD QEFL++ + RL
Sbjct: 642 DTGKLSKSFSVLIRKMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRL 701

Query: 407 HEELSNGT-VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
           H+ELSN T V   +P+L+ YDA   +V   +Y++W+E S++    SPID IF+GQ+EN L
Sbjct: 702 HDELSNQTEVLNAHPELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGL 761

Query: 466 KCQRCGNSSHSYSTFYVLSLAIPK-ISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWD 524
            C++CG SS+SYSTFY+LSLAIPK  S +  +SK   + LEDCIN+FTSDE +S +N+WD
Sbjct: 762 HCKKCGYSSYSYSTFYILSLAIPKPSSSFLSSSKGNWVNLEDCINMFTSDEVMSRENAWD 821

Query: 525 CPNCGTTDLKTK 536
           CP CG T  K K
Sbjct: 822 CPKCGVTVQKEK 833

 Score =  164 bits (416), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 100/125 (80%), Gaps = 1/125 (0%)

Query: 589  TVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYKLYGTVNHI 648
            ++++++F+ LPP+LVIHLSRFYYDLT+KN TVITYPLILN++LKNN+ ++Y+LY  VNH 
Sbjct: 920  SIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNHN 979

Query: 649  GNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQH-HHDDFEAGKTEVSSSEVYVLF 707
            GNL++GHYTS VNK ++H++  NRQ W  FDD+ +K    H +   G  +VSS +VYVLF
Sbjct: 980  GNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVLF 1039

Query: 708  YERMD 712
            YER+D
Sbjct: 1040 YERID 1044

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 94/147 (63%), Gaps = 4/147 (2%)

Query: 7   QVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIGG 66
           +++ LV ++YE DIK  Y+ L+L++L  L+DH  +L+E +  + +   + +ALTA+IIG 
Sbjct: 15  ELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDALTAYIIGC 74

Query: 67  YYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSNR 126
           Y+LYL+IPQS QFQ RN  +  +  LK  Y+++  M+ VL +VK+E + ++DR      R
Sbjct: 75  YFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDRDF----R 130

Query: 127 ISRTITRKRAYSLPLRPLPVHMASLSI 153
             + + RKRA+S P   L   ++ L++
Sbjct: 131 KLKDVERKRAFSSPDNGLDSEISRLTL 157

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  259 bits (662), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 177/250 (70%), Gaps = 5/250 (2%)

Query: 281 SSALNKLPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFL 340
           S A   +PTIE + +    LSITGL+N  NTCYINS++QCLF TT FR+LFL+ KY  +L
Sbjct: 724 SEAHFSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYL 783

Query: 341 QTDKYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLL 400
           ++        +SRS Y+LFKKMY+NGG ++ P+GFLKMC  L+PDL IP  QQDTQEFLL
Sbjct: 784 KSSNMD---NMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLL 840

Query: 401 IILARLHEELSN-GTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRG 459
            +L RL +ELS    V   YP L+ ++++  +VN  +Y  W++ +   +GLSPID IF+G
Sbjct: 841 FLLDRLRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQG 900

Query: 460 QMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSG 519
           Q+E+ L CQRC  SS+SYSTFYVLSLA+P     +F  K+KK++LEDCIN FT DE L+G
Sbjct: 901 QIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAF-GKAKKLRLEDCINFFTCDEVLTG 959

Query: 520 DNSWDCPNCG 529
            N WDCP CG
Sbjct: 960 QNPWDCPKCG 969

 Score =  166 bits (421), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 106/133 (79%), Gaps = 2/133 (1%)

Query: 580  KKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRY 639
            K++N +KL T+KS +FI LP IL+IHLSRF YDLT+KNNTV+TYPLILN++LKNN+V +Y
Sbjct: 1037 KRYN-KKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKY 1095

Query: 640  KLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIK-QHHHDDFEAGKTEV 698
            +LY T+NH G L++GHYTS VNK+  HEI   +Q W  FDD+ +K   +H +++ G T V
Sbjct: 1096 RLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSV 1155

Query: 699  SSSEVYVLFYERM 711
            SSS+VY+LFYER+
Sbjct: 1156 SSSDVYLLFYERI 1168

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 79/131 (60%), Gaps = 1/131 (0%)

Query: 11  LVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIGGYYLY 70
            V+  YE  +++ Y +LR + L  LL+ AA+LFE Y       Q  E L A++IG +YLY
Sbjct: 16  FVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTREGLMAYVIGAFYLY 75

Query: 71  LVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYL-SDSNRISR 129
           L+IPQS++F TRN  YS Y  L+  Y+ E  M+ V+++V E+ + ++ R    D  R   
Sbjct: 76  LIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAVLLRQTPEDGERGDT 135

Query: 130 TITRKRAYSLP 140
            + RKRAYS+P
Sbjct: 136 KLYRKRAYSVP 146

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score =  240 bits (612), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 170/251 (67%), Gaps = 14/251 (5%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKK-YRLFLQTDKY 345
           +P I+ + ++   LS+ GL+N  NTCYINS++QCLFGT + RDLF+++  Y+ F++ D  
Sbjct: 222 VPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKDA- 280

Query: 346 PREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILAR 405
             E ++S     L   MY NGG ++ P  FL+    LRPDLNIP DQQDTQEFL+I+L  
Sbjct: 281 --ETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEFLVILLDI 338

Query: 406 LHEELSNGTVTEYYPDLVSYDANAFQVNPSK-YQKWYEGSVLTDGLSPIDYIFRGQMENI 464
           LH+EL       Y  DL+S +  +  +N  K Y  W + ++  +G SPID IF+GQ+EN 
Sbjct: 339 LHDELV------YTDDLISNNYVSDDINLGKEYMPWLQNNLKANGKSPIDLIFQGQIENC 392

Query: 465 LKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWD 524
           L+CQRCGN+S++YS FY+LSLAIPKI+     +   ++KLEDCIN FTSDE L+G+N+W+
Sbjct: 393 LQCQRCGNTSYNYSMFYMLSLAIPKIAK---ENSKNRVKLEDCINFFTSDEILTGENAWN 449

Query: 525 CPNCGTTDLKT 535
           CP C  T ++T
Sbjct: 450 CPKCCPTTIET 460

 Score =  154 bits (390), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 79/134 (58%), Positives = 96/134 (71%), Gaps = 8/134 (5%)

Query: 587 LTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNN-KVVRYKLYGTV 645
           L T+K  +FI LPPILVIHLSRFYY+ T+KNN VITYPLILN+I+KNN  VV+YKLYG +
Sbjct: 523 LITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLI 582

Query: 646 NHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ-------HHHDDFEAGKTEV 698
           NH G L  GHYTS VNK+ NH + LN Q W  FDD+ IK+       +  + F   K E 
Sbjct: 583 NHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEF 642

Query: 699 SSSEVYVLFYERMD 712
            SS+VYVLFYER++
Sbjct: 643 DSSKVYVLFYERIE 656

 Score =  101 bits (251), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 91/136 (66%), Gaps = 4/136 (2%)

Query: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVY-LRDSEINQEMEALTAFII 64
           D + +LV ++++ DIK +Y++LRL+ L  LLDH  +L +++ +  S  +++ +A  AF+ 
Sbjct: 28  DDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQATLAFVN 87

Query: 65  GGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDS 124
           G +YL+L+IP  +QFQT+N L++ Y  LK DY+ +  M  +L  VKE+S  I+++ LS  
Sbjct: 88  GSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQDLSG- 146

Query: 125 NRISRTITRKRAYSLP 140
             I+R I +KRAY+ P
Sbjct: 147 --INRRILKKRAYTEP 160

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  134 bits (337), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 126/466 (27%), Positives = 181/466 (38%), Gaps = 120/466 (25%)

Query: 284 LNKLPTIEDSTSLLSQLS-----ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRL 338
           L K P+ E S +L S          GL+N  N+CYIN I+QCL GT    ++FL K Y  
Sbjct: 439 LPKFPSRESSPALGSANKYDLDFAVGLENMGNSCYINCIVQCLLGTHELTNIFLNKSYER 498

Query: 339 FLQTD-KYPREVQLSRSIYVLFKKMYLNG-------GEAIAPNGFLKMCKKLRPDLNIPD 390
            +  + +   +  L++    L   MY N        G+ + P  F   C  +   L    
Sbjct: 499 HINMNSRLGSKGVLAKYFAKLTHSMYQNASHKLNEKGKPVQPMEFKMACGTIN-SLFRES 557

Query: 391 DQQDTQEFLLIILARLHEEL----SNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVL 446
            QQD QEF   +L  LHE+L     N  + E   D          +  +   +W     L
Sbjct: 558 GQQDCQEFCQFLLDGLHEDLNQCGGNPPLKE-LSDEAEKMREKLSLRIASSIEWER--FL 614

Query: 447 TDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLED 506
           T   S I  +F+GQ  + L+CQ CG +S +Y  F VLS+ +P          +K   + D
Sbjct: 615 TTDFSVIVDLFQGQYASQLRCQVCGLTSTTYQPFSVLSVPVP---------HAKSCNIID 665

Query: 507 CINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXX 566
           C   FT  E+L  D  W CP C                                      
Sbjct: 666 CFKEFTKVEKLETDEQWSCPRC-------------------------------------- 687

Query: 567 XXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLI 626
                        K+ +++KLT  +      LP  L+IHL RF  ++  KNN  + YP  
Sbjct: 688 -----------KKKQPSTKKLTITR------LPRNLIIHLKRF-DNMMNKNNVFVKYPFT 729

Query: 627 LNV---------------------ILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKN 665
           L++                         +    YKLYG  +H+G+L  GHYTS V+K   
Sbjct: 730 LDLTPYWANDFDGRLPPGVTEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDKGP- 788

Query: 666 HEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYERM 711
                 ++ W  FDD   +   +       TE  +   YVLFY R+
Sbjct: 789 ------KRGWCYFDDTSFRPVRN------ATECITPNAYVLFYHRV 822

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  133 bits (334), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 125/442 (28%), Positives = 179/442 (40%), Gaps = 116/442 (26%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFKKM 362
           GL+N  N+CY+N IIQCL  T     +FL   Y   +  + K   +  L++    L   M
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHINLNSKLGSKGVLAKYFARLVHTM 579

Query: 363 YLNGG--------EAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGT 414
           Y  G         + I P  F   C  +   L   + QQD+QEF   +L  LHE+L+   
Sbjct: 580 YREGSFKRPLEKNKPIQPIQFKMACGSIN-SLFKDNTQQDSQEFCQFLLDGLHEDLNQCG 638

Query: 415 VTEYYPDLVSYDANAFQ----VNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRC 470
                 +L S DA   +    +  +   +W     LT   S I  +F+GQ  + LKC+ C
Sbjct: 639 ANPPLKEL-SEDAEKMREKLSMRIASSIEWER--FLTTDFSVIVDLFQGQYASQLKCKVC 695

Query: 471 GNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGT 530
           G +S +Y TF VLS+ +P +S            + DC N FT  E+L  D  W CP C  
Sbjct: 696 GCTSTTYQTFSVLSVPVPHVS---------SCHILDCFNEFTKVEKLGTDELWSCPTC-- 744

Query: 531 TDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTV 590
                                                            K+ +++KLT  
Sbjct: 745 -----------------------------------------------KKKQPSTKKLTIT 757

Query: 591 KSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI------------------LK 632
           +      LP  L+IHL RF  ++  KNN  + YP +L++                   L 
Sbjct: 758 R------LPRNLIIHLKRF-DNMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPGVTDELP 810

Query: 633 NNKVV---RYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHD 689
               V   RYKL    +H+G+L  GHYT+ VNK      G+NR  W  FDD   +   ++
Sbjct: 811 TRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNK------GINRG-WHYFDDTSYRPIKNE 863

Query: 690 DFEAGKTEVSSSEVYVLFYERM 711
                 TE  +   YVLFY R+
Sbjct: 864 ------TECITPNAYVLFYHRV 879

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  132 bits (333), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 126/444 (28%), Positives = 182/444 (40%), Gaps = 119/444 (26%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFKKM 362
           GL+N  N+CY+N IIQC+ GT     +FL   Y   +  + K   +  L++    L   M
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 622

Query: 363 YLNGGEA-----IAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEEL----SNG 413
           Y    +A     I+P  F   C  +   L     QQD QEF   +L  LHE+L    SN 
Sbjct: 623 YKEQVDASKKISISPIKFKLACGSVN-SLFKTASQQDCQEFCQFLLDGLHEDLNQCGSNP 681

Query: 414 TVTEYYPDLVSYDANA----FQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQR 469
            + E     +S +A A      +  +   +W     LT   S I  +F+GQ  + LKC+ 
Sbjct: 682 PLKE-----LSQEAEARREKLSLRIASSIEWER--FLTTDFSVIVDLFQGQYASRLKCKI 734

Query: 470 CGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCG 529
           CG++S +Y  F VLS+ IP+           +I +EDC   FT  E L  D  W CP+C 
Sbjct: 735 CGHTSTTYQPFTVLSIPIPR------KVPQNEITIEDCFKEFTKCENLEVDEQWLCPHC- 787

Query: 530 TTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTT 589
                                                             ++ ++++LT 
Sbjct: 788 ------------------------------------------------KKRQPSTKQLTV 799

Query: 590 VKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV-------------------- 629
            +      LP  L+IHL RF  +L  KNN  + YP +L++                    
Sbjct: 800 TR------LPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDDE 852

Query: 630 --ILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHH 687
             +       +Y+LYG   H G L  GHYT+ V K      GL R+ W+ FDD   K   
Sbjct: 853 LPVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKK------GL-RKGWLYFDDTKFKP-- 903

Query: 688 HDDFEAGKTEVSSSEVYVLFYERM 711
                  KT+V++S  YVLFY R+
Sbjct: 904 ----VKNKTDVTNSNAYVLFYHRV 923

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  130 bits (327), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 125/451 (27%), Positives = 187/451 (41%), Gaps = 121/451 (26%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQ-TDKYPREVQLSRSIYVLFK 360
           I GL+N  N+CY+N IIQC+ GT     +FL   Y   +  + +   +  L+++   L  
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHINLSSRLGSKGVLAKNFARLIH 663

Query: 361 KMYLNGGEA------------IAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHE 408
            MY++   +            + P  F   C  +   L     QQD+QEF   +L  LHE
Sbjct: 664 TMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSIN-SLFRDSQQQDSQEFCQFLLDGLHE 722

Query: 409 ELSNGTVTEYYPDLVSYDANAFQVNPS-------KYQKWYEGSVLTDGLSPIDYIFRGQM 461
           +L+         +L S +A   + N S       +++++     LT   S I  +F+GQ 
Sbjct: 723 DLNQCGGNPPLKEL-SLEAERLRENLSLRIASSIEWERY-----LTTDFSVIVDLFQGQY 776

Query: 462 ENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDN 521
            + L+C+ C ++S +Y +F VLS+ +PK     F  +++KI L DC N FT  E L  D 
Sbjct: 777 ASRLECKVCHHTSTTYQSFSVLSVPLPK----KFDPQTRKIDLIDCFNEFTKIENLEVDE 832

Query: 522 SWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKK 581
            W CP C                                                   K+
Sbjct: 833 QWSCPTC-------------------------------------------------KKKQ 843

Query: 582 WNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI----------- 630
            +++KLT  +      LP  L+IHL RF  ++  KNN+ I YP  L++            
Sbjct: 844 PSTKKLTITR------LPRNLIIHLKRF-DNMLNKNNSFIDYPFNLDLTEFWADDFDGNL 896

Query: 631 ---LKNNKVVR-------YKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDD 680
              + N    R       Y+LYG   H G+L  GHYT+ V+K     IG     W  FDD
Sbjct: 897 PPGVSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDK----GIG---NGWYYFDD 949

Query: 681 DYIKQHHHDDFEAGKTEVSSSEVYVLFYERM 711
              +   +D       E  SS  YVLFY R+
Sbjct: 950 TTYRPLKNDK------EPISSSAYVLFYTRV 974

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score =  129 bits (324), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 127/464 (27%), Positives = 191/464 (41%), Gaps = 112/464 (24%)

Query: 281 SSALNKLPTIEDSTSLLSQLSIT-GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLF 339
           SS+L+ +   + S+S    L    GL+N  N+CY+N IIQC+ GT     +FL   Y   
Sbjct: 540 SSSLDHIDASQTSSSRNYDLDFAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKH 599

Query: 340 LQTD-----KYPREVQLSRSIYVLFKKMYLNGG-EAIAPNGFLKMCKKLRPDLNIPDDQQ 393
           +  +     K       +R +++++KK   +   ++I+P  F   C  +   L     QQ
Sbjct: 600 ININSKLGSKGILAKYFARLVHMMYKKQVDSSKKDSISPIKFKLACGSVN-SLFKTASQQ 658

Query: 394 DTQEFLLIILARLHEELSNGTVTEYYPDLVSYDANA----FQVNPSKYQKWYEGSVLTDG 449
           D QEF   +L  LHE+L+         +L S +A        +  +   +W     LT  
Sbjct: 659 DCQEFCQFLLDGLHEDLNQCGSNPPLKEL-SQEAETRRERLSLRIASSIEWER--FLTTD 715

Query: 450 LSPIDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCIN 509
            S I  +F+GQ  + LKC+ C ++S +Y  F VLS+ IPK       +   KI +EDC  
Sbjct: 716 FSVIVDLFQGQYASRLKCKTCNHTSTTYQPFTVLSIPIPK------KNSQNKITIEDCFK 769

Query: 510 LFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 569
            FT  E L  D  W CP+C                                         
Sbjct: 770 EFTKCENLEIDEQWLCPHC----------------------------------------- 788

Query: 570 XXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV 629
                     ++ ++++LT  +      LP  L+IHL RF  +L  KNN  + YP +L++
Sbjct: 789 --------EKRQPSTKQLTITR------LPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDL 833

Query: 630 ----------------------ILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHE 667
                                 I       +Y+LYG   H G L  GHYTS V K     
Sbjct: 834 TPFWANDFDGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYVKK----- 888

Query: 668 IGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYERM 711
            GL+R  W+ FDD   +          +T+  +S  YVLFY R+
Sbjct: 889 -GLSRG-WLYFDDTKYRP------AKNQTDAINSNAYVLFYHRV 924

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 118/447 (26%), Positives = 174/447 (38%), Gaps = 111/447 (24%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFK 360
           + GL+N  N+CY+N IIQCL G      +FL   +  ++  + K   +  L+R    L  
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYVNLNSKLGSKGVLARYFSRLIH 678

Query: 361 KMYLN------GGE--AIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSN 412
            MY N      GG+   + P  F   C  +         QQD QEF   +L  LHE+L+ 
Sbjct: 679 TMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHEDLNQ 737

Query: 413 GTVTEYYPDLVSYDAN---AFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQR 469
               +   +L     N      +  +   +W     LT   S I  +F+GQ  + L+C+ 
Sbjct: 738 CGGNKRLAELTEEAENLREKLSLRIASSIEWER--FLTTDFSVIGDLFQGQYASRLQCKT 795

Query: 470 CGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCG 529
           CG +S +Y  F VLS+ +P   +        K  + DC + FT  E L  D  W CP C 
Sbjct: 796 CGKTSTTYQPFSVLSIPVPSKHI-------SKCSIIDCFDEFTKVENLEVDEQWSCPRCK 848

Query: 530 TTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTT 589
           +                                                 K+ +++KLT 
Sbjct: 849 S-------------------------------------------------KQPSTKKLTI 859

Query: 590 VKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVIL------------------ 631
            +      LP  L+IHL RF   L  KNN ++ YP  L++                    
Sbjct: 860 TR------LPRNLIIHLKRFDNRLN-KNNILVQYPFTLDLTTFWANDFDGKLPLNVSELP 912

Query: 632 --KNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHD 689
                    YKLYG   H G+L  GHYT+ V+K      G+ +  W  FDD   +   + 
Sbjct: 913 TRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDK------GI-KNGWYYFDDTSCRPIKNS 965

Query: 690 DFEAGKTEVSSSEVYVLFYERMDESEY 716
                  E  +S  YVLFY+R+  + Y
Sbjct: 966 ------MEPITSSAYVLFYKRIYGASY 986

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 120/444 (27%), Positives = 172/444 (38%), Gaps = 112/444 (25%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFKKM 362
           GL N  N+CY++ IIQCL GT     +FL   Y+  +  + +   +  L+R    L  +M
Sbjct: 487 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGVLARYFSQLIHQM 546

Query: 363 YLNGGE----------AIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSN 412
           Y  G +          A+ P  F   C  +   L     QQD QEF   +L  LHE+L+ 
Sbjct: 547 YQQGKDIRKTSGTEKTAVLPAQFKIACGSINA-LFRDRSQQDCQEFCQFLLDGLHEDLNQ 605

Query: 413 GTVTEYYPDLVSYDANAFQVNPSKYQKWYEGS-VLTDGLSPIDYIFRGQMENILKCQRCG 471
                   +L        ++ P +     E    LT   S I  +F+GQ  + L+C+ CG
Sbjct: 606 CGNNPPLKELSEKAEKMREMMPMRIASSIEWERYLTTDFSVIVDLFQGQYASQLRCKVCG 665

Query: 472 NSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTT 531
            +S +Y  F VLS+ +P          S++  + DC   FT  E L  D  W CP+C   
Sbjct: 666 RTSTTYQPFSVLSVPVP---------SSRQCTIIDCFTEFTKVETLDLDEQWSCPDCKKR 716

Query: 532 DLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVK 591
              TK                                                 K+T  +
Sbjct: 717 QPSTK-------------------------------------------------KITITR 727

Query: 592 SSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV-----------ILKNNKV---- 636
                 LP  L+IHL RF  ++  KNN  ++Y  +LN+           ++ NN V    
Sbjct: 728 ------LPRNLIIHLKRF-DNMLNKNNVFVSYSAVLNLTSFWANDYDKKVMNNNNVELPS 780

Query: 637 ------VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD 690
                   Y+LYG   H G L  GHYT+ VN  K   +G     W  +DD   +Q    +
Sbjct: 781 RGQVPPFNYQLYGVACHTGTLYGGHYTAYVN--KGATLG-----WCYYDDTNWRQIRSSN 833

Query: 691 FEAGKTEVSSSEVYVLFYERMDES 714
                 E  S   YVLFY R+  S
Sbjct: 834 ------EYISQNAYVLFYHRIHGS 851

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score =  126 bits (316), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 126/447 (28%), Positives = 174/447 (38%), Gaps = 127/447 (28%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQ-TDKYPREVQLSRSIYVLFKKM 362
           GL+N  N+CY+N IIQCL  +  F  +FL   Y   +    K   +  L+R+   L   M
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHINLKSKLGSKGVLARNFARLINTM 668

Query: 363 YLNGGE--------AIAPNGFLKMCKKL----RPDLNIPDDQQDTQEFLLIILARLHEEL 410
           Y  G E         + P  F   C  +    R DL     QQD+QEF   +L  LHE+L
Sbjct: 669 YTEGSEQSKNDRNGPVKPAQFKLACGSINSIFRSDL-----QQDSQEFCQFLLDGLHEDL 723

Query: 411 SNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSV-----LTDGLSPIDYIFRGQMENIL 465
           +        P L     NA ++   K       S+     LT   S I   F+GQ  + L
Sbjct: 724 NQCGAN---PPLKELSPNAEKMR-EKLSLRIASSIEWERYLTTDFSVIVDQFQGQYASQL 779

Query: 466 KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
           +C+ CG +S +Y  F VLS+ +P         + K   + DC N FT  E L  D  W C
Sbjct: 780 RCKVCGGTSTTYQAFSVLSVPVP---------RGKSCNIIDCFNEFTKVENLETDELWAC 830

Query: 526 PNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSR 585
           P+C                                                   K+ +++
Sbjct: 831 PHC-------------------------------------------------KKKQPSTK 841

Query: 586 KLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI--LKNNKVVR----- 638
           KLT  +      LP  L+IHL RF  ++  KNN  + YP +L++     N+   R     
Sbjct: 842 KLTITR------LPRNLIIHLKRF-DNMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPGV 894

Query: 639 --------------YKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIK 684
                         YKL     H G+L  GHYTS V+K K    G     W  FDD  I+
Sbjct: 895 TEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDKGK---FG-----WRYFDDTKIR 946

Query: 685 QHHHDDFEAGKTEVSSSEVYVLFYERM 711
              +        E  +S  YVLFY R+
Sbjct: 947 PLKNS------YECITSNAYVLFYHRV 967

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score =  124 bits (312), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 121/440 (27%), Positives = 179/440 (40%), Gaps = 111/440 (25%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFKKM 362
           GL+N  N+CY+N IIQC+ GT     +FL   Y   +  + K   +  L++    L   M
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 622

Query: 363 Y---LNGGE--AIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTE 417
           Y   ++G +  +I+P  F   C  +   L     QQD QEF   +L  LHE+L+      
Sbjct: 623 YKEQVDGSKKISISPIKFKLACGSVN-SLFKTASQQDCQEFCQFLLDGLHEDLNQCGSNP 681

Query: 418 YYPDLVSYDANA----FQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNS 473
              +L S +A A      +  +   +W     LT   S I  +F+GQ  + LKC+ C ++
Sbjct: 682 PLKEL-SQEAEARREKLSLRIASSIEWER--FLTTDFSVIVDLFQGQYASRLKCKVCSHT 738

Query: 474 SHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDL 533
           S +Y  F VLS+ IPK       +    I +EDC   FT  E L  D  W CP+C     
Sbjct: 739 STTYQPFTVLSIPIPK------KNSRNNITIEDCFREFTKCENLEVDEQWLCPHC----- 787

Query: 534 KTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSS 593
                                                         ++ ++++LT  +  
Sbjct: 788 --------------------------------------------EKRQPSTKQLTITR-- 801

Query: 594 DFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV----------------------IL 631
               LP  L++HL RF  +L  KNN  + YP +L++                      I 
Sbjct: 802 ----LPRNLIVHLKRFD-NLLNKNNDFVIYPFLLDLTPFWANDFDGVFPPGVNDDELPIR 856

Query: 632 KNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDF 691
                 +Y+LYG   H G L  GHYT+ V K      GL ++ W+ FDD   K       
Sbjct: 857 GQIPPFKYELYGVACHFGTLYGGHYTAYVKK------GL-KKGWLYFDDTKYKP------ 903

Query: 692 EAGKTEVSSSEVYVLFYERM 711
              K +  +S  YVLFY R+
Sbjct: 904 VKNKADAINSNAYVLFYHRV 923

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score =  123 bits (309), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 119/441 (26%), Positives = 179/441 (40%), Gaps = 115/441 (26%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFKKM 362
           GL+N  N+CYIN IIQCL GT    ++FL   Y   +  + K   +  L++    L  +M
Sbjct: 516 GLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAKHFARLIHQM 575

Query: 363 YLNGG-------EAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTV 415
           + +         +A+ P  F   C  +   L     QQD+QEF   +L  LHE+L+    
Sbjct: 576 HQSAAFKKSDKNKAVRPYEFKMACGSIN-SLFRESGQQDSQEFCQFLLDGLHEDLNQCGG 634

Query: 416 TEYYPDLVSYDANAFQ----VNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCG 471
                +L S +A   +    +  +   +W     LT   S I  +F+GQ  + L+C+ C 
Sbjct: 635 NPPLKEL-SEEAEKMRERLSMRIASSIEWER--YLTRDFSVIVDLFQGQYASQLRCKVCN 691

Query: 472 NSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTT 531
           ++S +Y  F +L+  +P          +K   L DC   FT  E+L  D  W CP C   
Sbjct: 692 HTSTTYQPFSILAAPVP---------HAKSCYLLDCFKEFTKLEQLEKDEEWLCPYC--- 739

Query: 532 DLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVK 591
                                                           K+ +++KLT  +
Sbjct: 740 ----------------------------------------------KKKQPSTKKLTITR 753

Query: 592 SSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV-------------------ILK 632
                 LP  L+IHL RF  +L  KNN ++ YP  L++                   +  
Sbjct: 754 ------LPRNLIIHLKRF-DNLLNKNNVLVNYPFFLDLTPFWANDFDGRLPPGVTDELPS 806

Query: 633 NNKVV--RYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD 690
             +V   +YKLY   +H G+L  GHYT+ V+K      GLN+  W  FDD   +      
Sbjct: 807 RGQVAPFKYKLYAVASHSGSLYGGHYTAYVDK------GLNKG-WYYFDDTGYRPMR--- 856

Query: 691 FEAGKTEVSSSEVYVLFYERM 711
                TE  +S  YVLFY R+
Sbjct: 857 ---TPTECITSNAYVLFYHRV 874

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  122 bits (307), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 116/440 (26%), Positives = 180/440 (40%), Gaps = 111/440 (25%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-----KYPREVQLSRSIYVL 358
           GL+N  N+CY+N IIQC+ GT     +FL   Y   +  +     K       +R ++++
Sbjct: 566 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 625

Query: 359 FKKMYLNGGE-AIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTE 417
           +K+   +  + +I+P  F   C  +   L     QQD QEF   +L  LHE+L+      
Sbjct: 626 YKEQVDSSKKISISPIKFKLACGSVN-SLFKTASQQDCQEFCQFLLDGLHEDLNQCGSNP 684

Query: 418 YYPDLVSYDANA----FQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNS 473
              +L S +A A      +  +   +W     LT   S I  +F+GQ  + L+C+ C ++
Sbjct: 685 PLKEL-SQEAEARREKLSLRIASSIEWER--FLTTDFSVIVDLFQGQYASRLRCKVCNHT 741

Query: 474 SHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDL 533
           S +Y  F VLS+ IPK       +   KI +EDC   FT  E L  +  W CP+C     
Sbjct: 742 STTYQPFTVLSIPIPK------KNSQNKITIEDCFKEFTKCENLEVEEQWLCPHC----- 790

Query: 534 KTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSS 593
                                                         ++ ++++LT  +  
Sbjct: 791 --------------------------------------------KQRQPSTKQLTVTR-- 804

Query: 594 DFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV----------------------IL 631
               LP  L++HL RF  +   KNN  + YP +L++                      I 
Sbjct: 805 ----LPRNLIVHLKRFD-NFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGVNDDELPIR 859

Query: 632 KNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDF 691
                 +Y+LYG   H G L  GHYT+ V K      GL ++ W+ FDD   K       
Sbjct: 860 GQIPPFKYELYGVACHFGTLYGGHYTAYVKK------GL-KKGWLYFDDTKYKP------ 906

Query: 692 EAGKTEVSSSEVYVLFYERM 711
              +T+  +S  YVLFY R+
Sbjct: 907 VKNQTDAINSNAYVLFYHRV 926

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score =  122 bits (306), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 119/440 (27%), Positives = 172/440 (39%), Gaps = 111/440 (25%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-----KYPREVQLSRSIYVL 358
           GL+N  N+CY+N I+QC+ GT     +FL   Y   +  +     K       +R  +++
Sbjct: 584 GLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHININSKLGSKGVLARYFARLAHIM 643

Query: 359 FKKMYLNGGEA--IAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEEL---SNG 413
            +  Y    +A  + P  F +M       +    +QQD QEF   +L  LHE+L    N 
Sbjct: 644 HQTSYDQEKKAAIVRPTQF-RMAIASINSMFRNTNQQDCQEFCQFLLDGLHEDLNQCGNN 702

Query: 414 TVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNS 473
              +   +          +  +   +W     LT   S I  +F+GQ  + LKC  C N+
Sbjct: 703 PPLKELSEEAEKKRELLSLRIASSIEWER--FLTTNFSVIIDLFQGQYASRLKCSVCSNT 760

Query: 474 SHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDL 533
           S +Y  F VLS+ +P       T     + L DC N FT  E+L  D  W+CP C     
Sbjct: 761 STTYQPFSVLSVPLP-------TGTKSSVNLMDCFNEFTKCEKLEHDEYWNCPTC----- 808

Query: 534 KTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSS 593
                                                         K+ ++++LT  +  
Sbjct: 809 --------------------------------------------KKKQPSTKQLTITR-- 822

Query: 594 DFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV--ILKNNKVVR------------- 638
               LP  L+IHL RF   +  KN  +I YP  L++     N+K  R             
Sbjct: 823 ----LPRNLIIHLKRFDNRMN-KNTKLIDYPFNLDLTSFWANDKDDRLPPGVSIDELPAR 877

Query: 639 -------YKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDF 691
                  Y LY   NH G+L  GHYTS VNK      GL+R  W  FDD   +       
Sbjct: 878 GQIPPFKYSLYAVANHFGSLYGGHYTSYVNK------GLSRG-WYYFDDQNYR------L 924

Query: 692 EAGKTEVSSSEVYVLFYERM 711
               +EV +S  YVLFY R+
Sbjct: 925 VKKTSEVVNSNAYVLFYRRV 944

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score =  121 bits (303), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 126/443 (28%), Positives = 171/443 (38%), Gaps = 118/443 (26%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFL-QTDKYPREVQLSRSIYVLFKKM 362
           GL+N  N+CYIN IIQC+F TT    +FL   Y   + +  K   +  LS +   L K M
Sbjct: 526 GLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHINKQSKLGSKGVLSHNFAKLLKDM 585

Query: 363 YLNGGE--------AIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEEL---- 410
           Y             A+    F   C  +   L     QQD  EF   +L  LHE+L    
Sbjct: 586 YEENSSKKIGKKHGAVKTLQFKMACASVN-SLFKDASQQDCLEFCQFLLDGLHEDLNQCG 644

Query: 411 SNGTVTEYYPDLVSYDAN-AFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQR 469
           +N  + E  P+      N + +V  S   + Y    LT   S I  +F+GQ  + L+C+ 
Sbjct: 645 ANPPLKELSPEAEKMRENLSLRVASSIEWERY----LTTDFSIIVDLFQGQYASQLRCKV 700

Query: 470 CGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCG 529
           C  +S +Y  F VLS+ +P           K   L DC   FT  E L  D  W CP+C 
Sbjct: 701 CNRTSTTYQAFSVLSVPVP---------SGKSCGLLDCFIEFTKTENLEVDEQWFCPSC- 750

Query: 530 TTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTT 589
                                                             K+ +++KLT 
Sbjct: 751 ------------------------------------------------KKKQPSTKKLTI 762

Query: 590 VKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV-------------------I 630
            +      LP  L+IHL RF  ++  KNN  + YP IL++                   I
Sbjct: 763 TR------LPRNLIIHLKRF-DNMMNKNNIFVRYPQILDLTPFWANDSDGKLPPGITDEI 815

Query: 631 LKNNKV--VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHH 688
               +V    Y+LYG   H G L  GHYTS V  +K  E G     WI FDD   +    
Sbjct: 816 PARGQVPPFNYRLYGAACHFGTLYGGHYTSYV--DKGPEKG-----WIYFDDTVYRPVRF 868

Query: 689 DDFEAGKTEVSSSEVYVLFYERM 711
                 + E  S   YVLFY R+
Sbjct: 869 ------QNEFISPSAYVLFYHRI 885

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score =  120 bits (300), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 127/450 (28%), Positives = 182/450 (40%), Gaps = 122/450 (27%)

Query: 302  ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-----KYPREVQLSRSIY 356
            I GLQN  N+CY+N IIQCL GT     +FL   +  ++  +     K      LS+ I+
Sbjct: 746  IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYINLNSKLGSKGVLAKNLSKLIH 805

Query: 357  VLFKKMYL----------NGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
            +++    L          +G   I P  F   C  +  +L     QQD QEF   +L  L
Sbjct: 806  LMYNHSTLKNNGDKTKKKSGNNFIKPIQFRMACGSIN-NLFKNCSQQDCQEFCQFLLDAL 864

Query: 407  HEEL----SNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQME 462
            HE+L    SN  + E      S       +  +   +W     LT   S I  +F+GQ  
Sbjct: 865  HEDLNQCGSNPPLKELSTKAESM-REKLSLRIASSIEWER--YLTTDFSVIVDLFQGQYA 921

Query: 463  NILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNS 522
            + L+C+ C ++S +Y  F VLS+ IP         K K + L DC   FT  E L  D  
Sbjct: 922  SRLQCKTCIHTSTTYQPFSVLSVPIP---------KKKNLNLLDCFKDFTKIENLEVDEQ 972

Query: 523  WDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKW 582
            W CPNC +                                                 K+ 
Sbjct: 973  WFCPNCKS-------------------------------------------------KQP 983

Query: 583  NSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV------------- 629
            +++KLT  +      LP  L+IHL RF  +L +  N +I YP IL++             
Sbjct: 984  STKKLTITR------LPRNLIIHLKRFDNNLNKN-NNLIDYPFILDLTQFWADDFDGELP 1036

Query: 630  ------ILKNNKV--VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDD 681
                  + K  ++   +Y+LYG   H G+L  GHYT+ VNK      G+ R  W  FDD 
Sbjct: 1037 PGVTDELPKRGQIPPFKYRLYGAALHFGSLYGGHYTAFVNK------GI-RNGWYYFDDT 1089

Query: 682  YIKQHHHDDFEAGKTEVSSSEVYVLFYERM 711
              +   ++       E  SS  YVLFY R+
Sbjct: 1090 NYRPIKNE------REPISSNAYVLFYHRI 1113

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score =  119 bits (297), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 123/450 (27%), Positives = 174/450 (38%), Gaps = 125/450 (27%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQ-TDKYPREVQLSRSIYVLFKKM 362
           GL N  N+CY+N IIQCL GT     +FL   Y+  +    K   +  L++    L   M
Sbjct: 524 GLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHINFNSKLGSKGVLAKYFSQLVHNM 583

Query: 363 Y--------------LNGGE--AIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARL 406
           Y              L+G E  A+ P  F   C  +   L     QQD QEF   +L  L
Sbjct: 584 YRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTIN-SLFRDCSQQDCQEFCQFLLDGL 642

Query: 407 HEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSV-----LTDGLSPIDYIFRGQM 461
           HE+L+        P L      A ++   K       S+     LT   S I  +F+GQ 
Sbjct: 643 HEDLNQCGGN---PRLKELSEEAEKIR-EKLSMRIASSIEWERYLTTDFSVIVDLFQGQY 698

Query: 462 ENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDN 521
            + LKCQ CG +S +Y  F VLS+ +P +         K   + DC   FT  E L  D 
Sbjct: 699 ASQLKCQVCGRTSTTYQPFSVLSVPLPSL---------KSCNILDCFQEFTKVETLEKDE 749

Query: 522 SWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKK 581
            W CP+C                                                   ++
Sbjct: 750 QWSCPDC-------------------------------------------------KKRQ 760

Query: 582 WNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYP--LILNVILKNNKVVR- 638
            +++K+T  +      LP  L+IHL RF  ++  KNN  ++YP  L L     N+   R 
Sbjct: 761 PSTKKITITR------LPRNLIIHLKRF-DNMMNKNNVFVSYPHTLDLTPFWANDFDGRL 813

Query: 639 -----------------YKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDD 681
                            YKLY   +H G L  GHYT+ V+K        +++ W  FDD 
Sbjct: 814 PPGVTELPTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHKG-------SQRGWCYFDDT 866

Query: 682 YIKQHHHDDFEAGKTEVSSSEVYVLFYERM 711
             ++   D+      E  +S  YVLFY R+
Sbjct: 867 NWRRSRSDN------ECITSNAYVLFYHRV 890

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score =  115 bits (288), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 117/445 (26%), Positives = 169/445 (37%), Gaps = 120/445 (26%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFKKM 362
           GL N  N+CY+N IIQCL GT     +FL   Y+  +  + +   +  L++    L   M
Sbjct: 57  GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHVNLNSRLGSKGVLAKYFSQLIHNM 116

Query: 363 Y-----------LNGGE--AIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEE 409
                        +G E  A+ P  F   C  +   L     QQD QEF   +L  LHE+
Sbjct: 117 QQQAISASGRKSTSGNERNAVQPLHFKVACGSIN-SLFKTTSQQDCQEFCQFLLDGLHED 175

Query: 410 LSNGTVTEYYPDLVSYDANAFQ----VNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
           L+         +L S +A A +    +  +   +W     LT   S I  +F+GQ  + L
Sbjct: 176 LNQCGGNPALKEL-SEEAEAIREKLCMRIASSIEWER--YLTTDFSVIVDLFQGQYASQL 232

Query: 466 KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
            C+ CG +S +Y  F VLS+ +P         +  +  L DC   FT  E L  D  W C
Sbjct: 233 MCKVCGRTSTTYQPFSVLSVPVP---------RGARCNLLDCFEEFTKIETLEKDEQWSC 283

Query: 526 PNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSR 585
           P C                                                   K+ +++
Sbjct: 284 PRC-------------------------------------------------KVKQPSTK 294

Query: 586 KLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV---------------- 629
           K+T  +      LP  L+IHL RF  +L  KNN  ++YP  L++                
Sbjct: 295 KITITR------LPRNLIIHLKRF-DNLLHKNNIFVSYPHTLDLTPFWANDFDGSLPKGV 347

Query: 630 ----ILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ 685
                        Y LY    H G L  GHYT+ VNKE       ++  W  FDD   ++
Sbjct: 348 AELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKE-------DKNGWCYFDDTCWRK 400

Query: 686 HHHDDFEAGKTEVSSSEVYVLFYER 710
              +D      E  ++  YVLFY R
Sbjct: 401 AKSED------ECITTSAYVLFYHR 419

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score =  117 bits (292), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 123/441 (27%), Positives = 174/441 (39%), Gaps = 110/441 (24%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFK 360
           I GLQN  N+CY+N IIQCL GT     +FL   Y   +  + K   +  L++    L  
Sbjct: 558 IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHINLNSKLGSKGVLAKYFARLIH 617

Query: 361 KMYLNGGEAIAPN----GFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVT 416
            M+ +    +  N       KM       L     QQD QEF   +L  LHE+L+     
Sbjct: 618 LMHNHANPKLKNNYVRPAQFKMAVGSVNTLFKNCSQQDCQEFCQFLLDGLHEDLNQCGSN 677

Query: 417 EYYPDLVSYDANAFQVNPSKYQKWYEGSV-----LTDGLSPIDYIFRGQMENILKCQRCG 471
               +L S    A + N  K       S+     LT   S I  +F+GQ  + L+C+ C 
Sbjct: 678 PPLKELSS----AAEKNREKLSLRIASSIEWERFLTTDFSVIVDLFQGQYASRLQCEVCK 733

Query: 472 NSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTT 531
           ++S +Y  F VLS+ IP++       K  K+ + DC   FT  E L  D  W CP C   
Sbjct: 734 HTSTTYQPFSVLSVPIPRV------PKGVKVNILDCFKDFTKLELLDTDEQWLCPTC--- 784

Query: 532 DLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVK 591
                                                           K+ +++KLT  +
Sbjct: 785 ----------------------------------------------KKKQRSTKKLTITR 798

Query: 592 SSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV-------------------ILK 632
                 LP  L+IHL RF      KNN  I YP IL++                   + K
Sbjct: 799 ------LPRNLIIHLKRFDN-NLNKNNNFIDYPFILDLTQFWVDDFDGKLPPGVRDELPK 851

Query: 633 NNKV--VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD 690
             ++   +YKLYG  +H G+L  GHYT+ V+K   H        W  FDD   +   +  
Sbjct: 852 RGQIPPFKYKLYGVASHFGSLYGGHYTAYVDKGPKHG-------WYYFDDTNYRSIKN-- 902

Query: 691 FEAGKTEVSSSEVYVLFYERM 711
               K E  +S  Y+LFY R+
Sbjct: 903 ----KNEPITSSAYLLFYHRI 919

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 106/414 (25%), Positives = 162/414 (39%), Gaps = 105/414 (25%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFKKM 362
           GL N  N+CY++ IIQCL GT     +FL   Y+  +  + +   +  L+R    L  +M
Sbjct: 489 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQLIHQM 548

Query: 363 YLNGGE----------AIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSN 412
           Y  G +          A+ P  F   C  +       + QQD QEF   +L  LHE+L+ 
Sbjct: 549 YQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHEDLNQ 607

Query: 413 GTVTEYYPDLVSYDANAFQVNPSKYQKWYEGS-VLTDGLSPIDYIFRGQMENILKCQRCG 471
                   +L        ++ P +     E    LT   S I  +F+GQ  + L+C+ C 
Sbjct: 608 CGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTDFSVIVDLFQGQYASQLQCKVCQ 667

Query: 472 NSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTT 531
            +S +Y  F VLS+ +P          ++   L DC   FT  E L  +  W CP+C   
Sbjct: 668 RTSTTYQPFSVLSVPVP---------STRTCTLTDCFTEFTKIETLEQEEQWSCPSC--- 715

Query: 532 DLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVK 591
                                                           ++ +++K+T  +
Sbjct: 716 ----------------------------------------------KKRQPSTKKITITR 729

Query: 592 SSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI----------LKNNKV----- 636
                 LP  L+IHL RF  ++  KNN  ++YP +L++           + NN V     
Sbjct: 730 ------LPRNLIIHLKRF-DNMLNKNNVFVSYPSVLDLTAFWANDYDKKVTNNNVELPSR 782

Query: 637 -----VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ 685
                  Y+LYG   H G L  GHYT+ VN  K   +G     W  +DD   +Q
Sbjct: 783 GQVPPFNYQLYGIACHDGTLRAGHYTAYVN--KGAVLG-----WCYYDDTNWRQ 829

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score =  110 bits (275), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 119/443 (26%), Positives = 167/443 (37%), Gaps = 118/443 (26%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFKKM 362
           GL N  N+CY+N IIQCL GT     +FL   Y+  +  + K   +  L++    L   M
Sbjct: 496 GLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHVNLNSKLGSKGVLAKYFSQLIHTM 555

Query: 363 Y---------LNGGE--AIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELS 411
                      N G+  A+ P  F   C  +   L     QQD QEF   +L  LHE+L+
Sbjct: 556 QQQAASASTKQNSGDKTAVQPLHFKVACGSIN-SLFRSSSQQDCQEFCQFLLDGLHEDLN 614

Query: 412 NGTVTEYYPDLVSYDANAFQ----VNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKC 467
                    +L S +A   +    +  +   +W     LT   S I  +F+GQ  + L C
Sbjct: 615 QCGGNPALKEL-SEEAEGIREKLCMRIASSIEWER--YLTTDFSVIVDLFQGQYASQLTC 671

Query: 468 QRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPN 527
           + CG +S +Y  F VLS+ +P  S         K  + DC   FT  E L  D  W CP 
Sbjct: 672 KVCGRTSTTYQPFSVLSVPVPSGS---------KCDIIDCFKEFTKVETLEKDEQWSCPR 722

Query: 528 CGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKL 587
           C                                                   K+ +++K+
Sbjct: 723 CKC-------------------------------------------------KQPSTKKI 733

Query: 588 TTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI----------------- 630
           T  +      LP  LVIHL RF  +L  KNN  ++YP  L++                  
Sbjct: 734 TITR------LPRNLVIHLKRF-DNLLHKNNIFVSYPHTLDLTPFWANDFDGRLPPGVAE 786

Query: 631 LKNNKVV---RYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHH 687
           L     V    Y LY    H G L  GHYTS V+K        ++  W  FDD   ++  
Sbjct: 787 LPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDKG-------DKAGWCYFDDTSWRK-- 837

Query: 688 HDDFEAGKTEVSSSEVYVLFYER 710
                  + E  +   YVLFY R
Sbjct: 838 ----AKSQGECITLSAYVLFYHR 856

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  105 bits (261), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/261 (30%), Positives = 122/261 (46%), Gaps = 26/261 (9%)

Query: 289 TIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPR 347
           TI +++ +L    I GL+N  N CY+N I+QCL GT     +FL   Y  F+  D     
Sbjct: 432 TILNNSQVLDLDLIVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSRGS 491

Query: 348 EVQLSRSIYVLFKKMYLNGGEAIAPN---------GFLKMCKKLRPDLNIPDDQQDTQEF 398
           +  L+++  +L   M+ +G     PN          F K+C  + P +     QQD QEF
Sbjct: 492 KGLLAKNFAILVNNMHRHGA-FTPPNVRTIPVQTIQFKKICGHINP-MYSDSMQQDCQEF 549

Query: 399 LLIILARLHEELSNGTVTEYYPDLVSYDANA---FQVNPSKYQKWYEGSVLTDGLSPIDY 455
              +L  LHE+L+     ++   L   +        +  +   +W E  +LTD  + ID 
Sbjct: 550 CQFLLDGLHEDLNQNGSKKHLKQLSDEEERMREKMSIRKASALEW-ERFLLTDFSAIID- 607

Query: 456 IFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDE 515
           +F+GQ  + L+CQ C ++S +Y TF VLS+ +P++         K   + DC   FT  E
Sbjct: 608 LFQGQYASRLQCQVCEHTSTTYQTFSVLSVPVPRV---------KTCNILDCFREFTKCE 658

Query: 516 ELSGDNSWDCPNCGTTDLKTK 536
            L  D  W CP C      TK
Sbjct: 659 RLGVDEQWSCPKCLKKQPSTK 679

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 61/146 (41%), Gaps = 33/146 (22%)

Query: 585 RKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI------LKNNKVV- 637
           +K  + K      LP  L+I+L RF   +  KNN  + YP  L++         +  +V 
Sbjct: 673 KKQPSTKQLKITRLPKKLIINLKRFDNQMN-KNNVFVQYPYSLDLTPYWARDFNHEAIVN 731

Query: 638 ------------RYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ 685
                       RY+LYG   H G+L  GHYTS V K         ++ W  FDD   + 
Sbjct: 732 EDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-------KKGWYFFDDSLYRP 784

Query: 686 HHHDDFEAGKTEVSSSEVYVLFYERM 711
                     TE  +   YVLFYER+
Sbjct: 785 ------ITFSTEFITPSAYVLFYERI 804

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  101 bits (251), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 78/128 (60%)

Query: 12  VRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIGGYYLYL 71
           V+++Y+ DIK    QLRL  L  LL+H A+L E +       +  +AL+A+I+G YYLYL
Sbjct: 23  VQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDALSAYIVGCYYLYL 82

Query: 72  VIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSNRISRTI 131
           +IPQS QFQT+N  YS Y   K  YQ+E  M+ V  +V+ E + I+D+   +     R I
Sbjct: 83  IIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDKSYQEPEPTKRVI 142

Query: 132 TRKRAYSL 139
            R RA+S+
Sbjct: 143 PRGRAFSV 150

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 106/251 (42%), Gaps = 33/251 (13%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFKKM 362
           GL+N  N+CY+N IIQCL        +FL   Y   +  + K   +  L++S   L   M
Sbjct: 736 GLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHININSKLGSKGILAKSFARLVHSM 795

Query: 363 YLNG-----------GEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELS 411
           Y NG              + P  F   C  +   L    +QQD QEF   +L  LHE+L+
Sbjct: 796 YQNGTLSIKNHSNKKNPPVQPITFKTACGSIN-SLFKGSNQQDCQEFCQFLLDGLHEDLN 854

Query: 412 NGTVTEYYPDLVSYDANA------FQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
                   P L      A        +  +   +W     LT   S I  +++GQ  + L
Sbjct: 855 QCGAN---PPLKELSTEAERMREKLSLRIASSIEWER--FLTTDFSVIIDLYQGQYASQL 909

Query: 466 KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDC 525
           KCQ CG +S +Y TF VLS+ +P         K+K I L DC N FT  E L  D  W C
Sbjct: 910 KCQVCGTTSTTYQTFSVLSVPVP---------KNKSIHLLDCFNEFTKTEFLGKDELWSC 960

Query: 526 PNCGTTDLKTK 536
             C      TK
Sbjct: 961 TECKKKQPSTK 971

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 65/144 (45%), Gaps = 35/144 (24%)

Query: 585  RKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV--------------- 629
            +K  + K+     LP  L+IHL RF  ++  KNN  + YPLIL++               
Sbjct: 965  KKQPSTKTLTITRLPKNLIIHLKRFD-NMLHKNNVFVKYPLILDLTNYWANDFDGKLPPG 1023

Query: 630  ----ILKNNKV--VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
                +    ++   +Y+L G   H+G+L  GHYT+ VNK      GL +  W  FDD   
Sbjct: 1024 VTEELPARGQIPPFKYELSGVALHMGSLYGGHYTAYVNK------GL-KNGWYYFDDTVY 1076

Query: 684  KQHHHDDFEAGKTEVSSSEVYVLF 707
            +   +       +E+ +   YVLF
Sbjct: 1077 RSIKYS------SEMITQNAYVLF 1094

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 121/262 (46%), Gaps = 28/262 (10%)

Query: 289 TIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP-R 347
           TI +++ ++    I GL+N  N CY+N I+QCL GT     +FL   Y  F+  D     
Sbjct: 432 TILNNSQVIDLDFIVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSKGS 491

Query: 348 EVQLSRSIYVLFKKMYLNGG--------EAIAPNGFLKMCKKLRPDLNIPDD--QQDTQE 397
           +  L+++   L + M+ N            +    F K+C  +    +I  D  QQD QE
Sbjct: 492 KGLLAKNFATLVRNMHRNSAFMPVNSRTTPVQTIQFKKICGHIN---SIYSDSMQQDCQE 548

Query: 398 FLLIILARLHEELSNGTVTEYYPDLVSYDAN---AFQVNPSKYQKWYEGSVLTDGLSPID 454
           F   +L  LHE+L+     E+   L   +        +  +   +W E  +LTD  + ID
Sbjct: 549 FCQFLLDGLHEDLNQNGGKEHLKQLTEEEEQKREKMTIRKASALEW-ERFLLTDFSAIID 607

Query: 455 YIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSD 514
            +F+GQ  + L+CQ C  +S +Y TF VLS+ +P+I+            + DC   FT  
Sbjct: 608 -LFQGQYASRLQCQACDRTSTTYQTFSVLSVPVPRIT---------TCNILDCFREFTKC 657

Query: 515 EELSGDNSWDCPNCGTTDLKTK 536
           E+L  D  W CP C      TK
Sbjct: 658 EKLGIDELWSCPRCLKKQPSTK 679

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 62/146 (42%), Gaps = 33/146 (22%)

Query: 585 RKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI------LKNNKVV- 637
           +K  + K      LP  L+I+L RF   +  KNN  + YP  L++         +  +V 
Sbjct: 673 KKQPSTKQLKITRLPKKLIINLKRFDNQMN-KNNVFVQYPYFLDLTPYWARDFNHEAIVN 731

Query: 638 ------------RYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ 685
                       RY+LYG   H G+L  GHYTS V K         ++ W  FDD   + 
Sbjct: 732 EDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-------KKGWYFFDDSIYRP 784

Query: 686 HHHDDFEAGKTEVSSSEVYVLFYERM 711
              +D      E  +   YVLFYER+
Sbjct: 785 IRFND------EFITPNAYVLFYERI 804

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 120/266 (45%), Gaps = 23/266 (8%)

Query: 287 LPTIEDSTSLLSQLSI---TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD 343
           LP   +   ++ +L +   TGL+N  N+CY+N +IQCL  T     L+LT  +   +  +
Sbjct: 439 LPPTANPQQIVPKLDLDFTTGLENVKNSCYMNCVIQCLLSTHDLTKLYLTNAFLTQINVE 498

Query: 344 -KYPREVQLSRSIYVLFKKMYLNGG---------EAIAPNGFLKMCKKLRPDLNIPDDQQ 393
            K   +  LS++   L + MY               +AP  F   C  +   +     +Q
Sbjct: 499 NKLGSKGFLSKNFANLIQTMYKKSAFQPYNPNFLHPVAPLEFKNACGMMN-SIYAESTEQ 557

Query: 394 DTQEFLLIILARLHEELSNGTVTEYYPDLVSYDAN---AFQVNPSKYQKWYEGSVLTDGL 450
           D QEF   +L  LHE+L+  +      +L + +A    +  +  +   +W   S LT   
Sbjct: 558 DCQEFCEFLLDGLHEDLNQCSGNPRPKELSANEAELRESLSMRIASEIEW--ESFLTTNF 615

Query: 451 SPIDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINL 510
           SPI  +F+GQ  + L+C  C ++S +Y  F +LS+ +P +      S  +   + DC   
Sbjct: 616 SPIINLFQGQYASRLQCLICQHTSTTYQPFSLLSIPVPSMVF----SNGQTCNILDCFKE 671

Query: 511 FTSDEELSGDNSWDCPNCGTTDLKTK 536
           FT  E L  D  W CP C    + TK
Sbjct: 672 FTKCERLDNDEKWFCPKCRRKQISTK 697

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 64/150 (42%), Gaps = 35/150 (23%)

Query: 585 RKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI----------LKNN 634
           RK  + K      LP  L+IH  RF  +   KNN  + YP  L++           L  N
Sbjct: 691 RKQISTKQLKITRLPKNLIIHFKRFD-NFMNKNNIFVQYPYQLDLTSLWVNDYDGKLPPN 749

Query: 635 -----------KVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
                         +YKL     H GNL +GHYT+ V+K      GL R  W  FDD   
Sbjct: 750 FNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDK------GLYRG-WFRFDD--- 799

Query: 684 KQHHHDDFEAGKTEVSSSEVYVLFYERMDE 713
               +   + G TE  + + Y+LFY+R+ E
Sbjct: 800 --ASYRPVKFG-TEFLTPDAYLLFYQRIYE 826

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 119/263 (45%), Gaps = 28/263 (10%)

Query: 288 PTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKY-P 346
           P I++ST +     I GL+N  N CY+N I+QCL GT     +FL   Y  F+  D    
Sbjct: 414 PPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFDNMRG 473

Query: 347 REVQLSRSIYVLFKKMYLNGG-----EAIAPN---GFLKMCKKLRPDLNIPDD--QQDTQ 396
            +  L+++   L   M+ +G        I P     F K C  +    +I  D  QQD Q
Sbjct: 474 SKGLLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHIN---SIYSDSMQQDCQ 530

Query: 397 EFLLIILARLHEELSNGTVTEYYPDLVSYDANA---FQVNPSKYQKWYEGSVLTDGLSPI 453
           EF   +L  LHE+L+     ++   L   +        +  +   +W E  +LTD  + I
Sbjct: 531 EFCQFLLDGLHEDLNQNGGKKHLKQLSEEEERTRENMSIRKASALEW-ERFLLTDFSAVI 589

Query: 454 DYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTS 513
           D +F+GQ  + L+CQ C ++S +Y TF VLS+ +P+I             + DC   FT 
Sbjct: 590 D-LFQGQYASRLQCQACEHTSTTYQTFSVLSVPVPRI---------MTCNVLDCFREFTK 639

Query: 514 DEELSGDNSWDCPNCGTTDLKTK 536
            E+L     W C  C      TK
Sbjct: 640 CEKLGIGEQWSCSRCLKKQPSTK 662

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 62/146 (42%), Gaps = 33/146 (22%)

Query: 585 RKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI------LKNNKVV- 637
           +K  + K      LP  L+I+L RF   +  KNN  + YP  L++         +  ++ 
Sbjct: 656 KKQPSTKQLKITRLPKKLIINLKRFDNQM-HKNNVFVQYPCFLDLTPYWARDFNHEAIID 714

Query: 638 ------------RYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ 685
                       RY+LYG   H G+L  GHYTS V K         ++ W  FDD   + 
Sbjct: 715 EDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-------QKGWYFFDDTIYRL 767

Query: 686 HHHDDFEAGKTEVSSSEVYVLFYERM 711
              ++      E  +   YVLFYER+
Sbjct: 768 IRFNN------EFITPNAYVLFYERI 787

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 104/246 (42%), Gaps = 23/246 (9%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLFKKM 362
           GL N  N+CY+N IIQCL G      +FLT  YR  +  + +   +  L+     L +KM
Sbjct: 433 GLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVNVNSRLGSKGLLANYFSQLVQKM 492

Query: 363 YLNG-----------GEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELS 411
           Y  G             A+ P  F   C  +   L     QQD QEF   +L  LHE+L+
Sbjct: 493 YQQGKLQAYNNTNMESTAVHPTQFKLACGSIN-SLFKGKQQQDCQEFCQFLLDGLHEDLN 551

Query: 412 NGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGS-VLTDGLSPIDYIFRGQMENILKCQRC 470
                    +L        +  P +     E    LT   S I  +F+GQ  + L+C+ C
Sbjct: 552 QCGTNPPLKELSPEAEKMRETMPMRIASAIEWERYLTTDFSVIVDLFQGQYASQLRCKIC 611

Query: 471 GNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGT 530
            ++S +Y  F VLS+ +P         +++   + DC   FT  E L  D  W CP C  
Sbjct: 612 AHTSTTYQAFSVLSVPVP---------RARSCTIYDCFKEFTKLETLEKDELWYCPYCKQ 662

Query: 531 TDLKTK 536
               TK
Sbjct: 663 RQPSTK 668

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 60/136 (44%), Gaps = 36/136 (26%)

Query: 598 LPPILVIHLSRFYYDLTRKNNTVITYPLILNV-----------ILKNNKV---------- 636
           LP  L+IHL RF  ++  KNN  + YP  L++           + K+N V          
Sbjct: 675 LPNNLIIHLKRFD-NMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDNGVSLPLRGQKPP 733

Query: 637 VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKT 696
             Y+L+   +H G L  GHYTS V+K         R  W +FDD   ++    D      
Sbjct: 734 FNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDDVSWRKIRRKD------ 779

Query: 697 EVSSSEVYVLFYERMD 712
           E  +   YVLFY R++
Sbjct: 780 EYITPNAYVLFYRRVN 795

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 94.4 bits (233), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 115/249 (46%), Gaps = 28/249 (11%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQ-TDKYPREVQLSRSIYVLFK 360
           I GL+N  N CY+N I+QCL GT     +FL   Y  F+   +    +  L+++   L  
Sbjct: 463 IVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFGNTRGSKGLLAKNYATLVH 522

Query: 361 KMYLNGG--------EAIAPNGFLKMCKKLRPDLNIPDD--QQDTQEFLLIILARLHEEL 410
            M+ +G           +    F K+C  +    +I  D  QQD QEF   +L  LHE+L
Sbjct: 523 NMHRHGAFKPPHSRTTPVQTLQFKKVCGHIN---SIYSDSMQQDCQEFCQFLLDGLHEDL 579

Query: 411 SNGTVTEYYPDLVSYDAN---AFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKC 467
           +     ++   L   +     +  +  +   +W E  +LTD  + ID +F+GQ  + L+C
Sbjct: 580 NQNGGKKHLKQLSEQEERMRESMSIRKASALEW-ERFLLTDFSAIID-LFQGQYASRLQC 637

Query: 468 QRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPN 527
           Q C ++S +Y TF VLS+ +P+I         +   + DC   FT  E+L  D  W C  
Sbjct: 638 QACEHTSTTYQTFSVLSVPVPRI---------RTCNILDCFREFTKCEKLGVDEQWSCSK 688

Query: 528 CGTTDLKTK 536
           C      TK
Sbjct: 689 CLKKQPSTK 697

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 63/147 (42%), Gaps = 35/147 (23%)

Query: 585 RKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVI------LKNNKVV- 637
           +K  + K      LP  L+I+L RF   +  KNN  + YP  L++         +  +V 
Sbjct: 691 KKQPSTKQLKITRLPKKLIINLKRFDNQMN-KNNVFVQYPCFLDLTPYWARDFNHESIVN 749

Query: 638 ------------RYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDD-YIK 684
                       RY+LYG   H G+L  GHYTS V K         ++ W  FDD  Y  
Sbjct: 750 EDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYKGP-------QKGWYFFDDSVYCP 802

Query: 685 QHHHDDFEAGKTEVSSSEVYVLFYERM 711
              +D+F        +   YVLFYER+
Sbjct: 803 IRFNDEF-------ITPNAYVLFYERI 822

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 70/221 (31%), Positives = 100/221 (45%), Gaps = 11/221 (4%)

Query: 296 LLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDK---YPREV--Q 350
           L+  L ITGL N  NTCY+NS +QC+    +FR+ FL   Y   L TD    Y   V   
Sbjct: 314 LVPSLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPLGYQGHVAEA 373

Query: 351 LSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEEL 410
            S  I  LF    +    A APN F          +     QQD+QEFL  +L  LHE+L
Sbjct: 374 FSELIRCLFGDKLVQFS-AYAPNHFKATIGHFN-SMFSGYLQQDSQEFLAFLLDSLHEDL 431

Query: 411 SNGTVTEYY--PDLVS-YDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKC 467
           +      Y   P L S  D N F++        ++  +L +  S I  +F G  ++ L+C
Sbjct: 432 NRIDKKPYVEKPSLPSTADLNDFRIVKKLADDTWKAHLLRND-SVITDLFVGLYKSTLEC 490

Query: 468 QRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCI 508
             C N S ++  +  L+L +P  S++    K   +    CI
Sbjct: 491 PECQNISITFDPYNDLTLPLPVKSMWHSHIKIFPLNAPPCI 531

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 25/39 (64%)

Query: 498 KSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTK 536
           K+K+I L DC+NLF+  E LS ++SW CP C      TK
Sbjct: 892 KNKEITLNDCLNLFSKPEILSLNDSWYCPTCKEHRQATK 930

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 73.6 bits (179), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 103/235 (43%), Gaps = 28/235 (11%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQL-----SRSIY 356
           I G+QN  N CY+N IIQCL     F + FL   Y   +  +       L     ++ I 
Sbjct: 343 IKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTINVNSRLGHQGLVVKNWAKIIQ 402

Query: 357 VLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVT 416
             F+    N   A++   F +    L P+      Q D  EF L +L  +HE+ + G   
Sbjct: 403 AFFQVSQENIQPAVSITEFREQWANLFPEYG-KYQQHDCSEFCLRLLEEIHEDSNWGRPQ 461

Query: 417 EYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSP-IDYIFRGQMENILKCQRCGNSSH 475
                  + DA A QV+  + + W   ++   G S  I   F+GQ+++ L CQ C   S+
Sbjct: 462 -------NSDA-AMQVDDYR-EAW---NLYRKGNSSYIVDTFKGQIKSQLTCQVCQTQSN 509

Query: 476 SYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGT 530
           +Y  F +L+L IP +S+           + DC+        L+GD+ W C  C T
Sbjct: 510 NYEPFSILNLPIPLVSM---------CHIYDCMKELFKVHVLTGDDRWYCSTCKT 555

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 53/117 (45%), Gaps = 19/117 (16%)

Query: 598 LPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKV----VRYKLYGTVNHIGNLVN 653
           +P +L+IH +RF  +L  K    + YP +L++   N  +    V YKL     H G L +
Sbjct: 568 VPEVLIIHFNRFD-NLLNKKECFVKYPYLLDLSQGNGLLGKCDVPYKLVAVACHTGTLFS 626

Query: 654 GHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYER 710
           GHYT+     KN E G     W  FDD   K            E  S   Y+LFY++
Sbjct: 627 GHYTAYCF--KNSENG-----WYHFDDTQCK-------PVSNGECISQSAYLLFYQK 669

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 99/257 (38%), Gaps = 41/257 (15%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTK-------------------KYRLFLQT 342
           I GL+N  N+CY+N IIQCL        + L                     K+   L  
Sbjct: 428 IIGLENMSNSCYMNCIIQCLLSVPELIQICLNNSFLKHINMESKLGSKGVIMKHFAKLIQ 487

Query: 343 DKYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLII 402
           D + ++V+  RS++             +    F   C  +   +     QQD QEF   +
Sbjct: 488 DMHSQQVKTGRSLF----------SYPVKTIDFKNACASVS-SIYSGSQQQDCQEFCEFL 536

Query: 403 LARLHEELSNGTVTEYYPDLVSYDAN---AFQVNPSKYQKWYEGSVLTDGLSPIDYIFRG 459
           L  LHE+L+         +L   +        +  +    W   + L +  S I  +F G
Sbjct: 537 LDGLHEDLNQCGGNPPARELTDQEERLREGLCMRVASSMAW--ENFLHNNFSLIIDLFAG 594

Query: 460 QMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSG 519
           Q  + L+C  C  +S +Y  F +LS+ +P       +S+  +  + DC   FT  E L  
Sbjct: 595 QYGSQLRCCVCQYTSTTYQPFTLLSVPVP------LSSRVSRCSIIDCFQEFTKCERLDK 648

Query: 520 DNSWDCPNCGTTDLKTK 536
           D  W CP C      TK
Sbjct: 649 DEEWFCPQCKRKQPSTK 665

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 64/149 (42%), Gaps = 36/149 (24%)

Query: 585 RKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNV--------------- 629
           RK  + K      LP  L+IH  RF  ++  KNN  I YP  L++               
Sbjct: 659 RKQPSTKQLKITRLPKNLIIHFKRFD-NMMNKNNIFIQYPYELDLTPFWVNDFNGELPLG 717

Query: 630 -----ILKNNKV--VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDY 682
                + K  +V   +Y+L     H+G L +GHYT+ VN  K  ++G     W  FDD  
Sbjct: 718 MTNSLLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVN--KGPDVG-----WYYFDDS- 769

Query: 683 IKQHHHDDFEAGKTEVSSSEVYVLFYERM 711
                H   +   TE  + + Y+LFY R+
Sbjct: 770 ----SHRIVKIA-TEYMNPDAYLLFYHRV 793

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 95/214 (44%), Gaps = 25/214 (11%)

Query: 296 LLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-----KYPREVQ 350
           LLS     GL N  NTCY+NS +QCL     F+D FL   Y   +  +     K      
Sbjct: 339 LLSSKGTIGLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWA 398

Query: 351 LSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEEL 410
            +  +  LF K + +   + +P  F      L   +     QQD+QEFL  +L  LHE+L
Sbjct: 399 FASMVQALFGKRH-SAATSYSPRNFKNTIGHLN-SMFSGYQQQDSQEFLAFLLDGLHEDL 456

Query: 411 SNGTVTEYY---PDLVSYDANA-FQV------NPSKYQKWYEGSVLTDGLSPIDYIFRGQ 460
            N  + + Y   P+L S D  A F+V      +     K    SV+TD       +F G 
Sbjct: 457 -NRIIEKPYVEKPELTSTDDTAEFKVIKKLADDTWGKHKLRNDSVITD-------LFVGL 508

Query: 461 MENILKCQRCGNSSHSYSTFYVLSLAIPKISLYS 494
            ++ L C  C  +S ++  +  L+L +P  S +S
Sbjct: 509 YKSTLICPVCKKTSVTFDPYNDLTLPLPVNSTWS 542

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 78/229 (34%), Gaps = 78/229 (34%)

Query: 496  TSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXX 555
             S  KKI L DC+ LF++ E L   +SW CPNC      TK  E                
Sbjct: 956  ASGEKKITLHDCLTLFSTPEVLGATDSWFCPNCKEHRQATKQIEL--------------- 1000

Query: 556  XXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRF--YYDL 613
                                      WN+              P IL+IHL RF      
Sbjct: 1001 --------------------------WNA--------------PDILLIHLKRFENQRSF 1020

Query: 614  TRKNNTVITYP-----LILNVILKN-NKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHE 667
            + K    + +P     +   ++ KN +K   Y L    NH G L  GHYT+ V       
Sbjct: 1021 SDKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLIAVDNHYGGLGGGHYTAYVKNIDGK- 1079

Query: 668  IGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYERMDESEY 716
                   W  FDD  + +   +   AG         Y+LFY R  ES Y
Sbjct: 1080 -------WYYFDDSRVSETLPERSIAGS-------AYLLFYRRRVESGY 1114

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 91/200 (45%), Gaps = 17/200 (8%)

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDK---YPREVQLSRSIYV 357
            ITGL N  NTCY+NS +QCL      RD FL   +   + +D    Y   +  + S+ V
Sbjct: 300 GITGLTNLGNTCYMNSALQCLVHIPELRDYFLYDGFTSEINSDNPLGYQGNIAKAFSLLV 359

Query: 358 --LFKKMYLNG-GEAIAPNGF---LKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELS 411
             LF   Y +   +A +PN F   +  C  +         QQD+QEFL  +L  LHE+L 
Sbjct: 360 KSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYM----QQDSQEFLAFLLDGLHEDL- 414

Query: 412 NGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSV---LTDGLSPIDYIFRGQMENILKCQ 468
           N    + Y +  S   N+   +    +K  E +    L    S +  +F    E+ L+C 
Sbjct: 415 NRVHDKPYIEKPSLSPNSDVTDRDTIKKLAEDTWKMHLLRNDSIVTDLFVALYESTLECP 474

Query: 469 RCGNSSHSYSTFYVLSLAIP 488
            C N S ++  +  L+L +P
Sbjct: 475 ECRNVSITFDPYNDLTLPLP 494

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 51/123 (41%), Gaps = 23/123 (18%)

Query: 599  PPILVIHLSRF--YYDLTRKNNTVITYP-----LILNVILKNNKVVRYKLYGTVNHIGNL 651
            P +L+IHL RF      + K +  + +P     +  +++ ++ +   Y L    NH G L
Sbjct: 912  PDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIAVDNHFGGL 971

Query: 652  VNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYERM 711
              GHYT+ V              W  FDD  + +   +   AG         Y+LFY R 
Sbjct: 972  GGGHYTAYVKTNDK---------WFYFDDSRVTETKPESSIAGS-------AYLLFYLRR 1015

Query: 712  DES 714
             ES
Sbjct: 1016 TES 1018

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 498 KSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTK 536
           + + I L DC+ LF+  E LS ++SW CP C      TK
Sbjct: 866 EKRAISLHDCLKLFSKKEVLSMNDSWYCPTCKDHRQATK 904

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 99/226 (43%), Gaps = 36/226 (15%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQ--LSRSIYVLFKK 361
           GL N  NTCY+NS +QCL      RD F+   +   +  +  P   Q  ++RS + L + 
Sbjct: 322 GLSNLGNTCYMNSGLQCLVHIPQIRDYFVYNGFEKEINVNN-PLGFQGHMARSFHGLIQS 380

Query: 362 MYLNGGEAIAP--------------NGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLH 407
           ++   G++IAP                F  M    +        QQD+QEFL  +L  LH
Sbjct: 381 LF---GDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQ--------QQDSQEFLAFLLDSLH 429

Query: 408 EELSNGTVTEYYPDLVSY----DANAFQ-VNPSKYQKWYEGSVLTDGLSPIDYIFRGQME 462
           E+L N  V + Y +  S     D N F  +     + W    +  D +  I  IF G  +
Sbjct: 430 EDL-NRIVEKPYVEKPSLKPGDDINDFDTIKKLANETWKSHLMRNDSI--ITDIFVGMYK 486

Query: 463 NILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCI 508
           + L+C  C N S ++  +  L+L +P  S ++   +    KL  C+
Sbjct: 487 STLECPECSNVSITFDPYNDLTLPLPINSSWNAQVRIFPSKLPPCM 532

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 78/219 (35%), Gaps = 77/219 (35%)

Query: 500  KKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXX 559
            ++  L+DC+NLF+  E L   +SW CPNC      TK  E                    
Sbjct: 891  QETTLKDCLNLFSKKEVLGMSDSWYCPNCKEHRQATKKIEL------------------- 931

Query: 560  XXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRF--YYDLTRKN 617
                                  WN+              P + +IHL RF      + K 
Sbjct: 932  ----------------------WNT--------------PDVFLIHLKRFENTRSFSDKI 955

Query: 618  NTVITYP-----LILNVILKNN-KVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLN 671
            +  I +P     +   ++ K++ +   Y L    NH G +  GHYT+ V   KN    L 
Sbjct: 956  DATILFPIEDLDMSEYLVYKDDPRGSVYDLIAVDNHYGGMGGGHYTAYV---KN----LT 1008

Query: 672  RQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYER 710
             Q W  FDD  + +   +   AG         Y+LFY R
Sbjct: 1009 DQNWYYFDDSRVSKTSPEKSIAGS-------AYLLFYLR 1040

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 88/201 (43%), Gaps = 12/201 (5%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDK---YPREVQLSRSIYV--L 358
           GL N  NTCY+NS +QCL      RD FL   Y   L TD    Y   V  + S  V  L
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELNTDNLIGYKGYVAKAFSSLVQNL 383

Query: 359 FKKMYLNGG--EAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELS---NG 413
           F       G   +  PN F           +    QQD+QEFL  +L  LHE+L+   N 
Sbjct: 384 FGDTITKQGTNSSFGPNHFKSTVGHFNSMFS-GYLQQDSQEFLAFLLDSLHEDLNRIINK 442

Query: 414 TVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNS 473
             TE        D N   V  S   + ++  +L +  S I  +F G  ++ L+C  C N 
Sbjct: 443 PSTEKPSLKEGDDYNDPAVIKSLADETWKMHLLRND-SVITDLFVGMYKSTLECPECTNV 501

Query: 474 SHSYSTFYVLSLAIPKISLYS 494
           S ++  +  L+L +P  S +S
Sbjct: 502 SITFDPYSDLTLPLPVDSTWS 522

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 21/29 (72%)

Query: 500 KKIKLEDCINLFTSDEELSGDNSWDCPNC 528
           K+I L DC+NLF+  E L  ++SW CP+C
Sbjct: 870 KEITLNDCLNLFSKREVLGLNDSWYCPHC 898

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 54/125 (43%), Gaps = 22/125 (17%)

Query: 599  PPILVIHLSRF--YYDLTRKNNTVITYP---LILNVILKNNKVVR---YKLYGTVNHIGN 650
            P +L+IHL RF      + K +  + +P   L ++  L +    R   Y LY   NH G 
Sbjct: 914  PDVLLIHLKRFENQRSFSDKIDATVNFPIENLDMSPYLVHKDDPRGTVYDLYAVDNHYGG 973

Query: 651  LVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYER 710
            L  GHYT+ V    +++       W  FDD  +       +E    +  S   Y+LFY R
Sbjct: 974  LGGGHYTAYVKNFIDNK-------WYYFDDSRV-------YETDPEKSVSGSAYLLFYLR 1019

Query: 711  MDESE 715
               +E
Sbjct: 1020 RGSNE 1024

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 98/207 (47%), Gaps = 11/207 (5%)

Query: 295 SLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQ--LS 352
           +L S     GL N  NTCY+NS +QC+    +FRD FL   ++  +  +  P   Q  ++
Sbjct: 322 NLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFLYGTFQKEV-NEGNPLGYQGYMA 380

Query: 353 RSIYVLFKKMY---LNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEE 409
           R+   L + ++   +    A +P+ F          +     QQD+QEFL  +L  LHE+
Sbjct: 381 RAFSDLIQSLFGDNITSTTAYSPSYFKSTLGHFN-SMFSGYLQQDSQEFLAFLLDSLHED 439

Query: 410 LSNGTVTEYY--PDL-VSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILK 466
           L+      Y   P L ++ + N F V        ++  +L +  S I  +F    ++ LK
Sbjct: 440 LNRIDKKPYVEKPSLPLTANLNDFDVVKRLADDTWKAHLLRND-SVITDLFVAMYKSTLK 498

Query: 467 CQRCGNSSHSYSTFYVLSLAIPKISLY 493
           C  C N+S ++  +  L+L +P  S++
Sbjct: 499 CPECQNTSVTFDPYNDLTLPLPVASIW 525

 Score = 38.1 bits (87), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%)

Query: 498 KSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTK 536
           + + I L+DC+ LF+  E LS ++SW CP+C      TK
Sbjct: 935 EERHITLDDCLKLFSKPEILSSNDSWYCPHCKEHRQATK 973

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 94/208 (45%), Gaps = 30/208 (14%)

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQ--LSRSIYVL 358
            ITGL N  NTCY+NS +QCL      RD FL   +   +  +  P   Q  ++R+   L
Sbjct: 291 GITGLYNLGNTCYMNSALQCLVHIPELRDYFLYNCFEDEINCNN-PLGYQGYVARAFSGL 349

Query: 359 FKKMY----LNGGE----AIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEEL 410
            + ++    L+ G     A +P GF          +     QQD+QEF+  +L  LHE+L
Sbjct: 350 VQNLFGCKTLSSGSTLTPAYSPTGFKSTIGHFN-SMFSGYMQQDSQEFITFLLDGLHEDL 408

Query: 411 SNGTVTEYYPDLVSY----DANAFQV------NPSKYQKWYEGSVLTDGLSPIDYIFRGQ 460
            N  V + Y +  S     D+N F V      +  K       SV+TD       +F G 
Sbjct: 409 -NRIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTWKLHLQRNDSVITD-------LFVGL 460

Query: 461 MENILKCQRCGNSSHSYSTFYVLSLAIP 488
            E+ L+C  C N S ++  +  L+L +P
Sbjct: 461 YESTLQCPECNNVSITFDPYNDLTLPLP 488

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%)

Query: 498 KSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTK 536
           + KKI L DC+ LF+  E L  ++SW CP+C      TK
Sbjct: 876 EEKKITLHDCLKLFSKREVLGMNDSWYCPSCKEHRQATK 914

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 92/203 (45%), Gaps = 11/203 (5%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQ--LSRSIYVLFKK 361
           GL N  NTCY+NS +QCL      RD F    Y+  +  D  P   Q  ++ +   L + 
Sbjct: 399 GLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDN-PLGFQGNIANAFSALVQN 457

Query: 362 MYLNG---GEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEY 418
           +Y N      + AP+ F K+       +     QQD+QEFL  +L  LHE+L+      Y
Sbjct: 458 LYKNQFIPSASYAPSQF-KLTIGHYNQMFSGYFQQDSQEFLAFLLDGLHEDLNRIKDKPY 516

Query: 419 Y--PDLV-SYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSH 475
              P L    D N + +         E  +  +    ID +F G  ++ LKC  C + S 
Sbjct: 517 VEKPSLADGSDVNDYNIIARLAADTLEAHLKRNDSIIID-LFVGLYKSTLKCPVCNHVSI 575

Query: 476 SYSTFYVLSLAIPKISLYSFTSK 498
           ++  +  L+L IP  S+++F  K
Sbjct: 576 TFDPYCDLTLPIPVESVWNFKVK 598

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%)

Query: 498 KSKKIKLEDCINLFTSDEELSGDNSWDCPNC 528
           + K I LED +NLF   E L  ++SW CP C
Sbjct: 958 EEKNITLEDSLNLFERAEVLGINDSWYCPKC 988

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 97/219 (44%), Gaps = 20/219 (9%)

Query: 297 LSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIY 356
           ++   I GL N  NTCY+NS +QCL      RD F    Y   +  D     +  + ++ 
Sbjct: 283 MTMTGIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLD---NPLGYNGTVA 339

Query: 357 VLFKKMYLN---------GGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLH 407
             F  +  N           ++ +PN F KM       +     QQD+QEFL  +L  LH
Sbjct: 340 TAFGNLIQNLYSYHWNQQQYQSYSPNRF-KMTLGQANSMFAGYMQQDSQEFLAFLLDSLH 398

Query: 408 EELSNGTVTEYY--PDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENIL 465
           E+L+      Y   P L + +  A +    +  K    + L    S I+ +F G  ++ L
Sbjct: 399 EDLNRIHDKPYIEKPTLETSEELADENAVKQLAKKTWDAHLARNDSVINDLFVGMYKSTL 458

Query: 466 KCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKL 504
           KC  C N S ++  +  L+L +P  +++     +KK+K+
Sbjct: 459 KCPTCKNISITFDPYNDLTLPLPISTVW-----NKKVKI 492

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 99/285 (34%), Gaps = 110/285 (38%)

Query: 439 KWYEGS---VLTDGLSPIDYIFRGQMEN--ILKCQRCGNSSHSYSTFYVLSLAIPKISLY 493
           +W + S   V TD   PID+     +EN  +L  Q+  NS            A P I   
Sbjct: 801 EWTQKSIDEVFTDD-KPIDWEHPALLENKELLLAQKQRNS------------ASPNI--- 844

Query: 494 SFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXX 553
                   I L+ C+ LF+  E L  ++SW CP C      TK  E              
Sbjct: 845 --------ITLDSCLKLFSKPEVLGINDSWYCPKCKEHRQATKQLEL------------- 883

Query: 554 XXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRF--YY 611
                                       WN+              P IL+IHL RF    
Sbjct: 884 ----------------------------WNT--------------PEILLIHLKRFENQR 901

Query: 612 DLTRKNNTVITYPL--------ILNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKE 663
             + K + V+ +P+        +++ ++++  +  Y L+   NH G L  GHYTS V   
Sbjct: 902 SFSDKIDAVVDFPIEGLDMTPYVVDSVVEDGCI--YDLFAVDNHYGGLGGGHYTSYVKNN 959

Query: 664 KNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFY 708
            +     NR  W  FDD  +         AG         Y+LFY
Sbjct: 960 ID-----NR--WYYFDDSRVSSTDPKKSVAGS-------AYLLFY 990

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 95/217 (43%), Gaps = 18/217 (8%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQ--LSRSIYVLFKK 361
           GL N  NTCY+NS +QCL      RD FL K +   +  D  P   Q  ++RS  +L + 
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFLYKVFEKEINLDN-PLGYQGHVARSFAILIQN 401

Query: 362 MY---LNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEEL---SNGTV 415
           ++   L    + +P  F           +    QQD+QEF+  +L  LHE+L   +N  V
Sbjct: 402 LFKDELLPSLSYSPTTFKSTVGHFNSMFS-GYLQQDSQEFIAFLLDGLHEDLNRITNKPV 460

Query: 416 TEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSH 475
            E  P L   D  + Q    K       S L    S I  IF G  ++ L C  C N S 
Sbjct: 461 VE-KPSLKPEDDVSNQEVIKKLADDTWNSHLLRNDSIITDIFVGLYKSTLHCPECDNLSV 519

Query: 476 SYSTFYVLSLAIP-------KISLYSFTSKSKKIKLE 505
           ++  +  L+L +P       KI L+   S    I++E
Sbjct: 520 TFDPYNDLTLPLPVDTKWNTKIKLFPQNSPPCIIEIE 556

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 20/29 (68%)

Query: 500 KKIKLEDCINLFTSDEELSGDNSWDCPNC 528
           KKI L+DC+NLF   E L  ++SW CP C
Sbjct: 907 KKITLDDCLNLFAKKEVLGMNDSWYCPTC 935

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 92/205 (44%), Gaps = 10/205 (4%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFL-QTDKYPREVQLSRSIYVLFKK 361
           TGL N  NTCY+NS +QCL      RD FL   Y   + + +       ++R+   L +K
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEENPLGYHGYVARAFSDLIQK 423

Query: 362 MYLNGGEAIAPNGFL--KMCKKLRPDLNIPDD---QQDTQEFLLIILARLHEELSNGTVT 416
           ++ N    +  NG     M K      N       QQD+QEFL  +L  LHE+L+     
Sbjct: 424 IFQNRLSVMQRNGAFPPSMFKSTVGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNRIIKK 483

Query: 417 EYY--PDLV-SYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNS 473
           EY   P L    D + + V        +E   L    S I  +F G  ++ L C  C N 
Sbjct: 484 EYIEKPSLSPGDDVDDWNVVKKLADDTWEMH-LKRNCSVITDLFVGMYKSTLYCPECKNV 542

Query: 474 SHSYSTFYVLSLAIPKISLYSFTSK 498
           S ++  +  ++L +P  ++++ T K
Sbjct: 543 SITFDPYNDVTLPLPVDTVWNKTVK 567

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/222 (25%), Positives = 81/222 (36%), Gaps = 77/222 (34%)

Query: 497  SKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXX 556
            +K + I L+DC+ LF+  E L   +SW CP C      TK                    
Sbjct: 953  AKERTITLDDCLQLFSKPEILGLSDSWYCPTCKEHRQATK-------------------- 992

Query: 557  XXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRF--YYDLT 614
                                   + WN+              P IL+IHL RF      +
Sbjct: 993  ---------------------QIQLWNT--------------PDILLIHLKRFESQRSFS 1017

Query: 615  RKNNTVITYP-----LILNVILKNN-KVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEI 668
             K +  + +P     L  NV+ K++ +   Y LY   NH G L  GHYT+ V    N++ 
Sbjct: 1018 DKIDATVNFPITDLDLSKNVVYKDDPRGSIYDLYAVDNHYGGLGGGHYTAYVKNFANNK- 1076

Query: 669  GLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYER 710
                  W  FDD  + +   ++  AG         Y+LFY R
Sbjct: 1077 ------WYYFDDSRVTETVPENSIAGS-------AYLLFYIR 1105

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 95/212 (44%), Gaps = 24/212 (11%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFL-QTDKYPREVQLSRSIYVLFKK 361
           TGL N  NTCY+NS +QCL      RD FL   Y   + + +       ++R+   L +K
Sbjct: 361 TGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPLGYHGYVARAFSDLIQK 420

Query: 362 MYLNGGEAIAPNGFL--KMCKKLRPDLNIPDD---QQDTQEFLLIILARLHEELSNGTVT 416
           ++ N    +  NG     M K      N       QQD+QEFL  +L  LHE+L N  + 
Sbjct: 421 LFQNKLNIMQRNGAFPPTMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLHEDL-NRIIK 479

Query: 417 EYYPDLVSY----DANAFQVNPSKYQKWYE------GSVLTDGLSPIDYIFRGQMENILK 466
           + Y +  S     D N + V        +E       SV+TD       +F G  ++ L 
Sbjct: 480 KAYIEKPSLSPDDDVNDWNVIKKLADDTWELHLKRNRSVITD-------LFVGMYKSTLY 532

Query: 467 CQRCGNSSHSYSTFYVLSLAIPKISLYSFTSK 498
           C  C + S ++  +  ++L +P  +++S T K
Sbjct: 533 CPECKDVSTTFDPYNDVTLPLPVDTVWSKTVK 564

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 85/232 (36%), Gaps = 77/232 (33%)

Query: 487  IPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXX 546
            + K+ L    +K + I L DC+ LF+  E L  ++SW CP C      TK          
Sbjct: 946  LEKVKLERCNAKERTITLNDCLQLFSKPEILGLNDSWYCPTCKEHRQATK---------- 995

Query: 547  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHL 606
                                             + WN+              P IL+IHL
Sbjct: 996  -------------------------------QIQLWNT--------------PDILLIHL 1010

Query: 607  SRF--YYDLTRKNNTVITYP-----LILNVILKNN-KVVRYKLYGTVNHIGNLVNGHYTS 658
             RF      + K +  + +P     L  +V+ K++ +   Y LY   NH G L  GHYT+
Sbjct: 1011 KRFESQRSFSDKIDDTVNFPITDLDLSEHVVYKDDPRGSIYDLYAVDNHYGGLGGGHYTA 1070

Query: 659  DVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYER 710
             V    +++       W  FDD  + +   ++  AG         Y+LFY R
Sbjct: 1071 YVKNFMDNK-------WYYFDDSRVTETVPENSVAGS-------AYLLFYIR 1108

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 91/201 (45%), Gaps = 9/201 (4%)

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQT-DKYPREVQLSRSIYVLF 359
            I GL N  N+CY+NS +QCL      RD FL   +   + T +    + Q++++   L 
Sbjct: 296 GIVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPLGYQGQIAQAFAALV 355

Query: 360 KKMYLNGG---EAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVT 416
           K ++ +     +A +P  F  +       +     QQD+QE L  +L  LHE+L+     
Sbjct: 356 KSLFDDKASALQAFSPRAFKSIIGH-HNGMFAGFLQQDSQELLAFLLDGLHEDLNRIMKK 414

Query: 417 EYY--PDLVSY-DANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNS 473
            +   P+L S  D N   V  +     +E   L +    +D +F G  ++ L C  C   
Sbjct: 415 PFVEKPELASSDDVNDIDVIRNLASLTWEKHKLRNESVIVD-LFVGLYKSTLTCPACDRV 473

Query: 474 SHSYSTFYVLSLAIPKISLYS 494
           S ++  F  L+L +P  S +S
Sbjct: 474 SVTFDPFSDLTLPLPVESFWS 494

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 75/222 (33%), Gaps = 77/222 (34%)

Query: 502  IKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXX 561
            I L DC+ LF+  E L   +SW CPNC      TK                         
Sbjct: 872  ISLTDCLELFSKSEVLGAADSWYCPNCKEHRQATK------------------------- 906

Query: 562  XXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRF--YYDLTRKNNT 619
                              + WN+              P IL IHL RF   +  + K + 
Sbjct: 907  ----------------QIQLWNT--------------PDILTIHLKRFENRHSFSDKISD 936

Query: 620  VITYPLI-LN-----VILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQ 673
            V+ +P+  L+     V    N+   Y L    NH G L  GHYT+ V   KN   G    
Sbjct: 937  VVDFPITGLDMSEHLVCHDPNQNSMYDLIAVDNHYGGLGGGHYTAYV---KNFMDG---- 989

Query: 674  VWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYERMDESE 715
             W  FDD  +        E       S   Y+LFY R  E E
Sbjct: 990  KWYYFDDSRVS-------ETEAERAISGAAYLLFYRRRIEGE 1024

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 93/206 (45%), Gaps = 12/206 (5%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFL-QTDKYPREVQLSRSIYVLFKK 361
           TGL N  NTCY+NS +QCL      RD FL   Y   + + +       ++R+   L +K
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPLGYHGYVARAFSDLVQK 423

Query: 362 MYLNGGEAIAPNGFL--KMCKKLRPDLNIPDD---QQDTQEFLLIILARLHEELSNGTVT 416
           ++ N   ++  N      M K      N       QQD+QEFL  +L  LHE+L N  + 
Sbjct: 424 LFHNKLSSMQRNAAFPPSMFKSTVGHFNSMFSGYMQQDSQEFLAFLLDSLHEDL-NRIIK 482

Query: 417 EYYPDLVSY----DANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGN 472
           + Y +  S     D N + V        +E   L    S I  +F G  ++ L C  C N
Sbjct: 483 KAYIEKPSLSPDDDVNDWNVVKKLADDTWEMH-LKRNCSVITDLFVGLYKSTLYCPECKN 541

Query: 473 SSHSYSTFYVLSLAIPKISLYSFTSK 498
            S ++  +  ++L +P  +++S T K
Sbjct: 542 VSITFDPYNDVTLPLPVDTVWSKTVK 567

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 87/399 (21%), Positives = 144/399 (36%), Gaps = 131/399 (32%)

Query: 345  YPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRP--------------DLNIPD 390
            YP  V+ + +I+     M ++G   + PNG     K  +P              + NI  
Sbjct: 811  YPSLVESAEAIH-----MQVDGESEVEPNGAENSFKPFQPKDGEENRNIETNIENGNINT 865

Query: 391  DQQDTQEFLLIILARLHEELSNGTVTEYYPDLV-SYDANAFQVNPSKYQKWYEGSVLTDG 449
            DQ +  E        L ++++    TE  PD   S  +     N              +G
Sbjct: 866  DQDEDME--------LTDDIAEDASTE--PDTADSIKSEGLDKN-------------ENG 902

Query: 450  LSPIDYIFRGQMENILKCQ-RCGNSSHSYSTFYVLSL----AIPKISLYSF-----TSKS 499
            LS I +     +++IL C+     S+ ++S   + +      +P I L +       +K 
Sbjct: 903  LSSISHEILS-IDDILVCEWEESGSNEAFSNDKIFNWENPAPLPNIELENAKLERSNAKE 961

Query: 500  KKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXX 559
            + I L+DC+ LF+  E L  ++SW CP C      TK                       
Sbjct: 962  RIITLDDCLQLFSKPEILGLNDSWYCPTCKEHRQATK----------------------- 998

Query: 560  XXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRF--YYDLTRKN 617
                                + WN+              P IL++HL RF      + K 
Sbjct: 999  ------------------QIQLWNT--------------PDILLVHLKRFESQRSFSDKI 1026

Query: 618  NTVITYPLIL-----NVILKNN-KVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLN 671
            +  + +P+       +V+ K++ +   Y LY   NH G L  GHYT+ V    + +    
Sbjct: 1027 DATVNFPVTALDLSKHVVHKDDPRGSIYDLYAVDNHYGGLGGGHYTAYVKNFADSK---- 1082

Query: 672  RQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYER 710
               W  FDD  + +         +  +S S  Y+LFY R
Sbjct: 1083 ---WYYFDDSRVTE------TVPENSISGS-AYLLFYIR 1111

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 89/210 (42%), Gaps = 20/210 (9%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYV----- 357
           TGL N  NTCY+NS +QCL      RD FL   Y      D+   E  L    YV     
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYE-----DEINEENPLGYHGYVARAFS 418

Query: 358 -LFKKMYLNGGEAIAPNGFL--KMCKKLRPDLNIPDD---QQDTQEFLLIILARLHEELS 411
            L +K++ N    +  N      M K      N       QQD+QEFL  +L  LHE+L+
Sbjct: 419 DLVQKLFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLN 478

Query: 412 NGTVTEYY--PDLV-SYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQ 468
                EY   P L    D N + V        +E   L    S I  +F G  ++ L C 
Sbjct: 479 RIIKKEYTEKPSLSPGDDVNDWNVVKKLADDTWEMH-LKRNCSVITDLFVGMYKSTLYCP 537

Query: 469 RCGNSSHSYSTFYVLSLAIPKISLYSFTSK 498
            C N S ++  +  ++L +P  +++  T K
Sbjct: 538 ECQNVSITFDPYNDVTLPLPVDTVWDKTIK 567

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 81/222 (36%), Gaps = 77/222 (34%)

Query: 497  SKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXX 556
            +K + I L+DC+ LF+  E L   +SW CP C      TK                    
Sbjct: 957  AKERTITLDDCLQLFSKPEILGLTDSWYCPTCKEHRQATK-------------------- 996

Query: 557  XXXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRF--YYDLT 614
                                   + WN+              P IL+IHL RF      +
Sbjct: 997  ---------------------QIQLWNT--------------PDILLIHLKRFESQRSFS 1021

Query: 615  RKNNTVITYP-----LILNVILKNN-KVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEI 668
             K +  + +P     L   V+ K++ + + Y LY   NH G L  GHYT+ V    +++ 
Sbjct: 1022 DKIDATVNFPITDLDLSRYVVYKDDPRGLIYDLYAVDNHYGGLGGGHYTAYVKNFADNK- 1080

Query: 669  GLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYER 710
                  W  FDD  + +   ++  AG         Y+LFY R
Sbjct: 1081 ------WYYFDDSRVTETAPENSIAGS-------AYLLFYIR 1109

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 13/200 (6%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDK-YPREVQLSRSIYVLFKKM 362
           GL N  NTCY+NS +QCL     F+D FL   Y   +  D     +  ++ +   L + +
Sbjct: 350 GLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVDNPLGHKGHIAWAFGTLIQSL 409

Query: 363 YLNGGEAI---APNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYY 419
           +      I   +P  F      L   +     QQD+QEFL  +L  LHE+L N  V + Y
Sbjct: 410 FGKRNNLISSYSPRHFKTTIGHLN-SMFAGYQQQDSQEFLAFLLDGLHEDL-NRIVDKPY 467

Query: 420 ---PDL-VSYDANAFQ-VNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSS 474
              P+L  + D   F+ +       W +  +  D +  I  +F G  ++ L C  C   S
Sbjct: 468 VEKPELNPTDDVTEFETIKKLADDTWLKHKLRNDSV--ILDLFVGLYKSTLICPTCKKVS 525

Query: 475 HSYSTFYVLSLAIPKISLYS 494
            ++  +  L+L +P  S +S
Sbjct: 526 TTFDPYNDLTLPLPVDSTWS 545

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 79/227 (34%), Gaps = 77/227 (33%)

Query: 498  KSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXX 557
            + KKI L DC+ LF++ E L   +SW CP+C      TK  E                  
Sbjct: 933  EEKKITLHDCLTLFSTPEVLGATDSWYCPSCKEHRQATKQIEL----------------- 975

Query: 558  XXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRF--YYDLTR 615
                                    WN+              P IL+IHL RF      + 
Sbjct: 976  ------------------------WNT--------------PDILLIHLKRFENQRSFSD 997

Query: 616  KNNTVITYPLI------LNVILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIG 669
            K   ++ +P+         V   + K   Y L    NH G L  GHYT+ V    +++  
Sbjct: 998  KIGDIVHFPITDLDMSPYLVYKDDKKGTIYDLIAVDNHYGGLGGGHYTAYVKNFLDNK-- 1055

Query: 670  LNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYERMDESEY 716
                 W  FDD  + +   +   AG         Y+LFY R  ES Y
Sbjct: 1056 -----WYYFDDSRVNETVPERSIAGS-------AYLLFYRRRTESNY 1090

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1297

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 86/209 (41%), Gaps = 21/209 (10%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD---KYPREV--QLSRSIYVL 358
           GL N  +TC+INS++QCL   T  RD FL   +   L T     Y   V    +  +  L
Sbjct: 352 GLANLGSTCHINSVLQCLTHITELRDYFLYNGFAAELNTRNSLGYGGRVAGAFAEVVQAL 411

Query: 359 FKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSN------ 412
           F           A N F       RP L  P  QQD+ E +  +L  LHE+L+       
Sbjct: 412 FGDKIAQFPTYAASN-FRATIGYFRPALG-PYVQQDSHEVVAFLLGALHEDLNRAPEGPR 469

Query: 413 -GTVTEYYPDLVSYDANAFQVNPSKYQK-----WYEGSVLTDGLSPIDYIFRGQMENILK 466
            G   E      S  A+A   N  + ++     W    +  D  S I  +F G +++ L 
Sbjct: 470 VGQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQND--SVITDLFAGMLKSTLT 527

Query: 467 CQRCGNSSHSYSTFYVLSLAIPKISLYSF 495
           C  C  SS ++     L++ +   + +SF
Sbjct: 528 CLTCRRSSVTFDPCTELAVPLAVDAHWSF 556

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 56/133 (42%), Gaps = 33/133 (24%)

Query: 599  PPILVIHLSRF--YYDLTRKNNTVITYPLILNVILKNNKVVR----------------YK 640
            P IL++HL RF  +Y  T K N  + +PL   + +  +   R                Y 
Sbjct: 975  PEILLVHLKRFESHYSSTGKLNNTVHFPLT-GLDMSPHLPCRDGDGDGDGDDGGRENVYD 1033

Query: 641  LYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSS 700
            L    NH G L +GHYT+ V    + +       W  FDD  ++       E     V+S
Sbjct: 1034 LIAVDNHFGGLGSGHYTAYVKNPVDDK-------WYLFDDSEVR-------EVDAESVAS 1079

Query: 701  SEVYVLFYERMDE 713
            S  Y+LFY R DE
Sbjct: 1080 SFGYLLFYRRRDE 1092

 Score = 38.5 bits (88), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%)

Query: 498 KSKKIKLEDCINLFTSDEELSGDNSWDCPNC 528
           + ++  LEDC++LFT+ E L+  +SW CP C
Sbjct: 929 QKQETTLEDCLDLFTAPEVLNTADSWYCPAC 959

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 98/207 (47%), Gaps = 11/207 (5%)

Query: 296 LLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQT-DKYPREVQLSRS 354
           LL     TGL N  N+CY+NS +QCL      +D FL   Y   + T +    +  ++++
Sbjct: 327 LLPPRGTTGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPLGYKGLVAQA 386

Query: 355 IYVLFKKMY---LNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELS 411
              L K ++    +   A +P  F  +  + +  +     QQD+QEFL  +L  LHE+L 
Sbjct: 387 FAALIKSLFDERSSSAFAFSPREFKSIIGQ-QNSMFAGFLQQDSQEFLAFLLDGLHEDL- 444

Query: 412 NGTVTEYY---PDLV-SYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKC 467
           N  + + +   P+L    D N  +V      K ++   L +    +D +F G  ++ L C
Sbjct: 445 NRIIEKPFVEKPELSPDEDVNNREVIHRLASKTWDKHKLRNDSVILD-LFVGLYKSTLTC 503

Query: 468 QRCGNSSHSYSTFYVLSLAIPKISLYS 494
             C  +S ++  +  L+L +P  S+++
Sbjct: 504 PVCDKTSVTFDPYSDLTLPLPVESIWT 530

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 78/220 (35%), Gaps = 79/220 (35%)

Query: 500  KKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXX 559
            ++I L DC+ LF+  E LS  +SW CP C      TK                       
Sbjct: 901  RRISLFDCLKLFSKPEVLSAADSWYCPTCREHRQATK----------------------- 937

Query: 560  XXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRF--YYDLTRKN 617
                                + WNS              P IL IHL RF   +  + K 
Sbjct: 938  ------------------QIQLWNS--------------PDILTIHLKRFESRHSFSDKI 965

Query: 618  NTVITYPLILNVILKNNKVVR-------YKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGL 670
            + V+ +P I  + + ++ V         Y L    NH G L  GHYT+     KN   G 
Sbjct: 966  SDVVDFP-ICGLNMSDHLVCEDAEQNNLYDLVAVDNHYGGLGGGHYTAFA---KNPVDG- 1020

Query: 671  NRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYER 710
                W  FDD  + +         +T VS +  Y+LFY R
Sbjct: 1021 ---KWYYFDDSRVSETD------PETSVSGA-AYLLFYRR 1050

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 103/241 (42%), Gaps = 43/241 (17%)

Query: 296 LLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDK---YPREV--Q 350
           L+      GL N  NTCY+NS +QCL     F + FL   Y+  +  D    Y   V   
Sbjct: 407 LVPSTGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANA 466

Query: 351 LSRSIYVLFKKMYLNGG--------EAIAPNGF---LKMCKKLRPDLNIPDDQQDTQEFL 399
             + I+ LF++  ++           + +P  F   +  C  +         QQD+QEFL
Sbjct: 467 FGKLIHKLFEERIIDNESEKSSFSINSFSPTNFKSTVGYCNSMFSGYL----QQDSQEFL 522

Query: 400 LIILARLHEELSNGTVTEYYPDLVSYDANA----FQVNPSKYQKWYEG------SVLTDG 449
             IL  LHE+L N  + + + +  S   N+    ++V        +E       S++TD 
Sbjct: 523 AFILDGLHEDL-NRILKKPFVEKPSLPENSNYKDYKVIKKLADDTWEAHLKRNDSIVTD- 580

Query: 450 LSPIDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYS-----FTSKSKKIKL 504
                 +F G  ++ L+C  C N S ++  +  L+L +P  ++++     F S S    L
Sbjct: 581 ------LFVGMYKSTLQCPDCHNVSVTFDPYNDLTLPLPVETIWNKVIKIFPSNSPPCSL 634

Query: 505 E 505
           E
Sbjct: 635 E 635

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 72/221 (32%), Gaps = 77/221 (34%)

Query: 498  KSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXX 557
            K K I L+DC+ LF+  E L   +SW CP C      TK  E                  
Sbjct: 1066 KEKTILLDDCLRLFSKPEILGLQDSWYCPTCKDHRQATKQIEL----------------- 1108

Query: 558  XXXXXXXXXXXXXXXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRF--YYDLTR 615
                                    WN+              P IL+IHL RF      + 
Sbjct: 1109 ------------------------WNT--------------PDILLIHLKRFENQRSFSD 1130

Query: 616  KNNTVITYPLI-LN-----VILKNNKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIG 669
            K + V+ +P+  L+     V     K   Y L    NH G L  GHYT+ V         
Sbjct: 1131 KIDAVVNFPITDLDLTPHIVCTDQEKSNIYDLIAVDNHYGGLGGGHYTAYVK-------N 1183

Query: 670  LNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYER 710
               Q W  FDD  +         A      S   Y+LFY R
Sbjct: 1184 FVDQKWYYFDDSRVSL-------ADPQRSISGSAYLLFYVR 1217

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 54.7 bits (130), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 81/204 (39%), Gaps = 27/204 (13%)

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-----KYPREVQLSRSI 355
            I GL N  NTCY+NS +QCL       + FL K Y   +  +     K          +
Sbjct: 337 GIMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVAHAFGHLL 396

Query: 356 YVLFKKMYLNGGEAI--APNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNG 413
           Y LF   Y   G++   AP  F          L     QQD+QEFL  +L  LHE+L+  
Sbjct: 397 YSLFAPSY---GQSTFYAPRNFKNTIGHYN-SLFAGYGQQDSQEFLAFLLDGLHEDLNRV 452

Query: 414 TVTEY-----YPDLVSYDAN----AFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENI 464
               Y     +P+    D          N   Y K    SV+ D       +F G  ++ 
Sbjct: 453 IEKPYVNKPEFPNDGQIDDTDQIVLLAANMWDYIKKRNDSVIMD-------LFVGLYKST 505

Query: 465 LKCQRCGNSSHSYSTFYVLSLAIP 488
           L C  C + S ++  +  L+L +P
Sbjct: 506 LVCPNCNHVSITFDPYNDLTLPLP 529

 Score = 35.0 bits (79), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 497 SKSKKIKLEDCINLFTSDEELSGDNSWDCPNC 528
           ++   I L+ C+ LF+  E L   +SW CPNC
Sbjct: 897 TEKSSITLDSCLRLFSQPEILGSADSWYCPNC 928

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 98/424 (23%), Positives = 161/424 (37%), Gaps = 119/424 (28%)

Query: 291 EDSTSLLSQL-SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREV 349
           E S   L+Q   + GL N  +TCY++SI+QCL    LF DL +   +  + +    P + 
Sbjct: 124 ETSIPTLTQAHGLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNYCKIQD-PMKC 182

Query: 350 QLSRSIYVLFKKMYLNGGEAIAPN-GFLKMCK-KLRPDLNIPD-DQQDTQEFLLIILARL 406
            +S +I  +  + Y  G +   PN G + +     R + N+    QQD  EFL  IL ++
Sbjct: 183 -MSCAIDNIISETY--GNKKTTPNEGLVDILNCSWRVNKNLAGYTQQDAHEFLQFILNQM 239

Query: 407 HEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDY----IFRGQME 462
           H +     +         +D N  ++N + ++    G+   + L   +     IF+G ++
Sbjct: 240 HNDYKLNEI---------HDTNKQEMNGTDFKTMVNGNSSKEHLHLCNCLPHTIFQGFLK 290

Query: 463 NILKCQRCGNSSHSYSTFYV-LSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDN 521
           +I+ C  C   S +    Y+ LSL +             K  L +C+  F   E L  D 
Sbjct: 291 SIISCSECKAQSQTTIDPYMDLSLDV-----------KGKSTLYECLESFHRTERLH-DF 338

Query: 522 SWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKK 581
           +++C          K N+                                          
Sbjct: 339 TYNCK---------KCNKSQDA-------------------------------------- 351

Query: 582 WNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTR---KNNTVITYPLILNVIL------- 631
             +R+L+ +K      L PI+VI L RF + +T    K N  + +PL LN+         
Sbjct: 352 --NRQLSILK------LAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTP 403

Query: 632 ---------KNNKV---VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFD 679
                    K NK    + Y+L G V H G +  GHY +               VW  F+
Sbjct: 404 DTDPTNLNEKTNKSTPDMIYELTGIVTHRGTVNEGHYITYTKTADG--------VWYQFN 455

Query: 680 DDYI 683
           D  +
Sbjct: 456 DSVV 459

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
           YMR223W
          Length = 440

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 23/119 (19%)

Query: 598 LPPILVIHLSRFYYDLTRKN---NTVITYPLILNV-----ILKNNKVVRYKLYGTVNHIG 649
           LPP+LV+ L RF +    +N   N  I +P  LN+       +NN  + Y+L G ++HIG
Sbjct: 331 LPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYELNGVISHIG 390

Query: 650 NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFY 708
            +  GHY + +  + N+        W  F+D  +           + EV   + Y+LFY
Sbjct: 391 TVNEGHYIATLKLDSNN--------WFKFNDSMVT-------SISEEEVLKDQAYLLFY 434

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 71/175 (40%), Gaps = 51/175 (29%)

Query: 365 NGGEAIAP--NGFLKMCKKLRPDLNIPDD-----QQDTQEFLLIILARLHEELSNGTVTE 417
           N G+ I    +GF+ M   L     I D+     QQD  EFL  IL RLH +        
Sbjct: 186 NNGKPINQYHDGFISM---LNCSWKINDNFAGYSQQDAHEFLQFILNRLHRD-------- 234

Query: 418 YYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSP-IDYIFRGQMENILKCQRCGNSSHS 476
            Y    +Y  N                  TD  S  I  IF+G++++ + C  C ++S +
Sbjct: 235 -YKLTSTYTNN------------------TDSCSCLIHSIFQGKLKSSIVCPECHDNSKT 275

Query: 477 YSTFYV-LSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGT 530
            +  Y+ LSL I             K  L  C++ F   E L  D ++ CPNC T
Sbjct: 276 VTDPYIDLSLDIKD-----------KATLYQCLDSFHKKETLH-DYNYHCPNCDT 318

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 60/128 (46%), Gaps = 20/128 (15%)

Query: 598 LPPILVIHLSRFYYDLTRKNNTV----ITYPLILNVILKNNKVVR--YKLYGTVNHIGNL 651
           LP  L +HL RF Y   +  N      I YPLILN     +  V   Y+L G V H+GN 
Sbjct: 564 LPKTLSLHLKRFKYSEEKNANVKLFNKIHYPLILNASSTFDSSVSKSYRLQGVVVHMGNG 623

Query: 652 VN-GHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHD---DFEAGKTEVSSSEVYVLF 707
            + GHY S  + E     G     W+ FDD+ ++        DF  G  E S +  YVLF
Sbjct: 624 PHHGHYVSLCHTEL---FG-----WLLFDDETVESVDESYVLDF-VGSHE-SPTTAYVLF 673

Query: 708 YERMDESE 715
           Y  +D SE
Sbjct: 674 YSEIDGSE 681

 Score = 35.0 bits (79), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 8/54 (14%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL--------TKKYRLFLQTDKYPR 347
           + G +N  NTCY NS++QCL+    FR   L         +++R      K+PR
Sbjct: 160 VFGYENFGNTCYCNSVLQCLYHLPEFRLRVLEYPEKPEEQERHRKRAMVGKHPR 213

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 59/126 (46%), Gaps = 16/126 (12%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILKNNKVV--RYKLYGTVNHIGNL 651
           LP IL +HL RF Y   +  N      ITYPL L V  K +  V  +Y+L G V H+G  
Sbjct: 548 LPRILALHLKRFKYSEAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGGG 607

Query: 652 -VNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD-FEAGKTEVSSSEVYVLFYE 709
             +GHY S V K  N         W+ FDD+ ++               +S+  YVLFY+
Sbjct: 608 PQHGHYVS-VCKTDNFG-------WLFFDDETVETLDEPQVLNFTGDTTTSTTAYVLFYK 659

Query: 710 RMDESE 715
             DE +
Sbjct: 660 ETDEGD 665

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (67%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           I G +N  NTCY NSI+QCLF  T FR+  L
Sbjct: 113 IFGYENFGNTCYCNSILQCLFNLTEFRNSIL 143

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 56/122 (45%), Gaps = 16/122 (13%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILKNNKVV--RYKLYGTVNHI-GN 650
           LP  L +HL RF Y   +  N      I YPL LNV    N  V  +Y+L G V H+ G 
Sbjct: 558 LPDTLALHLKRFKYSEKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAGIVVHMGGG 617

Query: 651 LVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD-FEAGKTEVSSSEVYVLFYE 709
             +GHY S    EK    G     W+ FDD+ ++    +   E      + +  YVLFY+
Sbjct: 618 PQHGHYVSLCKHEK---FG-----WLLFDDETVEAVKEETVLEFTGESPNMATAYVLFYK 669

Query: 710 RM 711
            M
Sbjct: 670 AM 671

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           + G +N  NTCY NS++QCL+  +  R+  L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSLRENIL 170

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
           Anc_7.390
          Length = 717

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 71/147 (48%), Gaps = 20/147 (13%)

Query: 581 KWNSRKLTTVKSSDFIV----LPPILVIHLSRFYYDLTRKNN----TVITYPLIL--NVI 630
           K+N  +   ++ ++  V    LP  L++HL RF Y   + +N    + + YPLIL  N  
Sbjct: 497 KFNCSQCCALQEAERAVELKKLPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSN 556

Query: 631 LKNNKVVRYKLYGTVNHIGNLVN-GHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHD 689
            K    ++Y+L G V H+G+    GHY +    EK          W+ +DD+ ++    +
Sbjct: 557 YKCTDTIKYELSGIVIHVGDGPQMGHYVALCKTEKYG--------WLFYDDETVESVSEE 608

Query: 690 D-FEAGKTEVSSSEVYVLFYERMDESE 715
              +    E + S  YVLFY+++ + E
Sbjct: 609 TVLKFIGDEKTQSTAYVLFYKKLGDKE 635

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFR 328
           + G +N  NTCY NS++QCL+    FR
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNLPEFR 151

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/76 (21%), Positives = 34/76 (44%), Gaps = 9/76 (11%)

Query: 453 IDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFT 512
           I+ IF+G + N ++C  C N +     F  L + +          ++    ++  +  ++
Sbjct: 437 INEIFQGTLTNKVRCLTCDNVTSREEAFLDLPIEV---------KENGDTDIQRVLKYYS 487

Query: 513 SDEELSGDNSWDCPNC 528
             E L+G N ++C  C
Sbjct: 488 QREMLNGSNKFNCSQC 503

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 58/122 (47%), Gaps = 16/122 (13%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILK-NNKVV-RYKLYGTVNHIGNL 651
           LP  L +HL RF Y   +  N      I YPL LNV    N+KV  +Y+L G V H+G  
Sbjct: 555 LPDTLTLHLKRFKYSEKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAGIVVHMGGG 614

Query: 652 V-NGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD-FEAGKTEVSSSEVYVLFYE 709
             +GHY S    EK    G     W+ FDD+ ++    +   E      + +  YVLFY+
Sbjct: 615 PQHGHYVSLCKHEK---FG-----WLLFDDETVEAVKEETVLEFTGESPNMATAYVLFYK 666

Query: 710 RM 711
            M
Sbjct: 667 AM 668

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 6/52 (11%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRD--LFLTKKYRLFLQTDKYPREVQL 351
           + G +N  NTCY NS++QCL+  +  R+  L   KK R   ++D+ PR+ ++
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLRENILQFPKKSR---ESDQ-PRKKEM 186

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON}
           Anc_7.390
          Length = 729

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (47%), Gaps = 16/128 (12%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNV--ILKNNKVVRYKLYGTVNHIG-N 650
           LP  L +HL RF Y   +  N      + YPL L+V     ++   +Y+L G V H+G +
Sbjct: 541 LPHTLALHLKRFKYSEEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGVVIHMGGS 600

Query: 651 LVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD-FEAGKTEVSSSEVYVLFYE 709
             +GHY S     KN + G     W+ FDD+ ++        E      + +  YVLFY+
Sbjct: 601 PQHGHYVSLC---KNDKFG-----WLLFDDETVESVTEKTVLEFTGDSSNQATAYVLFYK 652

Query: 710 RMDESEYK 717
            +DE + K
Sbjct: 653 ELDEKDTK 660

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFR 328
           + G +N  NTCY NS++QCL+  T  R
Sbjct: 136 VFGYENFGNTCYCNSVLQCLYNLTELR 162

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 64/160 (40%), Gaps = 33/160 (20%)

Query: 369 AIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDLVSYDAN 428
            ++P  F+K+ KK     N    QQD  EFL  +L  L         +EY  + +S+ +N
Sbjct: 400 VVSPVEFVKVLKKENILFN-SMMQQDAHEFLNFLLNEL---------SEYLQNHISHPSN 449

Query: 429 AFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIP 488
                P K       + + D       +F+G + N +KC  C N +     F    + + 
Sbjct: 450 KPTDIPFK-------NYVID-------LFQGVLTNRIKCLTCDNITSRDEPFLDFPIGV- 494

Query: 489 KISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNC 528
                      + I ++D +  + + E L+G N + C  C
Sbjct: 495 --------KGDENIDIQDVLRCYHTREMLNGSNKFYCSQC 526

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 49/104 (47%), Gaps = 10/104 (9%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLT--KKYRLFLQTDKYPREVQLSRSIYVLFKK 361
           G+ N  NTCY+N+ +Q L+G    R+  L    K       D Y   VQL R I   F+K
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKKATAEGMDLY--HVQLIREIQATFRK 118

Query: 362 MYLNGGEAIAPNGFLKMCKKLRPDLNIPD------DQQDTQEFL 399
           +    GEAI P   L++ +++ P  +  D       QQD +E  
Sbjct: 119 LRDKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELF 162

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 813

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 60/124 (48%), Gaps = 20/124 (16%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNV--ILKNNKVVRYKLYGTVNHIGNL 651
           LP  L +HL RF Y  T+ +N      + YPL L+V     N+   +Y+L G V H+G  
Sbjct: 611 LPHTLALHLKRFKYSETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGIVVHMGGG 670

Query: 652 V-NGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHD---DFEAGKTEVSSSEVYVLF 707
             +GHY S     KN   G     W+ FDD+ ++        DF    + ++++  YVLF
Sbjct: 671 PQHGHYVSLC---KNDNFG-----WLLFDDETVESVSEKTVLDFVGDSSTLTTA--YVLF 720

Query: 708 YERM 711
           Y  +
Sbjct: 721 YREL 724

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYR 337
           + G +N  NTCY NS++QCL+  T FR   L    R
Sbjct: 130 VFGFENFGNTCYCNSVLQCLYNMTEFRIQMLQHPER 165

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 61/123 (49%), Gaps = 16/123 (13%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILKNNKVV--RYKLYGTVNHI-GN 650
           LP IL +HL RF Y    ++N      I YPL L V  K++ +V   Y+L G V H+ G 
Sbjct: 590 LPKILSLHLKRFKYSEKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNGIVIHMGGG 649

Query: 651 LVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD-FEAGKTEVSSSEVYVLFYE 709
             +GHY +     K+   G     W+ +DD+ ++    +  F+    E   +  YVLF++
Sbjct: 650 PQHGHYVAIC---KHDMFG-----WLLYDDETVESIDEETVFKFVGDEKDMTTAYVLFFK 701

Query: 710 RMD 712
            +D
Sbjct: 702 EVD 704

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 453 IDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFT 512
           +  +F+G M N +KC  C N + S   F  L  AIP        ++ +++ ++D ++ F 
Sbjct: 509 VQSLFQGTMINSIKCLTCDNVTSSDELF--LDFAIP-------VNEDEEVNIQDMLSNFN 559

Query: 513 SDEELSGDNSWDCPNC 528
             E L+G N + C +C
Sbjct: 560 QREMLNGANKFYCDSC 575

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 6/42 (14%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFR 328
           LP  + ST +       GL+N  NTCY NS++QCLF  +  R
Sbjct: 123 LPCGDGSTKVF------GLENFGNTCYCNSVLQCLFNLSELR 158

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 57/122 (46%), Gaps = 16/122 (13%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILKNNKVV--RYKLYGTVNHI-GN 650
           LP  L +HL RF Y   +  N      I YPL LNV    N  V  +Y+L G V H+ G 
Sbjct: 555 LPDTLTLHLKRFKYSEKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAGIVVHMGGG 614

Query: 651 LVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD-FEAGKTEVSSSEVYVLFYE 709
             +GHY S     K+ + G     W+ FDD+ ++    +   E      + +  YVLFY+
Sbjct: 615 PQHGHYVSLC---KHQKFG-----WLLFDDETVEAVKEETVLEFTGESANMATAYVLFYK 666

Query: 710 RM 711
            +
Sbjct: 667 AV 668

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           + G +N  NTCY NS++QCL+  +  R+  L
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLRENIL 169

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 82/373 (21%), Positives = 135/373 (36%), Gaps = 73/373 (19%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKM 362
           TGL NP N C+INS IQ L          LT      L+ +K    + L   +  +  ++
Sbjct: 76  TGLVNPGNDCFINSSIQALVPLDK-----LTTYLSATLEDEKTASTLPLHNGLATMLLEL 130

Query: 363 --YLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYP 420
               +  ++++   F++  + +     I   Q D  EF  +IL RL+EE     +T  + 
Sbjct: 131 QQLRSDPKSVSSKRFIQQLETIFGG-KISRQQNDAHEFTQLILERLNEE----NLTLDHA 185

Query: 421 DLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSH-SYST 479
           DL                                  F+G + N L C +CG +SH +   
Sbjct: 186 DLT-------------------------------VPFKGIVGNHLVCLQCGRTSHVNEQP 214

Query: 480 FYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINE 539
           FY+  L +P         +   +KL D +N     E++    ++ C  C T  + T   E
Sbjct: 215 FYIYELTLP---------QQGSVKLSDLVN----GEQMETIENYSCMYCKTVAMLTNERE 261

Query: 540 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXKKWNSRKLTTV--KSS 593
                                                          N+ ++ +V  + S
Sbjct: 262 EKSNVSRTDAELNILKFLKGKLSTLLINEELPEHITHYINSYNKGYCNTSEIKSVIVRKS 321

Query: 594 DFIVLPPILVIHLSRFYYDLTR--KNNTVITYP---LILNVILKNNKV-----VRYKLYG 643
            F   P I +IHLSR  ++     +N   + +    L+   ILK+++      V+YKL  
Sbjct: 322 TFAEFPEIFLIHLSRSVFNGMNYSRNPCQVEFEEEILLPRQILKDHQCVGFETVKYKLKS 381

Query: 644 TVNHIGNLVNGHY 656
            V H G+   GHY
Sbjct: 382 IVKHTGSHYQGHY 394

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 756

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 17/109 (15%)

Query: 586 KLTTVKSSDFIV-LPPILVIHLSRFYYDLTR--KNNTVITYPLILNV--ILKNNKV---V 637
           K T     +FI+  P  L++HL +F ++ T   K    ++YP+ L+V    +N+K    V
Sbjct: 587 KTTNASKHNFILRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDVTEFCENSKTTLPV 646

Query: 638 RYKLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ 685
           +Y+L   V H G +L +GHY +   +            W T+DD+YI +
Sbjct: 647 KYQLISVVVHEGRSLTSGHYIAHCKQPDGS--------WSTYDDEYINK 687

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 750

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 55/108 (50%), Gaps = 17/108 (15%)

Query: 585 RKLT-TVKSSDFIVLPPILVIHLSRFYYDLT--RKNNTVITYPLILNVILKNNKV----- 636
           +K+T  +KS+  I  P  LV+HL +F ++ T   K    ++YP+ L++    ++      
Sbjct: 577 KKVTNALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISSLP 636

Query: 637 VRYKLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           VRY+L   V H G +L +GHY +   +            W T+DD+YI
Sbjct: 637 VRYQLISVVVHEGRSLSSGHYIAHCKQPDG--------SWATYDDEYI 676

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 80/363 (22%), Positives = 126/363 (34%), Gaps = 54/363 (14%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKK 361
           I GL N  NTC++NS++Q L  +      FL        + +   +  +  R + ++  K
Sbjct: 57  IAGLVNDGNTCFMNSVLQSLASSKELA-AFLDNVIENGSENNGDIKFTETLRELLLILNK 115

Query: 362 MYLNGGEAIAPNGFLK-MCKKLRPDLNIPDDQQDTQEFLLIILARLHEELS--------- 411
            Y         N  LK M      ++ +  DQ+D QEF   IL+ L + +          
Sbjct: 116 KYYKEKPYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIKKPSTEKKEE 175

Query: 412 --------------------NGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLS 451
                               N   T Y P     + N+   NP   QK Y    L   ++
Sbjct: 176 RNNIKESDLPDDALLGQDDLNNVGTVYIP-TEQIEPNSVLENPD--QKLYSPFKL---IT 229

Query: 452 PIDYIFRGQMENILKCQRCG-NSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINL 510
           P+D    G     + C  CG N    YS F  LSL +P  SL   T     +KL + +N 
Sbjct: 230 PLD----GITAERIGCLTCGENGGIRYSVFSGLSLNLPSESLNQST-----LKLSELLNE 280

Query: 511 FTSDEELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 570
           +   E + G    +C  C    +++ + +                               
Sbjct: 281 WVKPEIIEG---VECNRCSLNAVRSHLQDQIQNDTIPEKLKIAINQRLNLLTEILSKPVI 337

Query: 571 XXXXXXXXXKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYD----LTRKNNTVITYPLI 626
                     +   RK +  K       PP L IH++R  +D    + RKNN  + +   
Sbjct: 338 EEDDYKKYHTENMVRKCSKSKQILISRPPPFLSIHINRSVFDPRTYMIRKNNARVLFKTR 397

Query: 627 LNV 629
           LN+
Sbjct: 398 LNL 400

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 92/440 (20%), Positives = 157/440 (35%), Gaps = 132/440 (30%)

Query: 289 TIEDSTSLLSQLSITGLQNPCN---TCYINSIIQCLFGTTLFRDLFLTKKY--RLFLQTD 343
           T+ + T L + L   GLQ   N   TC+++SIIQ +     F +  L+ K+     +++ 
Sbjct: 116 TVMEKTELPASLHRDGLQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKHCNNCDIKSG 175

Query: 344 KYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNI-----PDDQQDTQEF 398
                  L       +      G  +    GF+ +   L    +I        QQD  E+
Sbjct: 176 TKCVSCALDEIACDFYGNGPGTGKSSSVSKGFVNL---LSASWHINHHLVGSSQQDAHEY 232

Query: 399 LLIILARLHEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFR 458
              +L +LH +                           + + +  S   D       IF+
Sbjct: 233 WQFLLNQLHTD---------------------------HARVFGSSKAPDCQCITHRIFQ 265

Query: 459 GQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELS 518
           G ++N L+C +CG S  +      LSL I               KLEDC++ F  +E L+
Sbjct: 266 GYLKNTLQCSQCGFSKTTIDPIMDLSLEI-----------KNNPKLEDCLDHFQREETLT 314

Query: 519 GDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 578
            D  ++C +C       K N+                                       
Sbjct: 315 -DFHYECQSC-------KQNQGVV------------------------------------ 330

Query: 579 XKKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDL---TRKNNTVITYPLILNVILKNNK 635
                 ++LT  K+ + +V      I L RF + L   + K N  + +PL LN+     +
Sbjct: 331 ------KQLTLHKAPNVLV------IQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQ 378

Query: 636 V-------VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHH 688
           +       + Y L   V+H G +  GHYT+ V+K ++ +       W  F+D  +     
Sbjct: 379 IEDEYIPNIAYDLLNVVSHQGTVDQGHYTT-VSKTEDGQ-------WFKFNDSVVT---- 426

Query: 689 DDFEAGKTEVSSSEVYVLFY 708
                 + +V   + Y+LFY
Sbjct: 427 ---SVTEEQVLEQQAYLLFY 443

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 45/82 (54%), Gaps = 10/82 (12%)

Query: 586 KLTTVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYP--LILN-VILKNNK----- 635
           K T VK +  +  P +L++HLSR  ++     KN   +T+P  L++N  +L+NNK     
Sbjct: 375 KSTIVKRTVSVDSPRVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVR 434

Query: 636 VVRYKLYGTVNHIGNLVNGHYT 657
            VRYKL   + HIG    GHY 
Sbjct: 435 AVRYKLCAMIKHIGTHSQGHYA 456

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 55/120 (45%), Gaps = 16/120 (13%)

Query: 598 LPPILVIHLSRFYYDLTRKNNTV----ITYPLILNVILKNNKVV--RYKLYGTVNHI-GN 650
           LP  L +HL RF Y   +  N      I YPL LNV    N  V  +Y+L G V H+ G 
Sbjct: 557 LPDTLALHLKRFKYSEKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSGIVVHMGGG 616

Query: 651 LVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD-FEAGKTEVSSSEVYVLFYE 709
             +GHY S       HEI      W+ FDD+ ++    +   E      + +  YVLFY+
Sbjct: 617 PQHGHYVSLC----KHEIF----GWLLFDDETVEAVKEEAVLEFTGESPNMATAYVLFYK 668

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           + G +N  NTCY NS++QCL+  +  R+  L
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVRENIL 170

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
           Anc_7.390 YBL067C
          Length = 846

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 58/124 (46%), Gaps = 16/124 (12%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILKNNKVVR--YKLYGTVNHIGNL 651
           LP IL +HL RF Y   +  N      + YPL LNV    +  +   Y+L G V H+G+ 
Sbjct: 645 LPHILALHLKRFKYSEVKNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMGSS 704

Query: 652 V-NGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD-FEAGKTEVSSSEVYVLFYE 709
             +GHY S     KN + G     W+ FDD+ ++        E      + +  YVLFY+
Sbjct: 705 PQHGHYVSLC---KNDKFG-----WLLFDDETVESVSESTVLEFTGDPNNQATAYVLFYK 756

Query: 710 RMDE 713
            + +
Sbjct: 757 EIKD 760

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFR 328
           + G +N  NTCY NS++QCL+    FR
Sbjct: 171 VFGYENFGNTCYCNSVLQCLYNLYEFR 197

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 97/240 (40%), Gaps = 52/240 (21%)

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLF-RDLFLTKKYRLFLQTDKYPR-EVQLSRSIYVL 358
            ++GL N  +TCY++ IIQCL     F +  F    Y+     D        L   ++ L
Sbjct: 135 GLSGLVNMGSTCYMSCIIQCLVRNPYFLKHSFNQTHYKECKIRDPVSCLSCALDSVVFEL 194

Query: 359 FKKMY------LNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEE--L 410
           + K         NGG        L    K+  DL +   QQD  EF   ++ R+H E  L
Sbjct: 195 YGKTQKKAVDDKNGGLI----DILNCTWKINEDL-VGYSQQDAHEFWQFLMNRIHSEYKL 249

Query: 411 SNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRC 470
           +N T        +    +  Q+    Y K                +F+G +E+ ++C  C
Sbjct: 250 NNNT--------IEVPKDTHQLCNCIYHK----------------VFQGFLESTIECANC 285

Query: 471 GNSSHSYSTFYV-LSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCG 529
              S + +  Y+ LSL +          K KK  L +C+N F   EEL  D ++ C NCG
Sbjct: 286 RKESKTTTEAYMDLSLDL----------KDKKT-LYECLNSFHMKEELK-DFTFHCSNCG 333

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 43/101 (42%), Gaps = 23/101 (22%)

Query: 598 LPPILVIHLSRFYYDL---TRKNNTVITYP--LILNVILK----------NNKVVRYKLY 642
           LPP+L++ L RF + L   + K N  I YP  L +N   +          ++  + Y+L 
Sbjct: 347 LPPVLLLQLKRFEHKLNGQSSKLNDSIEYPPYLRMNDYCQTSSNETIDSPDDSDIIYELI 406

Query: 643 GTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           G + H G +  GHY        N         W+ F+D  I
Sbjct: 407 GVICHTGTVNEGHYICSCKLANNQ--------WVKFNDSMI 439

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223w UBP8
          Length = 461

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 61/122 (50%), Gaps = 26/122 (21%)

Query: 598 LPPILVIHLSRFYY---DLTRKNNTVITYPLILNV--ILKNNK------VVRYKLYGTVN 646
           LPP+LV+ L RF +    + +K N  I +P IL++   LK+N+       + Y+L G ++
Sbjct: 349 LPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSILYELIGIIS 408

Query: 647 HIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVL 706
           H G++  GHY +   K +N E       W  F+D  + +         + +V   + Y+L
Sbjct: 409 HTGSVNEGHYVA-FCKIENGE-------WFKFNDSMVTK-------ILEKDVLKEQAYLL 453

Query: 707 FY 708
           FY
Sbjct: 454 FY 455

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 454

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 31/134 (23%)

Query: 585 RKLTTVKSSDFIVLPPILVIHLSRFYYDL---TRKNNTVITYPLILNV--ILKNNKV--- 636
           R+LT  K      LPP+LV+ L RF + +   + K N  I +P  L++    + +KV   
Sbjct: 336 RQLTIAK------LPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGET 389

Query: 637 --VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAG 694
             + Y+L G ++H G++  GHYTS                W  F+D  +           
Sbjct: 390 PAIVYELIGLISHQGSVNQGHYTSICKIPGGQ--------WFKFNDSMVT-------AVA 434

Query: 695 KTEVSSSEVYVLFY 708
           + +V   + Y+LFY
Sbjct: 435 EIDVLKEQAYLLFY 448

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
           carboxyl-terminal hydrolase, ubiquitin-specific protease
           that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 67/134 (50%), Gaps = 22/134 (16%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILKNNKVV--RYKLYGTVNHIGNL 651
           LP IL +HL RF Y   +K+N      I YPL L+V    N  V  +Y+L G V H+G+ 
Sbjct: 554 LPHILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGSG 613

Query: 652 -VNGHYTSDVNKEKNHEIGLNRQVWITFDDDY---IKQHHHDDFEAGKTEVSSSEVYVLF 707
             +GHY      EK    G     W+ +DD+    IK+     F     + +++  YVLF
Sbjct: 614 PQHGHYVCICRNEK---FG-----WLLYDDETVESIKEETVLQFTGHPGDQTTA--YVLF 663

Query: 708 YE--RMDESEYKEE 719
           Y+  + D++E + E
Sbjct: 664 YKETQADKTENQNE 677

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFR 328
           + G +N  NTCY NS++QCL+    FR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
           (REAL)
          Length = 763

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 60/129 (46%), Gaps = 20/129 (15%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNVI--LKNNKV-VRYKLYG 643
            VK +  +  P  L++HL +F ++ T   K    ++YP+ L++    +N  + V+Y+L  
Sbjct: 589 AVKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCENKDLPVKYQLLS 648

Query: 644 TVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSE 702
            V H G +L +GHY +   +            W T+DD+YI +    D       +  + 
Sbjct: 649 VVVHEGRSLSSGHYIAHCKQPDGS--------WATYDDEYINKISERDV------LKETN 694

Query: 703 VYVLFYERM 711
            Y L Y R+
Sbjct: 695 AYYLLYTRL 703

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 53/121 (43%), Gaps = 25/121 (20%)

Query: 598 LPPILVIHLSRFYYDLTRKN---NTVITYPLILNV-------ILKNNKVVRYKLYGTVNH 647
           LPP+LV+ L RF + +   N   N  + YPL LN+         +    + Y+L G ++H
Sbjct: 355 LPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDIIYELTGILSH 414

Query: 648 IGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLF 707
           IG++  GHY           + +N   W  F+D  I     D       E    + Y+LF
Sbjct: 415 IGSINEGHYVV--------VLKINDGRWFKFNDSMISVIKED-------EALKQQAYLLF 459

Query: 708 Y 708
           Y
Sbjct: 460 Y 460

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa]
           {ON} Anc_2.69 YNL186W
          Length = 802

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 62/133 (46%), Gaps = 24/133 (18%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNVIL-----KNNKV--VRY 639
            VK +  +  P  L++HL +F ++ T   K    ++YP+ L++        N K+  V+Y
Sbjct: 614 AVKRNTILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCDNEGNKKILPVKY 673

Query: 640 KLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEV 698
           +L   V H G +L +GHY +   +           +W T+DD+YI +       + K  +
Sbjct: 674 QLISVVVHEGRSLSSGHYVAHCKQPDG--------LWATYDDEYINKI------SDKEVL 719

Query: 699 SSSEVYVLFYERM 711
             +  Y L Y R+
Sbjct: 720 RETNAYYLVYSRL 732

 Score = 39.3 bits (90), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 80/203 (39%), Gaps = 52/203 (25%)

Query: 297 LSQLSITGLQNPCNTCYINSIIQCLFGTTLFRD-LF--LTKKYRLFLQTDKYPREVQLSR 353
           LS+L   GL N   TCY N+ +Q +      +  LF  L  KY   +  D       +S 
Sbjct: 362 LSELKPRGLLNHGVTCYTNAAVQAMLHIPAVQHYLFDILRGKYNDIISPD------SVST 415

Query: 354 SIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDD---------QQDTQEFLLIILA 404
            +    KKM+L   +    N      KKL   L   DD         Q+D+ E+ + +++
Sbjct: 416 VLAETSKKMWLPNNQLKEKNVTFINPKKLISRL---DDINCMMSEWQQEDSHEYFMSLMS 472

Query: 405 RLHEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENI 464
           RL E+                       +  K +K  E SV+ D       IF G ++ I
Sbjct: 473 RLQED-----------------------SVPKGKKLIE-SVIYD-------IFGGLLKQI 501

Query: 465 LKCQRCGNSSHSYSTFYVLSLAI 487
           + C+ CG  S +    Y LSL +
Sbjct: 502 VTCKSCGGISKTEQPIYDLSLHL 524

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 49/104 (47%), Gaps = 10/104 (9%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLT--KKYRLFLQTDKYPREVQLSRSIYVLFKK 361
           G+ N  NTCY+N+ +Q LF     R+  L   +K  +    D Y    QL R + V F+K
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVLEFDEKRAIKEGVDTY--HAQLVRELKVTFQK 160

Query: 362 MYLNGGEAIAPNGFLKMCKKLRPDLNIPD------DQQDTQEFL 399
           +    GE I P   L++ +++ P  +  D       QQD +E  
Sbjct: 161 LKDRKGENITPLLLLEILRRVFPQFSETDPQGGFYKQQDAEELF 204

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
           Anc_7.390 YBL067C
          Length = 827

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 58/129 (44%), Gaps = 21/129 (16%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILKNNKVV--RYKLYGTVNHIGNL 651
           LP  L +HL RF Y      N      I YPL LNV       +  +YKL G V H+G+ 
Sbjct: 625 LPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGIVVHMGSS 684

Query: 652 -VNGHYTSDVNKEKNHEIGLNRQVWITFDDD---YIKQHHHDDFEAGKTEVSSSEVYVLF 707
              GHY +    +K          W+ FDD+   +I +     F     E S +  YVLF
Sbjct: 685 PQQGHYVAICKTDK--------YGWLLFDDETASWINEEEVLSFIGD--EKSQNTAYVLF 734

Query: 708 YERM-DESE 715
           YE + DE++
Sbjct: 735 YEEVKDEND 743

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFR 328
           I G +N  NTCY NS++QCL+    F+
Sbjct: 154 IFGYENFGNTCYCNSVLQCLYHLDDFK 180

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
           Anc_7.390 YBL067C
          Length = 715

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 64/131 (48%), Gaps = 21/131 (16%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILKNNKVV--RYKLYGTVNHIGNL 651
           LP  L++HL RF Y   + +N      I YPL+L V   +N  +   Y L G V H+G  
Sbjct: 520 LPETLILHLKRFKYSEEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGIVLHLGGG 579

Query: 652 -VNGHYTSDVNKEKNHEIGLNRQVWITFDDDY---IKQHHHDDFEAGKTEVSSSEVYVLF 707
             +GHY S     KN + G     W+ FDD+    I +     F    T ++++  Y+L 
Sbjct: 580 PQHGHYVSIC---KNEKYG-----WLLFDDEVVVSITEESVLKFVGDPTTLTTA--YLLV 629

Query: 708 YERMDESEYKE 718
           Y+  DE +Y+E
Sbjct: 630 YKLKDE-KYEE 639

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRD 329
           + G +N  NTCY NS++QCL+     RD
Sbjct: 111 VFGYENFGNTCYCNSVLQCLYNIPELRD 138

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 92/238 (38%), Gaps = 55/238 (23%)

Query: 304 GLQNPCNTCYINSIIQCLF--GTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVL--F 359
           G  N  N+CY+NS++QCLF  G   +  L        F     YP      + I +L  F
Sbjct: 334 GFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQLIKILNAF 393

Query: 360 KKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYY 419
           K    N  E I P  F     +   +    ++QQD  EFL  +L +L + L       + 
Sbjct: 394 KLNPENYPEGIKPQSFKNYVGQSNKEFK-SNNQQDATEFLTFLLEQLEKTL-------FK 445

Query: 420 PDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYST 479
            D           NP+   K+                    ME+ ++CQ CGN  +SY  
Sbjct: 446 KD----------NNPNNIMKFI-------------------MEDKIQCQSCGNVKYSYEP 476

Query: 480 FYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDN-SWDCPNCGTTDLKTK 536
              + L +        T+  + + +E   N F      +G+N  +DCP C  T + TK
Sbjct: 477 TEYIQLPL------DGTNNPQNL-VETLTNFF------NGENIDFDCPTCKKTVVATK 521

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
           Ashbya gossypii AFR551W
          Length = 466

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 25/110 (22%)

Query: 585 RKLTTVKSSDFIVLPPILVIHLSRFYYDL---TRKNNTVITYPLILNV--------ILKN 633
           R+LTT K      LPP+L++ L RF + +   + K N  I++PL LN+         L  
Sbjct: 350 RQLTTAK------LPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPVDCLHP 403

Query: 634 NKVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
              + YKL   ++H G +  GHYT+           +N  +W  F+D  +
Sbjct: 404 VPNMMYKLSAIISHHGTVHQGHYTTICR--------INGDIWAKFNDSMV 445

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
           cerevisiae YBL067c UBP13
          Length = 724

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 56/124 (45%), Gaps = 14/124 (11%)

Query: 591 KSSDFIVLPPILVIHLSRFYYD--LTRKNNTVITYPLILNV--ILKNNKVVRYKLYGTVN 646
           K+  F  LP  L +HL RF  D  +  K    I YPL L V     N+    Y+L G V 
Sbjct: 531 KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 647 HIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSS-EVY 704
           H+G +  +GHY S    EK          W+ +DD+ I+    +   +   E ++    Y
Sbjct: 591 HVGASPTHGHYVSICKHEK--------YGWLMYDDETIESIPEEAVTSHVGEPNNPITAY 642

Query: 705 VLFY 708
           VLFY
Sbjct: 643 VLFY 646

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 286 KLPTIEDS--TSLL----SQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLF 339
           ++PTI D+  T L+        + G +N  +TCY NS++QC++    FR   L    R  
Sbjct: 98  QIPTIVDTNVTKLMPFGDGSNKVFGYENFGHTCYCNSVLQCIYNLPEFRKSILQFPQRYP 157

Query: 340 LQT 342
           L++
Sbjct: 158 LKS 160

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
           (REAL)
          Length = 788

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 20/129 (15%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNVIL---KNNKVVRYKLYG 643
            VK +  +  P  L++HL +F ++ T   K    ++YP+ L++       +  V+Y+L  
Sbjct: 614 AVKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCDDKDLPVKYQLLS 673

Query: 644 TVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSE 702
            V H G +L +GHY +   +            W T+DD+YI +    D       +    
Sbjct: 674 VVVHEGRSLSSGHYIAHCKQPDG--------TWATYDDEYINKISERDV------LKEPN 719

Query: 703 VYVLFYERM 711
            Y L Y R+
Sbjct: 720 AYYLLYTRL 728

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 702

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 59/134 (44%), Gaps = 21/134 (15%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNV----ILKNNKVVRYKLY 642
            +K +  +  P  L++HL +F ++ T   K    ++YP+ L++    +      ++Y+L 
Sbjct: 531 AIKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTDYCVEGKELPLKYQLI 590

Query: 643 GTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSS 701
             V H G +L +GHY     + + H        W T+DD+YI   +  D       +   
Sbjct: 591 TVVVHEGRSLSSGHYIVHCKQPEGH--------WATYDDEYINNINEKDV------LREP 636

Query: 702 EVYVLFYERMDESE 715
             Y L Y R+   E
Sbjct: 637 NAYYLVYTRLTPKE 650

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 61/125 (48%), Gaps = 20/125 (16%)

Query: 598 LPPILVIHLSRFYYDLTRKNNTV-----ITYPLILNV--ILKNNKVVRYKLYGTVNHIGN 650
           LP  LV+HL RF Y    KN  +     + YP  LN+  +  ++   +Y+L   V HIG 
Sbjct: 540 LPKHLVVHLKRFKY-CEEKNCNIKLFNKVNYPFTLNISSVFDDSISKKYELNSIVVHIGE 598

Query: 651 LVN-GHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAG--KTEVSSSEVYVLF 707
               GHY + + K K++        W+ +DD+ + Q   D+  +     E  S+  Y+LF
Sbjct: 599 SPQLGHYVT-LCKHKSYG-------WLIYDDETV-QAVSDELVSRILNNEQRSATAYLLF 649

Query: 708 YERMD 712
           YE +D
Sbjct: 650 YEEVD 654

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 17/28 (60%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRD 329
           + G QN   TCY NSI+Q LF    FRD
Sbjct: 105 VFGFQNFGYTCYCNSILQALFNIGSFRD 132

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 22/127 (17%)

Query: 586 KLTTVKSSDFIVLPPILVIHLSRFYYD---LTRKNNTV-------ITYPLILNVILKNNK 635
           K   +K +  I  P  L++HLSR  ++   +TR    V       +   +++N   +  +
Sbjct: 324 KSNIIKKNAVIKEPASLIVHLSRSIFNGATITRSACRVEYEQSLNLQRQVMINDAFERTE 383

Query: 636 VVRYKLYGTVNHIGNLVNGHYTS-----DVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD 690
            ++Y+L   V H G+ V GHY       D+ KE+N +  +NR          IK++  D 
Sbjct: 384 PIKYELKSVVKHTGSHVQGHYQCYRKKPDLMKERNTDTIVNR-------SPMIKKYSQDK 436

Query: 691 FEAGKTE 697
           F+A K E
Sbjct: 437 FDASKIE 443

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 55/120 (45%), Gaps = 14/120 (11%)

Query: 297 LSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDK---YPREVQLSR 353
            +Q+ I GL N  NTCY+NS +Q L+     RD+ L  K +  +Q      Y    +L R
Sbjct: 104 FNQMPI-GLLNMGNTCYMNSTLQALYRVDGLRDMVLKYKEQANVQPGDELHYKLISELKR 162

Query: 354 SIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDD------QQDTQEFLLIILARLH 407
               L KK Y    E++ P  FL + +K  P     D+      QQD +E    + + L+
Sbjct: 163 CFENLQKKSY----ESVMPVVFLNLLRKCYPQFAEVDNANGIFKQQDAEELFTQLFSSLN 218

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
           Anc_7.390 YBL067C
          Length = 765

 Score = 44.7 bits (104), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 63/131 (48%), Gaps = 20/131 (15%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILN--VILKNNKVVRYKLYGTVNHI-GN 650
           LP  L +HL RF Y   +  N      I YPL L+      ++   +Y+L G V H+ G 
Sbjct: 568 LPHTLALHLKRFKYSEEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGIVVHMGGG 627

Query: 651 LVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHH---DDFEAGKTEVSSSEVYVLF 707
             +GHY S     KN   G     W+ FDD+ ++  H      F   +  ++++  YVLF
Sbjct: 628 PQHGHYVSLC---KNDNFG-----WLLFDDETVEAVHESTVSKFIGDRDSLTTA--YVLF 677

Query: 708 YERMDESEYKE 718
           Y+ + +SE ++
Sbjct: 678 YKEIAQSENQD 688

 Score = 38.1 bits (87), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           + G +N  NTCY NS++QCL+  T FR L L
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 53/124 (42%), Gaps = 10/124 (8%)

Query: 292 DSTSLLSQLSIT--GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREV 349
           D  + +  LS T  GL+N  NTCY+NS +Q L+     RD  L   Y++  +     +  
Sbjct: 47  DEGAQMQHLSQTPVGLKNLGNTCYMNSTLQALYQIKPLRDEVLN--YKVPREKPSEEQHH 104

Query: 350 QLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDD------QQDTQEFLLIIL 403
           QL   +   F+++     E++ P   L M +K  P     D       QQD +E    I 
Sbjct: 105 QLVSELRRCFQQLKDKPQESVTPMLLLAMLRKCYPQFAERDQESGFYKQQDAEELFTQIF 164

Query: 404 ARLH 407
             L 
Sbjct: 165 NSLR 168

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
           (REAL)
          Length = 776

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 58/129 (44%), Gaps = 20/129 (15%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNVIL---KNNKVVRYKLYG 643
            VK +  +  P  L++HL +F ++ T   K    ++YP+ L++       +  V+Y+L  
Sbjct: 602 AVKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCDDKDLPVKYQLLS 661

Query: 644 TVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSE 702
            V H G +L +GHY +   +   +        W T+DD+YI +    D       +    
Sbjct: 662 VVVHEGRSLSSGHYIAHCKQPDGN--------WATYDDEYINKISERDV------LKEPN 707

Query: 703 VYVLFYERM 711
            Y L Y R+
Sbjct: 708 AYYLLYTRL 716

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 83/211 (39%), Gaps = 38/211 (18%)

Query: 283 ALNKLPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFR----DLFLTKKYRL 338
           +LN    I++     + L   GL N   TCY N+ +Q +      +    D+ L K    
Sbjct: 324 SLNSTRVIKNWGDQFTNLKPRGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDVLLGKYDST 383

Query: 339 FLQTDKYPREVQLSRSIYVLFKKMYLNGGEA--IAPNGFLKMCKKLRPDLNIPDDQQDTQ 396
             +        + S+ +++   K Y     A  I P   +     +   ++    Q+D+ 
Sbjct: 384 ISKNSVSYTLAETSKKMWLPLSKNYKKNSPASYINPKHLISRLDDINCMMS-EWQQEDSH 442

Query: 397 EFLLIILARLHEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYI 456
           E+ + +++RL E+                       +  K  K  E S++ D       I
Sbjct: 443 EYFMSLMSRLQED-----------------------SVPKGHKLIE-SIIYD-------I 471

Query: 457 FRGQMENILKCQRCGNSSHSYSTFYVLSLAI 487
           F G ++ I+ C+ CG++S +   FY LSL +
Sbjct: 472 FGGLLKQIVTCKSCGSTSKTEQPFYDLSLHL 502

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 58/126 (46%), Gaps = 18/126 (14%)

Query: 598 LPPILVIHLSRFYYDLTRKNNT----VITYPLILNVILKNNKVVR--YKLYGTVNHIG-N 650
           LP  L IHL RF Y      N      I YP+ L V    ++ V   Y+L G V HIG  
Sbjct: 527 LPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGLVVHIGIG 586

Query: 651 LVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEA--GKTEVSSSEVYVLFY 708
             +GHY S     K  + G     W+ FDD+ ++    D   +  G +  S+   YVLFY
Sbjct: 587 PQHGHYISVC---KTSDYG-----WLLFDDETVECISEDTVLSFVGDSN-SAGTAYVLFY 637

Query: 709 ERMDES 714
           + ++ S
Sbjct: 638 KEINSS 643

 Score = 38.5 bits (88), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           + GL+N  NTCY NSI+QCL+    FR+  L
Sbjct: 130 VYGLENFGNTCYCNSILQCLYNMNEFRENIL 160

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 62/159 (38%), Gaps = 32/159 (20%)

Query: 370 IAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDLVSYDANA 429
           I+P GF+++ KK    L   D  QD  EFL  +L           V++Y       D   
Sbjct: 386 ISPGGFMEIVKKENI-LFATDMHQDAHEFLNFLL---------NDVSDYL------DKAN 429

Query: 430 FQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPK 489
            + NP   +   E + + D       IF+G + N ++C  C   +  Y +F  L   I  
Sbjct: 430 TEKNPDNTRSGNETNFVND-------IFKGTITNQIRCLTCDTVTSRYESF--LDFPIEV 480

Query: 490 ISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNC 528
           I         + I ++  +  +   E L G N + C  C
Sbjct: 481 IG-------DETIDIQKMMISYHQKEMLQGSNKFYCGTC 512

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
           YNL186W
          Length = 661

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 59/137 (43%), Gaps = 24/137 (17%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYDLT--RKNNTVITYPLILNVIL------KNNKV-VRY 639
            VK S  I  P  L+ HL +F ++ T   K    ++YP+ L++        K++ V V+Y
Sbjct: 490 AVKRSSIIRAPETLLTHLKKFRFNGTASSKMKQAVSYPMFLDLTEYCESNEKDHVVPVKY 549

Query: 640 KLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEV 698
           +L   V H G +L +GHY     +            W T+DD+YI +    D       +
Sbjct: 550 QLTTVVVHEGRSLSSGHYIVHCKQPDG--------TWATYDDEYINKITERDV------L 595

Query: 699 SSSEVYVLFYERMDESE 715
                Y L Y R+   E
Sbjct: 596 KEPNAYYLLYTRLTPKE 612

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
           (REAL)
          Length = 749

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 61/122 (50%), Gaps = 20/122 (16%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILKNNKVV--RYKLYGTVNHIGNL 651
           LP IL +HL RF Y   +K+N      I YPL L+V    +  V  +Y+L G V H+G+ 
Sbjct: 552 LPYILSLHLKRFKYSEEQKSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSG 611

Query: 652 -VNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHD---DFEAGKTEVSSSEVYVLF 707
             +GHY       KN + G     W+ +DD+ ++    +    F     + +++  YVLF
Sbjct: 612 PQHGHYVCIC---KNEKFG-----WLLYDDETVESIREETVLQFTGHPGDQTTA--YVLF 661

Query: 708 YE 709
           Y+
Sbjct: 662 YK 663

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFR 328
           + G +N  NTCY NS++QCL+    FR
Sbjct: 133 VFGYENFGNTCYCNSVLQCLYNIPEFR 159

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 54/108 (50%), Gaps = 18/108 (16%)

Query: 586 KLTT--VKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNVI---LKNNKV-- 636
           K TT  +K +  +  P  L++HL +F ++ T   K    ++YPL +++    ++  K   
Sbjct: 576 KATTNAIKRNMILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPLFMDLTEYCVEAAKCLP 635

Query: 637 VRYKLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           V+Y+L   V H G +L +GHY +   +            W T+DD+YI
Sbjct: 636 VKYQLISVVVHEGRSLSSGHYIAHCKQPDG--------TWATYDDEYI 675

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
           UBP10Ubiquitin-specific protease that deubiquitinates
           ubiquitin-protein moieties; may regulate silencing by
           acting on Sir4p; involved in posttranscriptionally
           regulating Gap1p and possibly other transporters;
           primarily located in the nucleus
          Length = 792

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 48/101 (47%), Gaps = 14/101 (13%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNVIL---KNNKVVRYKLYG 643
            VK S  +  P  L++HL +F ++ T   K    ++YP+ L++          V+Y+L  
Sbjct: 619 AVKHSSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCESKELPVKYQLLS 678

Query: 644 TVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
            V H G +L +GHY +   +            W T+DD+YI
Sbjct: 679 VVVHEGRSLSSGHYIAHCKQPDGS--------WATYDDEYI 711

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186W UBP10 Ubiquitin-specific protease that
           deubiquitinates ubiquitin-protein moieties may regulate
           silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 739

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 16/103 (15%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNVI-----LKNNKVVRYKL 641
            +K +  +  P  L+IHL +F ++ T   K    ++YP+ L++       +    V+Y+L
Sbjct: 570 AIKRNSILRAPETLLIHLKKFRFNGTSSSKMKQAVSYPMFLDMSEYCEDQQKTLPVKYQL 629

Query: 642 YGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
              V H G +L +GHY +   +            W T+DD+YI
Sbjct: 630 ISVVVHEGRSLSSGHYIAHCKQPDG--------SWATYDDEYI 664

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 14/113 (12%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKMY 363
           G QN  NTCY+NS +Q LF   + +D+ L  K     + +    E +L   I +  KK +
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMILNYK----TEGNNISPEDELHHKIVIELKKCF 165

Query: 364 --LNGG--EAIAPNGFLKMCKKLRPDLNIPDD------QQDTQEFLLIILARL 406
             L+G   +A+ P   L + +K  P     D       QQD +E    +   L
Sbjct: 166 ETLDGKKFKAVMPVVLLSVLRKCYPQFAERDSQSGFYKQQDAEELFTQLFQTL 218

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 7/74 (9%)

Query: 639 YKLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTE 697
           Y L G + H G N  +GHY S +  E + +       W  F+DD + ++  D  E     
Sbjct: 436 YDLIGIITHQGANSESGHYQSFIRDENDED------KWYKFNDDKVSEYEKDKIEQLAGG 489

Query: 698 VSSSEVYVLFYERM 711
             S    +L Y+ M
Sbjct: 490 GESDSALILIYKGM 503

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 58/122 (47%), Gaps = 20/122 (16%)

Query: 598 LPPILVIHLSRFYYDLTRKNNT----VITYPLILNVILKNNKVV--RYKLYGTVNHI-GN 650
           LP  L +HL RF Y   + +N      ++YPL L V    N  +   Y+L G V H+ G 
Sbjct: 566 LPKTLALHLKRFKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGIVVHMGGG 625

Query: 651 LVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHD---DFEAGKTEVSSSEVYVLF 707
             +GHY S     KN + G     W+ FDD+ ++         +   K  ++++  YVLF
Sbjct: 626 PQHGHYISLC---KNEKFG-----WLLFDDETVEAISEQAVLQYTGDKDTMTTA--YVLF 675

Query: 708 YE 709
           Y+
Sbjct: 676 YQ 677

 Score = 35.8 bits (81), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           I G +N  NTCY NS++QCL+    FR+  L
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFRNDML 179

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 65/166 (39%), Gaps = 26/166 (15%)

Query: 363 YLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDL 422
           YL G   + P+ F++M K+    L      QD  EFL+ +L  + + L           +
Sbjct: 412 YLTG--VVTPSAFIEMLKRENV-LFSSMMHQDAHEFLIFLLNEISDFLDKQNKNALNSKI 468

Query: 423 VSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYV 482
             YD++  + N    + +            +  IF+G + N +KC  C N++     F  
Sbjct: 469 --YDSSQGRRNSGTVKNF------------VSDIFQGTLTNRIKCLTCDNTTARDEPFLD 514

Query: 483 LSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNC 528
             + +          ++  I +++ +  F   E L G N + C  C
Sbjct: 515 FPIEV---------QENVDIDIQEILESFHQKEMLHGPNKFYCDEC 551

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
           YNL186W
          Length = 784

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 58/136 (42%), Gaps = 27/136 (19%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNVILKNNK----------V 636
             K +  +  P  L++HL +F ++ T   K    ++YP+ L++    +K           
Sbjct: 583 AAKRNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTKYCDKEATPKGQDVLP 642

Query: 637 VRYKLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGK 695
           V+Y+L   V H G +L +GHY +   +            W T+DD+YI +    D     
Sbjct: 643 VKYQLISVVVHEGRSLSSGHYIAHCKQPDGS--------WSTYDDEYINKITERDV---- 690

Query: 696 TEVSSSEVYVLFYERM 711
             +  S  Y L Y R+
Sbjct: 691 --LRESNAYYLVYTRL 704

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 465

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 22/118 (18%)

Query: 598 LPPILVIHLSRFYYDL---TRKNNTVITYPLILNV--ILKNNKV--VRYKLYGTVNHIGN 650
           LP +LV+ L RF + L   + K N ++ +PL LN+      + V  + ++L G + H G 
Sbjct: 357 LPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDVPDIIFELIGIIAHRGT 416

Query: 651 LVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFY 708
           +  GHY +       H        W  F+D  +           + E+   + Y+LFY
Sbjct: 417 VNEGHYIAFTKVTTGH--------WFKFNDSMVS-------SITEEELLQEQAYLLFY 459

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 56/245 (22%), Positives = 100/245 (40%), Gaps = 48/245 (19%)

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKY--RLFLQTDKYPREVQLSRSIYVL 358
            + GL N  +TC+++SI+QCL     F    + + +  R  LQ         L R ++  
Sbjct: 135 GLQGLLNMGSTCFMSSIVQCLIHNPYFFQFSINQLHSQRCPLQDPLSCISCALDRMVWEF 194

Query: 359 FKKMYL-NGGEAIAPN--------GFLKM-CKKLRPDLNIPD-DQQDTQEFLLIILARLH 407
           +    L   GE  + N        GF+ +     + + N+    QQD  E+   +L +LH
Sbjct: 195 YGHPELIKNGEDDSNNSRTSDEYAGFIGLFVSSWKINENLAGYFQQDAHEYWQFLLNQLH 254

Query: 408 EELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKC 467
            +            +VS++ +  + N ++         L D ++     F+G +++ + C
Sbjct: 255 NDY-----------MVSHNKSPDETNFAE---------LCDCIA--HSTFQGSLKSSIVC 292

Query: 468 QRCG-NSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCP 526
             C  +S  +   F  LSL I             K  L +C++ F   E+L  D ++ C 
Sbjct: 293 PECKMDSKTTKDPFMDLSLDI-----------KDKSNLYECLDSFHKMEQLH-DFNYHCD 340

Query: 527 NCGTT 531
            C TT
Sbjct: 341 RCNTT 345

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186w UBP10
          Length = 771

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 16/103 (15%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNVI-----LKNNKVVRYKL 641
            +K +  +  P  L++HL +F ++ T   K    ++YP+ L++       K    V+Y+L
Sbjct: 605 ALKRNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDMTEYCEESKKMLPVKYEL 664

Query: 642 YGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
              V H G +L +GHY +   +            W T+DD+YI
Sbjct: 665 LSVVVHEGRSLSSGHYIAHCKQPDGS--------WATYDDEYI 699

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
           (UBP10) - predicted to encode a ubiquitin-processing
           protease [contig 103] PARTIAL
          Length = 511

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 17/107 (15%)

Query: 586 KLTTVKSSDFIV-LPPILVIHLSRFYYDLTR--KNNTVITYPLILNVI--LKNNKV---V 637
           K T     +F++  P  L++HL +F ++ T   K    ++YP+ L++    +N+     V
Sbjct: 334 KTTNASKHNFLLRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDLTEYCENSATALPV 393

Query: 638 RYKLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           +Y+L   V H G +L +GHY +   +            W T+DD+YI
Sbjct: 394 KYQLISVVVHEGRSLSSGHYIAHCKQPDGS--------WSTYDDEYI 432

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa]
           {ON} YMR223W (UBP8) - putative deubiquitinating enzyme
           [contig 70] FULL
          Length = 454

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 53/129 (41%), Gaps = 25/129 (19%)

Query: 590 VKSSDFIVLPPILVIHLSRFYYDL---TRKNNTVITYPLILNVILKNNKV-------VRY 639
           +K      LPP+LV+ L RF + +   + K N  I YP  LN+    ++        + Y
Sbjct: 335 IKQMTIAKLPPVLVLQLKRFEHLMNGNSVKLNEKIAYPTYLNMAPFCHQSESRPVPDMMY 394

Query: 640 KLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVS 699
           +L   ++H G++  GHYTS                W  F+D  I           + E  
Sbjct: 395 ELVAVISHEGSVNQGHYTSMCKIPGGQ--------WFRFNDSMI-------VSISEEEAL 439

Query: 700 SSEVYVLFY 708
             + Y+LFY
Sbjct: 440 RQQAYLLFY 448

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 93/262 (35%), Gaps = 71/262 (27%)

Query: 289 TIEDSTSLL----------SQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRL 338
            +ED T +L           +    G +N   TCY+NS++Q  F T  FRDL     Y++
Sbjct: 235 VLEDPTGVLWHNFINYDSKKETGYVGFRNQGATCYLNSLLQSYFFTKYFRDLV----YQI 290

Query: 339 FLQTDKYPRE---VQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDT 395
               D+ P +   + L R+ Y L    Y        P   L++ +    D      Q D 
Sbjct: 291 -PTADENPNDSVALALQRAFYQLQVSNY--------PLDTLELTRSFGWDTAEAFTQHDV 341

Query: 396 QEFLLIILARLHEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDY 455
           QE   I++ RL   +   +V                          EG  LTD       
Sbjct: 342 QELNRILMDRLESRMKGTSV--------------------------EGK-LTD------- 367

Query: 456 IFRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDE 515
           +F G+M++ +KC      S     F+ + L +  +             L +    +   E
Sbjct: 368 VFVGKMKSYIKCVNIDYESSRVEDFWDIQLNVKGLE-----------GLANAFENYIEVE 416

Query: 516 ELSGDNSWDCPNCGTTDLKTKI 537
            + G+N +   + G  D K  +
Sbjct: 417 LMDGENQYAAQDYGLQDAKKGV 438

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 19/101 (18%)

Query: 595 FIVLPPILVIHLSRFYYD-----LTRKNN------TVITYPLILNVILKNNKVVR-YKLY 642
           F   P +L + L RF YD     L + N+      T+   P +   +LK  K    Y L+
Sbjct: 440 FESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNNYNLH 499

Query: 643 GTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           G + H G++  GHY + +    + +       W  FDD+ +
Sbjct: 500 GVLVHTGDISTGHYYAMIKPTTDDK-------WYRFDDEKV 533

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 75/192 (39%), Gaps = 46/192 (23%)

Query: 303 TGLQNPCNTCYINSIIQCLF--GTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFK 360
            GL N  N+CY+NS++Q L   G   +   FL  ++ L +    YP      + I +L  
Sbjct: 323 CGLINLGNSCYLNSVMQSLLNGGVPSWSLDFLGSEFPLDVV---YPANNLKCQWIKLLNA 379

Query: 361 -----KMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTV 415
                K+Y NG   I P  F K   K   + +  + QQD  EFL  +L  L         
Sbjct: 380 MKHEPKLYANG---IKPTTFKKCIGKNHEEFS-SNRQQDAMEFLTFLLDSL--------- 426

Query: 416 TEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSH 475
                     D N F  N +             G S  + + R  ME+ L+C +CG   +
Sbjct: 427 ----------DRNFFSDNSA-------------GASNPNDLMRFMMEDRLQCNKCGKVKY 463

Query: 476 SYSTFYVLSLAI 487
           SY     + L +
Sbjct: 464 SYEPAEAIQLPL 475

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa]
           {ON} Anc_2.69 YNL186W
          Length = 898

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 50/105 (47%), Gaps = 17/105 (16%)

Query: 590 VKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNVI----LKNNKV--VRYKL 641
            K S  +  P  L+IHL +F ++ T   K    ++YP+ L++        + +  V+Y+L
Sbjct: 698 TKRSTILRAPETLLIHLKKFRFNGTSSSKMKQAVSYPMFLDLTEFCEAGKDSILPVKYQL 757

Query: 642 YGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ 685
              V H G +L +GHY +   +            W T+DD+YI +
Sbjct: 758 LSVVVHEGRSLSSGHYIAHCKQPDGS--------WATYDDEYINK 794

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
           (REAL)
          Length = 754

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 61/124 (49%), Gaps = 20/124 (16%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILKNNKVV--RYKLYGTVNHIGNL 651
           +P IL +HL RF Y   + +N      I YPL L+V    +  V  RY+L G V H+G+ 
Sbjct: 557 VPYILSLHLKRFKYSEEQNSNIKLFNKIRYPLRLDVSSTFDTSVSKRYELSGVVIHMGSG 616

Query: 652 -VNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHD---DFEAGKTEVSSSEVYVLF 707
             +GHY       KN + G     W+ +DD+ ++    +    F     + +++  YVLF
Sbjct: 617 PQHGHYVCIC---KNEKFG-----WLLYDDETVESVSEETVLKFTGHSGDQTTA--YVLF 666

Query: 708 YERM 711
           Y+ +
Sbjct: 667 YKEI 670

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSI 355
           + G +N  NTCY NS++QCL+    FR   L           +YP  + +S  I
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFRCNVL-----------RYPERIPVSNRI 177

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 43/102 (42%), Gaps = 20/102 (19%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYPLILNVI---------LKNNKVVRYKL 641
           F   PP+L + L RF YD       K N    +P  ++V          L N +   Y L
Sbjct: 384 FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEACIYNL 443

Query: 642 YGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           +G + H G++  GHY + +    + E       W  FDDD +
Sbjct: 444 HGVLVHAGDISTGHYYTMIRPGVSDE-------WYRFDDDKV 478

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 47/235 (20%), Positives = 82/235 (34%), Gaps = 55/235 (23%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKM 362
            G +N   TCY+NS++Q  F T  FR L       +    +  P  + L R+ Y L    
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYEIPTDMDSPNNSVP--LALQRAFYQL---- 256

Query: 363 YLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDL 422
                 +  P   L++ +    D      Q D QE   I++ RL   +    V       
Sbjct: 257 ----QVSNEPLDTLELTRSFGWDNGDAFTQHDVQELNRILMDRLENRMKETPV------- 305

Query: 423 VSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYV 482
                              EG         ++ +F G+M++ +KC      S     F+ 
Sbjct: 306 -------------------EGK--------LNELFVGKMKSYIKCINVDYESSRVEDFWD 338

Query: 483 LSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
           L L +  +             LE+  + +   E ++G+N +   + G  D +  +
Sbjct: 339 LQLNVKNLK-----------GLEESFSNYIEIELMNGENQYAAQDYGLQDAEKGV 382

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 56/116 (48%), Gaps = 15/116 (12%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREV-----QLSRSIYVL 358
           GL N  N+CY+NS++QC     LF+D   T K ++ +  +++P +V      L   +  L
Sbjct: 321 GLINMGNSCYLNSVLQC-----LFQDETWTGKLQMAV-GEEFPTDVVFPSNNLRCQLIKL 374

Query: 359 FKKMYLNG---GEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELS 411
           ++ M L      + I P  F K C     +      QQD  EFL  ++  L ++LS
Sbjct: 375 YRAMKLEPELYPQGIKPQSF-KKCFSAGHEEFASQRQQDAMEFLTYMIDNLDKKLS 429

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 54/127 (42%), Gaps = 31/127 (24%)

Query: 598 LPPILVIHLSRFYYDLT---RKNNTVITYPLILNVI-----------LKNNKV--VRYKL 641
           LP +LV+ L RF + L    RK +  I +P  LN+            + N KV  + Y+L
Sbjct: 354 LPSVLVLQLKRFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNKKVPDIIYEL 413

Query: 642 YGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSS 701
            G V+H G +  GHY +           ++   W  F+D  +           + EV   
Sbjct: 414 IGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVS-------SISQEEVLKE 458

Query: 702 EVYVLFY 708
           + Y+LFY
Sbjct: 459 QAYLLFY 465

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 104/242 (42%), Gaps = 45/242 (18%)

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKY--RLFLQTDKYPREVQLSRSIYVL 358
            ++GL N  +TC+++SI+QCL     F    +++ +  +  +++        L + ++ L
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYFIKHSMSQSHFNKCKVRSPDNCFSCALDKIVHEL 194

Query: 359 FKKMYLNG--GEAIAPN---GFLKM--CKKLRPDLNIPD-DQQDTQEFLLIILARLHEEL 410
           +  +  +     + A N   GF+ +  C   + + N+    QQD  EF   I+ ++H+  
Sbjct: 195 YGVLNTDQPPSSSSATNRQAGFIYLLTCA-WKINQNLAGYSQQDAHEFWQFIINQIHQN- 252

Query: 411 SNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRC 470
                  Y   L           PS  +   E     D +  +  +F G +E+ + C  C
Sbjct: 253 -------YVLSL-----------PSTKESDKENIKHCDCI--VHTVFEGSLESSIVCPSC 292

Query: 471 GNSSH-SYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCG 529
            N+S  +   F  LSL I          K KK KL +C++ F   +EL  D ++ C  C 
Sbjct: 293 QNNSKTTIDPFMDLSLDI----------KDKK-KLYECLDSF-HKKELLKDFNYHCGECN 340

Query: 530 TT 531
           +T
Sbjct: 341 ST 342

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 19/101 (18%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYPLILNV--------ILKNNKVVRYKLY 642
           F   PPIL + L RF YD       K N    +P  ++V        + +N +  +Y L+
Sbjct: 388 FESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCKYTLH 447

Query: 643 GTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           G + H G++  GHY + +  +   +       W  FDD+ +
Sbjct: 448 GVLVHTGDISTGHYYAMIKPDLQDQ-------WYRFDDEKV 481

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 48/235 (20%), Positives = 80/235 (34%), Gaps = 55/235 (23%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKM 362
            G +N   TCY+NS++Q  F T  FR L            D  P  + L R+ Y L    
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYQIPTENESPNDSVP--LALQRAFYQL---- 260

Query: 363 YLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDL 422
                 +  P   L++ +    D      Q D QE   I++ RL   +    V       
Sbjct: 261 ----QVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTPV------- 309

Query: 423 VSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYV 482
                              EG         ++ +F G+M++ +KC      S     F+ 
Sbjct: 310 -------------------EGK--------LNELFVGKMKSYIKCINVDYESSRVEDFWD 342

Query: 483 LSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
           L L +  +             LE+    +   E ++G+N +   + G  D +  +
Sbjct: 343 LQLNVKNLK-----------GLEESFKNYIEIELMNGENQYAAQDFGLQDAEKGV 386

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
           (REAL)
          Length = 748

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 61/122 (50%), Gaps = 20/122 (16%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNV--ILKNNKVVRYKLYGTVNHIGNL 651
           LP IL +HL RF Y   +++N      I YPL L+V     ++   +Y+L G V H+G+ 
Sbjct: 546 LPYILSLHLKRFEYSEGQQSNIKLFNKILYPLSLDVSSTFDSSISKKYELSGVVIHMGSG 605

Query: 652 -VNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHD---DFEAGKTEVSSSEVYVLF 707
             +GHY       KN + G     W+ +DD+ ++    +    F     + +++  YVLF
Sbjct: 606 PQHGHYVCIC---KNEKFG-----WLLYDDETVESIREETVLKFTGHPGDQTTA--YVLF 655

Query: 708 YE 709
           Y+
Sbjct: 656 YK 657

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 15/68 (22%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKK 361
           + G +N  NTCY NS++QCL+  + FR   L           +YP  V +   I    +K
Sbjct: 125 VFGYENFGNTCYCNSVLQCLYNISEFRCNVL-----------RYPERVPVVSRI----RK 169

Query: 362 MYLNGGEA 369
             LNG +A
Sbjct: 170 SDLNGSKA 177

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
           (REAL)
          Length = 473

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 54/129 (41%), Gaps = 33/129 (25%)

Query: 598 LPPILVIHLSRFYYDLT---RKNNTVITYPLILNVI-------------LKNNKV--VRY 639
           LP +LV+ L RF + L    RK +  I +P  LN+              + N KV  + Y
Sbjct: 354 LPSVLVLQLKRFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESENHIGNGKVPDIIY 413

Query: 640 KLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVS 699
           +L G V+H G +  GHY +           ++   W  F+D  +           + EV 
Sbjct: 414 ELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVS-------SISQEEVL 458

Query: 700 SSEVYVLFY 708
             + Y+LFY
Sbjct: 459 KEQAYLLFY 467

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 86/385 (22%), Positives = 140/385 (36%), Gaps = 84/385 (21%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRL--FL------QTDKY--PREVQLS 352
           TGL N  N C+INS +Q L G+  F   +L    R   FL      + ++Y  P    ++
Sbjct: 69  TGLINKGNDCFINSSLQGLAGSQRFNH-YLNSVLRCLKFLNENPKQEGNRYALPLHQVMA 127

Query: 353 RSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSN 412
             IY L    +LN  E+ +    + M    +  ++    Q D QEF  ++L  LH E   
Sbjct: 128 EFIYDLQAPTFLNTVES-SDKIIVTMESIFKQKMS--RRQNDAQEFTQLLLEVLHNE--- 181

Query: 413 GTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCG- 471
                 Y +L+                    + +T+ L    Y F G+  + L C +CG 
Sbjct: 182 ------YQELIRL-----------------MNFITNNLDIPTYPFEGKYCHELTCLKCGR 218

Query: 472 NSSHSYSTFYVLSL---AIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNS-----W 523
           NS      F +L+L   A P ISL                     DE +SG NS     +
Sbjct: 219 NSEVKMFDFDILTLNLPAQPSISL---------------------DELISGSNSDVIEGF 257

Query: 524 DCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKWN 583
            C  C  + +                                                  
Sbjct: 258 SCTVCKVSAILGGTGTHNPNTRSLIKSLKEIFPELKINTELDEPLNSFVDSYSHDGVITR 317

Query: 584 SRKLTTVKSSDFIVLPPILVIHLSRFYYD----------LTRKNNTVITYPLILN--VIL 631
           + K T VK + F+ +P IL+IHL+R  ++          +      ++ + L+++   ++
Sbjct: 318 NIKSTIVKKTVFVEVPDILLIHLTRSMFNGMSYTRNACKIAYDEKLLLEHQLVMDGVSVM 377

Query: 632 KNNKVVRYKLYGTVNHIGNLVNGHY 656
           +NN  ++Y L   + H G+   GHY
Sbjct: 378 RNN--IQYTLSSAIKHSGSHSMGHY 400

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 44/94 (46%), Gaps = 16/94 (17%)

Query: 598 LPPILVIHLSRFYYDLTRKN---NTVITYPLILNVIL-----KNNKVVRYKLYGTVNHIG 649
           L P LV+ L RF +  + +N   N  + +PL L++       +    + Y+L G V+H G
Sbjct: 347 LAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRLSGVVSHSG 406

Query: 650 NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
            +  GHYT+ +         LN   W  F+D  I
Sbjct: 407 TVNEGHYTAVLQ--------LNSGEWFKFNDSMI 432

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
           (REAL)
          Length = 501

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 56/132 (42%), Gaps = 21/132 (15%)

Query: 590 VKSSDFIVLPPILVIHLSRFYYD-LTRKNN----------TVITYPLILNVILKNNKVVR 638
           +K    + LP ILV+HLSR  ++ +T   N           +  Y L  N  +  N+ V+
Sbjct: 331 IKKDVAVQLPDILVVHLSRSTFNGITYCRNPCNVEFGERVKLPEYTLAENRAITENRQVK 390

Query: 639 YKLYGTVNHIGNLVNGHYT-----SDVNKEKNHEIGLNRQVWITFDDDYIKQH-----HH 688
           Y L   V H G+   GHY      +D+  +K  E  L     I  ++   + H     H+
Sbjct: 391 YNLKSVVKHTGSHSRGHYICYRRKADIRFDKGEESSLEGASTIVNNEAKTRNHDQKIGHN 450

Query: 689 DDFEAGKTEVSS 700
           DD  +   +V S
Sbjct: 451 DDRRSRHKKVKS 462

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 54/128 (42%), Gaps = 18/128 (14%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNV--ILKNNKVVRYKLYGTVNHIGNL 651
           LP  L +HL RF Y   +  N      I YP  L V     +    RY+L   V H+G+ 
Sbjct: 512 LPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLSKRYELASAVIHLGDG 571

Query: 652 VN-GHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVLFYER 710
              GHY S     K    G     W+ FDD+ ++        +   E +S   YVLFY  
Sbjct: 572 PQYGHYISLC---KTETFG-----WLLFDDETVEAVDEQTVLSFTGE-NSDTAYVLFYNE 622

Query: 711 MDESEYKE 718
           +  SEY E
Sbjct: 623 V--SEYDE 628

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLT 333
           I G +N  NTCY NSI+QC F  ++FR   L+
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSMLS 157

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 51/114 (44%), Gaps = 24/114 (21%)

Query: 595 FIVLPPILVIHLSRFYYD-----LTRKNN------TVITYPLILNVILKNNKVVR-YKLY 642
           F   PP+L + L RF YD     L + N+      ++   P + +  L+ N   + YKL+
Sbjct: 384 FESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKIYKLH 443

Query: 643 GTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI-----KQHHHDDF 691
           G + H G++  GHY + +      E       W  FDDD +     KQ   D+F
Sbjct: 444 GVLVHTGDISTGHYYTLIKPSTKDE-------WYRFDDDRVWRATKKQIFDDNF 490

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar
           to uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
           ubiquitin-specific proteinase
          Length = 816

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 59/150 (39%), Gaps = 35/150 (23%)

Query: 590 VKSSDFI-VLPPILVIHLSRF-----------------YYDLTRKNNTVITYPLILNV-- 629
            K   FI  LP IL+I L RF                 Y     K    I+Y   L +  
Sbjct: 672 AKKQTFIDKLPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEIPD 731

Query: 630 ------ILKNNKVVRYKLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDY 682
                  L+NN    Y+L G + H G +   GHYT+DV  ++        + W   DD  
Sbjct: 732 ETLASSALRNNSSKTYELSGVIYHHGMSPDGGHYTADVFHKQT-------KTWYRIDDVN 784

Query: 683 IKQHHHDD-FEAGKTEVSSSEVYVLFYERM 711
           I +   DD  + G+  + S   Y+L Y+ +
Sbjct: 785 ITKLEDDDVLKGGEDNMDSRTAYILMYQNV 814

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 31/127 (24%)

Query: 598 LPPILVIHLSRFYYDLT---RKNNTVITYPLILNVI-----------LKNNKV--VRYKL 641
           LP +LV+ L RF + L    RK +  I +P  LN+              N KV  + Y+L
Sbjct: 354 LPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNGKVPDIIYEL 413

Query: 642 YGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSS 701
            G V+H G +  GHY +           ++   W  F+D  +           + EV   
Sbjct: 414 IGIVSHRGTVNEGHYIAFCK--------ISGGQWFKFNDSVVT-------SIAQGEVLKE 458

Query: 702 EVYVLFY 708
           + Y+LFY
Sbjct: 459 QAYLLFY 465

 Score = 31.6 bits (70), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 106/244 (43%), Gaps = 49/244 (20%)

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFK 360
            ++GL N  +TC+++SI+QCL     F    +++ +    +    P +   S ++  + +
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNKCKVGS-PDKC-FSCALDKIIQ 192

Query: 361 KMY--LNGGE----AIAPN---GF---LKMCKKLRPDLNIPDDQQDTQEFLLIILARLHE 408
           ++Y  LN  +    + A N   GF   L    K+  +L     QQD  EF   I+ ++H+
Sbjct: 193 ELYGVLNTDQPSPSSSATNRQTGFIYLLTCAWKINQNL-AGYSQQDAHEFWQFIINQIHQ 251

Query: 409 ELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQ 468
             ++ +     P+    D    +VN  + +              +  +F G +E+ + C 
Sbjct: 252 SYTHDS-----PNAKEID----RVNNKRCE------------CIVHSVFEGSLESSIVCP 290

Query: 469 RC-GNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPN 527
            C  NS  +   F  LSL I          K KK KL +C++ F   E+L  D ++ C  
Sbjct: 291 GCQKNSKTTIDPFMDLSLDI----------KDKK-KLYECLDSFHKKEQLK-DFNYHCGE 338

Query: 528 CGTT 531
           C +T
Sbjct: 339 CNST 342

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 298 SQLSITGLQNPCNTCYINSIIQCLFGTTLFRDL 330
           S+L  TG+ N  NTCY+NS++Q  F  TLFR+ 
Sbjct: 753 SELWPTGINNIGNTCYLNSLLQYYFSITLFREF 785

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
           UBP8Ubiquitin-specific protease that is a component of
           the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
           complex; required for SAGA-mediated deubiquitination of
           histone H2B
          Length = 471

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 54/127 (42%), Gaps = 31/127 (24%)

Query: 598 LPPILVIHLSRFYYDLT---RKNNTVITYPLILNVI-----------LKNNKV--VRYKL 641
           LP +LV+ L RF + L    RK +  I +P  LN+             +N KV  + Y+L
Sbjct: 354 LPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENGKVPDIIYEL 413

Query: 642 YGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSS 701
            G V+H G +  GHY +           ++   W  F+D  +           + EV   
Sbjct: 414 IGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVS-------SISQEEVLKE 458

Query: 702 EVYVLFY 708
           + Y+LFY
Sbjct: 459 QAYLLFY 465

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 108/244 (44%), Gaps = 49/244 (20%)

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKY--RLFLQTDKYPREVQLSRSIYVL 358
            ++GL N  +TC+++SI+QCL     F    +++ +     +++        L + ++ L
Sbjct: 135 GLSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHEL 194

Query: 359 FKKMYLNGGEAIAPN-------GFLKM--CK-KLRPDLNIPDDQQDTQEFLLIILARLHE 408
           +    LN  +A + +       GF+ +  C  K+  +L     QQD  EF   I+ ++H+
Sbjct: 195 YGA--LNTKQASSSSTSTNRQTGFIYLLTCAWKINQNL-AGYSQQDAHEFWQFIINQIHQ 251

Query: 409 ELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQ 468
                    Y  DL     NA +V+ +   K  E  V T        +F G +E+ + C 
Sbjct: 252 S--------YVLDL----PNAKEVSRAN-NKQCECIVHT--------VFEGSLESSIVCP 290

Query: 469 RCGNSSH-SYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPN 527
            C N+S  +   F  LSL I          K KK KL +C++ F   E+L  D ++ C  
Sbjct: 291 GCQNNSKTTIDPFLDLSLDI----------KDKK-KLYECLDSFHKKEQLK-DFNYHCGE 338

Query: 528 CGTT 531
           C +T
Sbjct: 339 CNST 342

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 63/143 (44%), Gaps = 38/143 (26%)

Query: 598  LPPILVIHLSRF-YYDLTRKNNTVITYPLILNVILK-------NNKVV------------ 637
            LP +L+IHL RF + + T K+N++  Y      I K       N+++V            
Sbjct: 886  LPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKISYNHELVIPAETITNGKQL 945

Query: 638  -----RYKLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQV--WITFDDDYIKQHHHD 689
                  Y+L G V H G +   GHYT+D+          +++V  W   DD  + +   D
Sbjct: 946  APENRTYELTGVVYHHGLSSDGGHYTADI---------YHKEVDKWYRIDDVTVTELEKD 996

Query: 690  D-FEAGKTEVSSSEVYVLFYERM 711
            D  + G+    S   Y+L Y+++
Sbjct: 997  DVLKGGENSTDSRTAYILMYQKL 1019

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
           to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
           Ubiquitin-specific protease that is a component of the
           SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
           complex required for SAGA- mediated deubiquitination of
           histone H2B
          Length = 453

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 52/129 (40%), Gaps = 25/129 (19%)

Query: 590 VKSSDFIVLPPILVIHLSRFYYDLTRKN---NTVITYPLILNVI-LKNNKVVR------Y 639
           +K      LPP+LV+ L RF + +   N   N  ITYP  LN+    ++   R      Y
Sbjct: 334 IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 640 KLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVS 699
           +L   ++  G++  GHYT                 W  F+D  I     +D       V 
Sbjct: 394 ELVAVISQEGSVNQGHYTCMCKVPGGQ--------WFRFNDTMIVSITEED-------VL 438

Query: 700 SSEVYVLFY 708
             + Y+LFY
Sbjct: 439 RQQAYLLFY 447

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 12/106 (11%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKMY 363
           G QN  NTCY+N+ +Q L+ T   R + L   Y+   Q+  Y  E ++   I +  K+ +
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMILD--YKPPAQSSTYNPEDEMHHKIVLEIKRCF 169

Query: 364 LN----GGEAIAPNGFLKMCKKLRPDLNIPD------DQQDTQEFL 399
            N      +++ P   L + +K  P     D       QQD +E  
Sbjct: 170 ENLEKKNFKSVMPMMLLTVLRKCYPQFAERDPRGGFYKQQDAEELF 215

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 82/230 (35%), Gaps = 55/230 (23%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKM 362
            G +N   TCY+NS++Q  F T  FR L            D  P  + L R+ Y L    
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYGIPTNGENPNDSVP--LALQRAFYQLQVSK 261

Query: 363 YLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDL 422
           +        P   L++ +    D      Q D QE   I++ RL   +    V       
Sbjct: 262 F--------PLDTLELTRSFGWDTADAFTQHDVQELNRILMDRLENRMKGTNV------- 306

Query: 423 VSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYV 482
                              EG         ++ IF G+M++ ++C+     S     F+ 
Sbjct: 307 -------------------EGK--------LNEIFVGKMKSYIRCKNVDYESSRVEDFWD 339

Query: 483 LSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTD 532
           + L +          KS +   E+ I +    E ++G+N +  P+ G  D
Sbjct: 340 IQLNVKNF-------KSLQESFENYIEV----ELMNGENQYAAPDFGLQD 378

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 40.0 bits (92), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 55/120 (45%), Gaps = 16/120 (13%)

Query: 598  LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVILKNNKVV--RYKLYGTVNHI-GN 650
            LP  L +HL RF Y   +  N      + YPL L+V    N  +  RY+L G V H+ G 
Sbjct: 959  LPKTLSLHLKRFKYSEEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNGIVVHMGGG 1018

Query: 651  LVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSS-SEVYVLFYE 709
              +GHY +     KN + G     W+  DD+ ++    +     K +    +  YVLFY+
Sbjct: 1019 PQHGHYVAIC---KNDKFG-----WLLMDDETVETISEETVLRCKGDSKDLTTAYVLFYK 1070

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           G +N  NTCY NS++QCL+  T  R   L
Sbjct: 517 GYENFGNTCYCNSVLQCLYNMTNLRTNIL 545

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 52/105 (49%), Gaps = 16/105 (15%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYD--LTRKNNTVITYPLILNVI--LKNNKVV---RYKL 641
            +K S  +  P  LV+HL +F ++   + K    ++YP+ L++    +++K V   +Y+L
Sbjct: 704 AIKRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITEYCESSKKVLPAKYQL 763

Query: 642 YGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ 685
              V H G +L +GHY +   +            W T+DD+ I +
Sbjct: 764 LSVVVHEGRSLSSGHYIAHCRQPDG--------TWATYDDELINK 800

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 44/235 (18%), Positives = 81/235 (34%), Gaps = 55/235 (23%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKM 362
            G +N   TCY+NS++Q  F T  FR L         + TDK       + S+ +  ++ 
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLVYQ------IPTDK----ESPNNSVPLALQRA 255

Query: 363 YLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDL 422
           +    ++  P   L++ +    D      Q D QE   I++ RL  ++            
Sbjct: 256 FFQLQKSNEPLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKG---------- 305

Query: 423 VSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYV 482
                                   TD    ++ +F G+M + +KC      S     F+ 
Sbjct: 306 ------------------------TDVDGKLNEVFVGKMRSYIKCVNVDYESSRVEDFWD 341

Query: 483 LSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
           + L +  +             L++    +   E + G+N +     G  D K  +
Sbjct: 342 IQLNVKNLR-----------GLQESFKNYIEVEMMDGENQYAAQGYGLQDAKKGV 385

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 39/101 (38%), Gaps = 19/101 (18%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYP--------LILNVILKNNKVVRYKLY 642
           F   PP+L + L RF YD       K N    +P        L   +   N     Y L+
Sbjct: 387 FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYIYDLH 446

Query: 643 GTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           G + H G++  GHY + +      +       W  FDDD +
Sbjct: 447 GVLVHTGDISTGHYYTMIKPSIEDQ-------WYRFDDDKV 480

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
           (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 62/126 (49%), Gaps = 22/126 (17%)

Query: 598 LPPILVIHLSRFYYDLTRKNNT------VITYPLILNVILKNNKVV--RYKLYGTVNHIG 649
           LP IL +HL RF Y  + +NN        ITYP  L+V    ++ +  +Y+L G + H+G
Sbjct: 549 LPKILSLHLKRFKY--SEENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLG 606

Query: 650 -NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDF--EAGKTEVSSSEVYVL 706
               +GHY +    EK    G     W+ +DD+ ++     D     G +   ++  Y+L
Sbjct: 607 AGPQHGHYVAMCKTEK---FG-----WLLYDDETVEAVLEKDVLRHVGDSNDLAT-AYIL 657

Query: 707 FYERMD 712
           FY+ ++
Sbjct: 658 FYKTIE 663

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 6/45 (13%)

Query: 285 NKLPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRD 329
           N+L  I+ ST +       G +N  NTCY NS++QCL+  +  RD
Sbjct: 115 NQLGRIDSSTKVF------GFENFGNTCYCNSVLQCLYNFSELRD 153

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 57/141 (40%), Gaps = 27/141 (19%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDK-----YPREVQLSRSIYVL 358
           GLQN  NTCY+N+ +Q LF     +DL L         +D      Y   ++L R+   L
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVLELKRTFETL 169

Query: 359 FKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPD------DQQDTQEFLLIILARLHEELSN 412
            K+ +    +++ P   L   +K  P     D       QQD +E    +          
Sbjct: 170 KKRSF----KSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFH-------- 217

Query: 413 GTVTEYYPDLVSYDANAFQVN 433
            T+T  + D     AN FQ+N
Sbjct: 218 -TLTVVFGDKF---ANQFQIN 234

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 39.7 bits (91), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 48/107 (44%), Gaps = 18/107 (16%)

Query: 589 TVKSSDFIVLPPILVIHLSRFYYDLT--RKNNTVITYPLILNVIL-------KNNKVVRY 639
             K S  +  P  L++HL +F ++ T   K    ++YP+ L++              V+Y
Sbjct: 632 ATKRSSILRAPETLLVHLKKFRFNGTTSSKMKQAVSYPMYLDMTEYCETPSGTKQLPVKY 691

Query: 640 KLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ 685
           +L   V H G +L +GHY +   +            W T+DD+YI +
Sbjct: 692 ELLSVVVHEGRSLSSGHYIAHCRQPDGS--------WATYDDEYINK 730

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|Q02863 Saccharomyces cerevisiae
           YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 39.3 bits (90), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 80/218 (36%), Gaps = 33/218 (15%)

Query: 457 FRGQMENILKCQRCGNSSHSYST-FYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDE 515
           FRG++ + L C  C NSS    T F +L LA+P+    + T+K         +    SD 
Sbjct: 335 FRGKVADHLVCTACRNSSKVRVTQFNMLPLAVPQ----AITAK---------LAEMVSDN 381

Query: 516 ELSGDNSWDCPNCGTTDLKTKINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 575
           ++     + C  C     K   NE                                    
Sbjct: 382 QVESIEGYSCLTCKVG--KILENEKGRDTSSYETTEQNTLASLARAFPNLTINDDVSEEL 439

Query: 576 XXXXKKWNSRKLTT-------VKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLI 626
                 +N   L T       VK +  +  P +L+IHLSR  ++ T   +N   + +  I
Sbjct: 440 MNYINGYNRDGLVTSQLKSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEI 499

Query: 627 LNV---ILKNNKV-----VRYKLYGTVNHIGNLVNGHY 656
           L +   +++N++      V Y+L   V H G+   GHY
Sbjct: 500 LQLQEQVIQNDRCVGINSVNYELKAIVKHAGSHSQGHY 537

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 14/116 (12%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDL--FLTKKYRLFLQTDKYPREVQLSRSIYVLF 359
           + GL N  NTC++NS++Q L  +   R+L  FL     +  +++    E+  S +   L 
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASS---RELAHFLDD---IIEESEPNKNELNFSVAFKTLL 118

Query: 360 KKM---YLNGGEAIAPNGFLKMCKKLRPDLNI--PDDQQDTQEFLLIILARLHEEL 410
            K+   Y    +   PN  LK  +   P+ NI    DQ+D QEF   I+++L ++L
Sbjct: 119 DKLNAKYGRNRKYYRPNALLKTMES-GPNKNILLGYDQEDAQEFFQQIISQLEKDL 173

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 39.3 bits (90), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 92/229 (40%), Gaps = 44/229 (19%)

Query: 304 GLQNPCNTCYINSIIQCLF--GTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVL--F 359
           GL N  N+CY+NS++QCL   G   + D         F +   YP      + I +L  F
Sbjct: 343 GLINLGNSCYLNSVMQCLLNGGVPNWSDKLGNIIGHDFPKDVIYPTGNLRCQMIKLLNAF 402

Query: 360 KKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYY 419
           K    +  E I P  F +   K   +    ++QQD+ EFL  +     EEL  G     +
Sbjct: 403 KLNPEDYEEGIRPRSFKECVGKHNAEFKT-NNQQDSMEFLTFVT----EELEKG----LF 453

Query: 420 PDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYST 479
           P +   DA+   +NP+   K+                    ME+ L+C  C N  ++Y  
Sbjct: 454 PKI--QDAS---INPNNLLKFI-------------------MEDKLQCVECKNVKYTYQP 489

Query: 480 FYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNC 528
              + L + + +    T+    ++L   I  +   EE+     + CP C
Sbjct: 490 NECIQLPLKEGNDLVGTTTQNLMEL---ITDYFQGEEI----EFSCPTC 531

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 39.3 bits (90), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 46/103 (44%), Gaps = 19/103 (18%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYPLILNVILKNNKVVR--------YKLY 642
           F   PP+L + L RF YD       K N    +P  +++    +  VR        Y L+
Sbjct: 380 FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMMYNLH 439

Query: 643 GTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQ 685
           G + H G++  GHY + +        GL+ + W  FDDD + Q
Sbjct: 440 GVLVHTGDISTGHYYAMIKP------GLDDK-WYRFDDDKVWQ 475

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 46/238 (19%), Positives = 82/238 (34%), Gaps = 57/238 (23%)

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTD-KYPREVQLSRSIYVLF 359
              GL+N   TCY+NS++Q  + T  FR L         + TD + P     S S+ +  
Sbjct: 197 GFVGLKNQGATCYLNSLLQSYYFTKYFRKLV------YHIPTDGETP-----SNSVPLAL 245

Query: 360 KKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYY 419
           ++ +     +  P    ++ +    D      Q D QE   I++ RL  ++    V    
Sbjct: 246 QRAFYKLQRSSEPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKATEV---- 301

Query: 420 PDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYST 479
                                 EG         ++ IF G+M++ +KC      S     
Sbjct: 302 ----------------------EGK--------LNEIFVGKMKSYIKCVNVEYESSRVED 331

Query: 480 FYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
           F+ + L +  ++            L      +   E + G+N +     G  D K  +
Sbjct: 332 FWDIQLNVKGLN-----------GLNQAFENYIEVEMMDGENQYAAQRYGLQDAKKGV 378

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 38.9 bits (89), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 53/263 (20%), Positives = 93/263 (35%), Gaps = 69/263 (26%)

Query: 289 TIEDSTSLL----------SQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRL 338
           +IED T +L                G +N   TCY+NS++Q    T LFR L     Y++
Sbjct: 173 SIEDPTGVLWHNFLNYDSKKMTGFVGFKNQGATCYLNSLLQSYHFTKLFRKLV----YQI 228

Query: 339 FLQTDKYPREVQLS--RSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQ 396
             + +     V L+  R+ Y+L          +  P    ++ K    D      Q D Q
Sbjct: 229 PTEDENPTNSVALALQRAFYLL--------QTSKEPLDTTELTKSFGWDTGDAFTQHDVQ 280

Query: 397 EFLLIILARLHEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYI 456
           E   I++ RL   +   +V                          EG         I+ +
Sbjct: 281 ELNRILMDRLEHRMKGTSV--------------------------EGK--------INEL 306

Query: 457 FRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEE 516
           F G+M++ +KC      S     F+ + L +  +             L++    +   E 
Sbjct: 307 FVGKMKSCIKCINVDYESSRVEDFWDIQLNVKDMK-----------NLQESFEQYIEVEL 355

Query: 517 LSGDNSWDCPNCGTTDLKTKINE 539
           ++G+N +   + G  D +  + E
Sbjct: 356 MNGENQYAAQDHGLQDAQKVVFE 378

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 51/124 (41%), Gaps = 24/124 (19%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYP------LILNVILKNNKVVRYKLYGT 644
           F   PP+L + L RF YD       K N    +P        L+     +    Y L+G 
Sbjct: 377 FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTPADYILHGV 436

Query: 645 VNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI-----KQHHHDDFEAGKTEVS 699
           + H G++  GHY + +  + +         W  FDDD +     KQ   ++F  GK ++ 
Sbjct: 437 LVHSGDISTGHYYAMIQPDAHGS-------WYRFDDDRVIKATDKQVFEENF--GKAKLP 487

Query: 700 SSEV 703
             E+
Sbjct: 488 DDEI 491

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (65%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           GLQN  NTCY+N+ +Q LF     RDL L
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLIL 136

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 38.5 bits (88), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 76/193 (39%), Gaps = 48/193 (24%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPRE------VQLSRSIY 356
            GL N  N+CY+NS++QCLF   + +   L    + F Q   YP        ++L+ ++ 
Sbjct: 323 CGLINLGNSCYLNSVLQCLFNGGV-KGWSLKGLGQDFPQDVLYPTNNFKCQLIKLNNAMK 381

Query: 357 VLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVT 416
           V  +    N  E I P  F K   +   + +    QQD+ EFL  ++  L ++       
Sbjct: 382 VEPQ----NYPEGIRPKSFKKCVGQSHEEFS-SGRQQDSMEFLGYLVDVLDKK------- 429

Query: 417 EYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHS 476
                                       +  +G +P D + +  ME+ L+C  CG   +S
Sbjct: 430 ----------------------------IFKNGSNPND-LMKFTMEDRLQCTNCGKVKYS 460

Query: 477 YSTFYVLSLAIPK 489
                 L L +P+
Sbjct: 461 SEAAESLQLPMPE 473

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin-specific
           protease
          Length = 782

 Score = 38.5 bits (88), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 10/81 (12%)

Query: 586 KLTTVKSSDFIVLPPILVIHLSRFYYDLT--RKNNTVITY--PLILN-VILKNNKVV--- 637
           K T VK +  +  P +L++HLSR  +D    +KN   +++   L++N  +++NNK V   
Sbjct: 435 KSTIVKKTVVVDSPDVLILHLSRSVFDGMGYQKNTCNVSFEEELVVNRQVIENNKCVGIR 494

Query: 638 --RYKLYGTVNHIGNLVNGHY 656
              YKL   + H G+   GHY
Sbjct: 495 KDSYKLRSMLRHQGSHSTGHY 515

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 38.5 bits (88), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 90/237 (37%), Gaps = 61/237 (25%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPRE---VQLSRSIYVLFK 360
           G +N   TCY+NS++Q  F T LFR +     Y++    ++ P +   + L RS Y+L K
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFRKMV----YKI-PSDNESPNDSVSLALQRSFYLLEK 257

Query: 361 KMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYP 420
                   +  P   L++ +    D      Q D QE   I++ RL   +    V     
Sbjct: 258 --------SKEPLDTLELTRSFGWDTGEAFTQHDVQELNRILMDRLETRMKGTEV----- 304

Query: 421 DLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTF 480
                                EG+        ++ +F G+M++ ++C      S     F
Sbjct: 305 ---------------------EGT--------LNDLFVGKMKSYIRCVNVDYESFRVEDF 335

Query: 481 YVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
           + + L +  +       K  K   E+ + +    E + G+N +   + G  D K  +
Sbjct: 336 WDIQLNVKNL-------KDVKESFENYVEV----EMMDGENQYAAQDYGLQDAKKGV 381

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 19/101 (18%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYPLILNVI------LKNN--KVVRYKLY 642
           F   PP+L + L RF YD       K N    +P  +++       +K+N      Y L+
Sbjct: 383 FESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCIYNLH 442

Query: 643 GTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
             + H G++  GHY + +      +       W  FDDD +
Sbjct: 443 CVLVHSGDISAGHYYAMIKPNVTDQ-------WFRFDDDKV 476

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
           YPL072W
          Length = 734

 Score = 38.1 bits (87), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 586 KLTTVKSSDFIVLPPILVIHLSRFYYDLT--RKNNTVITYPLILNV---ILKNNKVV--- 637
           K T VK +  +  P  LV+HLSR  +D    ++N+  + +  IL     ++++NK V   
Sbjct: 420 KSTIVKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEILESREQVIRHNKCVGIN 479

Query: 638 --RYKLYGTVNHIGNLVNGHY 656
              YKL   V H G+   GHY
Sbjct: 480 PISYKLKAIVAHSGSHSQGHY 500

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 50/116 (43%), Gaps = 9/116 (7%)

Query: 297 LSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIY 356
           LSQL + GL+N  NTCY+NS +Q L+     R+  L   ++   +     + +QL   + 
Sbjct: 101 LSQLPV-GLKNLGNTCYMNSTLQALYQIRPLREEILN--FQPPKENRSGEQHIQLVAELK 157

Query: 357 VLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDD------QQDTQEFLLIILARL 406
             F+++     E+  P   L   +K  P     D       QQD +E    I   L
Sbjct: 158 RCFQQLRDRPQESTTPILLLATLRKCYPQFAERDQESGFYKQQDAEELFTQIFHSL 213

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER151C
           (UBP3)
          Length = 789

 Score = 38.1 bits (87), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 56/143 (39%), Gaps = 37/143 (25%)

Query: 598 LPPILVIHLSRF-YYDLTRKNNTVITYPLILNVILKNNKVVRY----------------- 639
           LP +L+I L RF + + + +   +I Y      I K  K +RY                 
Sbjct: 654 LPRVLLIQLKRFEFVNNSSERRELINYNAYNGRIEKIRKWIRYDQELTIPKEALSSVNAK 713

Query: 640 ----------KLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHH 688
                     +L G V H G +   GHYT+DV       +   +  W   DD+ + +   
Sbjct: 714 FYLSGKDTTYRLTGVVYHHGLSPSGGHYTADV-------LHQTQDKWYRIDDNNVTEIRQ 766

Query: 689 DD-FEAGKTEVSSSEVYVLFYER 710
           +D F+ G     S   Y+L Y+R
Sbjct: 767 EDVFKRGDEASDSKTAYILIYQR 789

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 38.1 bits (87), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 59/133 (44%), Gaps = 30/133 (22%)

Query: 304 GLQNPCNTCYINSIIQCLF--------------------GTTLFRDLFLTKKYRLFLQTD 343
           G+ N  N C+++SI+Q L                     G+T F  L L     L+ + D
Sbjct: 348 GIVNTGNICFMSSILQVLLFCEPFVNLMNLISVKTSAKMGSTGF--LLLDACLELYRKFD 405

Query: 344 K--YPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRP--DLNIPDDQQDTQEFL 399
           K  + RE + SRS   +     L   +AI P+ F K   KL    DL     Q+D +EFL
Sbjct: 406 KQAFERE-KASRSSSGVNISSAL--ADAIKPDDFYKTLSKLPKFKDLRW-GHQEDAEEFL 461

Query: 400 LIILARLHEELSN 412
             +L +LHEE  N
Sbjct: 462 THLLDQLHEEFVN 474

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 754

 Score = 38.1 bits (87), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 57/125 (45%), Gaps = 14/125 (11%)

Query: 598 LPPILVIHLSRFYYDLTRKNN----TVITYPLILNVI--LKNNKVVRYKLYGTVNHIGNL 651
           LP IL +HL RF Y  T+  N      I YPL L V     ++   RY+L G V  +   
Sbjct: 558 LPHILALHLKRFKYSETQNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGIV--VHMG 615

Query: 652 VNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSS-SEVYVLFYER 710
              H+   V+  KN + G     W+ FDD+ ++            ++   +  YVLFY+ 
Sbjct: 616 GGPHHGHYVSLCKNEKFG-----WLLFDDETVESVDESSVMKFCGDLHDLTTAYVLFYKE 670

Query: 711 MDESE 715
           ++ S+
Sbjct: 671 INGSD 675

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFR 328
           + G +N  NTCY NS++QCL+  T FR
Sbjct: 145 VFGYENFGNTCYCNSVLQCLYNLTEFR 171

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKK 335
           GL+N  NTCY+N+ +QCLF     R++ L  K
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYK 141

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 89/237 (37%), Gaps = 59/237 (24%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLS--RSIYVLFK 360
            G +N   TCY+NS++Q  F T  FR L     Y++  + D     V L+  R+ Y L  
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLV----YQIPTENDSPNNSVPLALQRAFYQL-- 246

Query: 361 KMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYP 420
                   +  P   L++ +    D      Q D QE   I++ RL  ++          
Sbjct: 247 ------QVSDEPLDTLELTRSFGWDSGDAFTQHDVQELNRILMDRLENKM---------- 290

Query: 421 DLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTF 480
                                +G+ + D L+    IF G+M++ +KC      S     F
Sbjct: 291 ---------------------KGTPVEDKLNE---IFVGRMKSYIKCINVDYESSRVEEF 326

Query: 481 YVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
           + L + +  +       K  K   E+ I +    E ++G+N +   + G  D +  +
Sbjct: 327 WDLQMNVKNL-------KDLKSSFENYIEI----ELMNGENQYAAQDYGLQDAEKGV 372

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 43/102 (42%), Gaps = 20/102 (19%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYPLILNVILKNNKV---------VRYKL 641
           F   PP+L + L RF YD       K N    +P  ++V    +K+           YKL
Sbjct: 374 FESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPCIYKL 433

Query: 642 YGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           +G + H G++  GHY + +      +       W  FDD+ +
Sbjct: 434 HGVLVHAGDISTGHYYAMIKPSTEDQ-------WYRFDDEKV 468

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 10/83 (12%)

Query: 584 SRKLTTVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYP--LILNVI-LKNNKV-- 636
           S K   +K +  +  P +L++HLSR  +D     KN+  + +P  LILN   +K ++   
Sbjct: 389 SLKSRILKRTVVVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPEDLILNEQEIKEDRCIA 448

Query: 637 ---VRYKLYGTVNHIGNLVNGHY 656
              VRYKL   + H G    GHY
Sbjct: 449 VHCVRYKLQAMIKHTGTHFQGHY 471

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 97/247 (39%), Gaps = 43/247 (17%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLF--LTKKYRLFLQTDK--YPREVQL------- 351
           TGL N  N C+ NS IQ L       +    +T+  R   Q      PR+          
Sbjct: 84  TGLTNSRNDCFANSSIQALASLPALAEYLNGVTEVVRSTRQALGLLVPRDDAADFSDHGG 143

Query: 352 --SRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEE 409
             S+     F           A NG       + PDL +PD +    E L I++  L + 
Sbjct: 144 MPSKKSASPFTDPAAVSANCAAANGKEPEGNHVTPDLLLPDLRM--HEALSIMIHNLQQP 201

Query: 410 LSNGTVTEYYPDLVSY-------------DANAF-QVNPSKYQK-------WYEGSVLTD 448
           + N T T   P L +              DA+ F Q+     +K       + E   L+D
Sbjct: 202 VKNYTQTSLQPLLHTLEQIHNAKISSGQNDAHEFSQILFETLEKERLALKTFLEKQQLSD 261

Query: 449 GLSPIDYIFRGQMENILKCQRCGNSSH-SYSTFYVLSLAIPKISLYS-----FTSKSKKI 502
              P ++ F+G +   L C RC NSS  +   F + SL +P++S  S     F ++++ I
Sbjct: 262 IRIP-EFPFQGSLATNLICLRCNNSSKVNVHRFTMHSLPVPQMSSASLKDMMFDNQTETI 320

Query: 503 KLEDCIN 509
           +   CI+
Sbjct: 321 EGYSCIS 327

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 18/100 (18%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYP--LILNVILKNNKVVR-----YKLYG 643
           F   PP+L + L RF YD       K N    +P  + L+  L+++K  +     Y L+G
Sbjct: 384 FESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVYNLHG 443

Query: 644 TVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
            + H G++  GHY + +        GL  Q W  FDD+ +
Sbjct: 444 VLVHAGDISTGHYYTLIKP------GLEDQ-WYRFDDERV 476

 Score = 36.6 bits (83), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 49/237 (20%), Positives = 87/237 (36%), Gaps = 59/237 (24%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLS--RSIYVLFK 360
            G +N   TCY+NS++Q  F T  FR L     Y++  + +     V L+  RS Y L  
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLV----YQIPTENESPNNSVPLALQRSFYQLQV 258

Query: 361 KMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYP 420
             +        P   L++ +    D      Q D QE   I++ RL   +   +V     
Sbjct: 259 SKF--------PLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTSV----- 305

Query: 421 DLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTF 480
                                      +G+  ++ IF G+M++ +KC      S     F
Sbjct: 306 ---------------------------EGM--LNEIFVGKMKSYIKCIDVDYESSRVEDF 336

Query: 481 YVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
           + L L +  +             L++  + +   E L+G+N +   + G  D +  +
Sbjct: 337 WDLQLNVKNMK-----------GLKESFDNYIEIELLNGENQYQAQDYGLQDAEKGV 382

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 48/237 (20%), Positives = 90/237 (37%), Gaps = 61/237 (25%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPRE---VQLSRSIYVLFK 360
           GL+N   TCY+NS++Q  F T LFR +     Y++  + +  P +   + L RS Y+L K
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKIV----YKIPSENES-PNDSVLLALQRSFYLLQK 257

Query: 361 KMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYP 420
                  E +     L++ +    D      Q D QE   I++ RL   +    V     
Sbjct: 258 -----SNETLDT---LELTRSFGWDTGDAFTQHDVQELNRILMDRLETRMKGTEV----- 304

Query: 421 DLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTF 480
                                EG+        ++ +F G+M++ ++C      S     F
Sbjct: 305 ---------------------EGA--------LNELFVGKMKSYIRCINVDYESSRVEDF 335

Query: 481 YVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
           + + L +  +             +++  + +   E + G+N +   + G  D K  +
Sbjct: 336 WDIQLNVKNLK-----------GVQESFDNYVEVEIMDGENQYAAQDYGLQDAKKGV 381

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 41/101 (40%), Gaps = 19/101 (18%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYPLILN--------VILKNNKVVRYKLY 642
           F   P +L + L RF YD       K N    +P  ++        V+ KN     Y L+
Sbjct: 383 FESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCVYNLH 442

Query: 643 GTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           G + H G +  GHY + +  +   +       W  FDDD +
Sbjct: 443 GVLVHSGEISVGHYYAMIKPDVGDQ-------WFRFDDDKV 476

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 47/230 (20%), Positives = 85/230 (36%), Gaps = 55/230 (23%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKM 362
            G +N   TCY+NS++Q  F T  FR L         + TD    E + + S+ +  ++ 
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYE------IPTD----EEKPNDSVPLALQRA 258

Query: 363 YLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDL 422
           +     +  P   L++ +    D      Q D QE   I++ RL   +  GT  E     
Sbjct: 259 FYQLQVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMDRLETRMK-GTKVE----- 312

Query: 423 VSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYV 482
                                         +  +F G+M++ +KC+     S     F+ 
Sbjct: 313 ----------------------------GKLSELFVGKMKSYIKCKNVDYESSRVEEFWD 344

Query: 483 LSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTD 532
           + L +  +       K+ +   E+ I +    E + G+N +  P+ G  D
Sbjct: 345 IQLNVKDL-------KNLQQSFENYIEV----ELMDGENQYAAPDFGLQD 383

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 45/103 (43%), Gaps = 21/103 (20%)

Query: 595 FIVLPPILVIHLSRFYYD-----LTRKNN------TVITYPLILNVILKNNKVVR---YK 640
           F   P +L + L RF YD     L + N+      ++   P +   +LKN        YK
Sbjct: 390 FESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETESHIYK 449

Query: 641 LYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           L+G + H G++  GHY + +  +   +       W  FDD+ +
Sbjct: 450 LHGVLVHTGDISTGHYYTMIKPDLGDQ-------WYRFDDERV 485

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 87/236 (36%), Gaps = 57/236 (24%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQL-SRSIYVLFKK 361
            GL+N   TCY+NS++Q  + T  FR L     Y++       P E +  + S+ +  ++
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLV----YQI-------PTEGETPANSVSLALQR 238

Query: 362 MYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPD 421
            +     +  P    ++ +    D      Q D QE   I++ RL  ++    V      
Sbjct: 239 AFFQLQRSSEPLDTCELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKGTEV------ 292

Query: 422 LVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFY 481
                               EG +  +GL      F G+M++ +KC      S     F+
Sbjct: 293 --------------------EGKL--NGL------FVGKMKSYIKCVNVDYESSRVEDFW 324

Query: 482 VLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
            + L +  +       K  +   E+ I +    E + G+N +     G  D K  +
Sbjct: 325 DIQLNVKGL-------KGLQQSFENYIEV----EMMDGENQYAAQGHGLQDAKKGV 369

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 45/101 (44%), Gaps = 19/101 (18%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYPLILNV-------ILKNNKV-VRYKLY 642
           F   PP+L + L RF YD       K N    +P  +++       + +++    +Y L+
Sbjct: 371 FESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAKYNLH 430

Query: 643 GTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           G + H G++  GHY + +        GL    W  FDDD +
Sbjct: 431 GVLVHTGDISTGHYYAMIKP------GL-EDAWYRFDDDKV 464

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 12/81 (14%)

Query: 451 SPIDYI---FRGQMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDC 507
           SP ++I   F+G M N +KC  C N + +   F+    AIP        S+ +++ ++D 
Sbjct: 459 SPENFIHTLFQGTMNNSIKCLTCDNITSNEEPFF--DFAIP-------VSEDEELNVQDI 509

Query: 508 INLFTSDEELSGDNSWDCPNC 528
           +  F   E L+G N + C +C
Sbjct: 510 LRDFHQREMLNGANKFYCDSC 530

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (80%)

Query: 302 ITGLQNPCNTCYINSIIQCLF 322
           + GL+N  NTCY NS++QCL+
Sbjct: 98  VFGLENYGNTCYCNSVLQCLY 118

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 55/142 (38%), Gaps = 35/142 (24%)

Query: 598 LPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVR------------------- 638
           LP + +I L RF +      + V+ Y      + K  K +R                   
Sbjct: 310 LPEVFLIQLKRFSFINNTDKSKVVNYNAYSGRVEKIRKKIRFGSELTIPSSAISSVHANF 369

Query: 639 -------YKLYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDD 690
                  YKL G V H G +   GHYT DV +E        ++ W   DD  +++   ++
Sbjct: 370 YKESGSTYKLIGVVYHHGVSSSGGHYTCDVYQEA-------QKKWFRIDDINVQEIEMEE 422

Query: 691 -FEAGKTEVSSSEVYVLFYERM 711
             + G+    S   Y+L Y+++
Sbjct: 423 VLQPGEEGSDSRTAYILIYQKL 444

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 53/129 (41%), Gaps = 25/129 (19%)

Query: 304 GLQNPCNTCYINSIIQCLF--------------------GTTLFRDLFLTKKYRLFLQTD 343
           G+ N  N C+++SI+Q L                     G T F  L L     L+ + D
Sbjct: 10  GIVNSGNICFMSSILQVLLFCEPFVSLMNLISIKTSAKMGNTGF--LLLDACLELYRKFD 67

Query: 344 KYPREVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRP--DLNIPDDQQDTQEFLLI 401
           K   E + +  I      +     +AI P+ F K   KL    DL     Q+D +EFL  
Sbjct: 68  KVTFEREKAARINAGNSGISSALADAIKPDDFYKTLSKLPKFKDLRW-GHQEDAEEFLTH 126

Query: 402 ILARLHEEL 410
           +L +LHEE 
Sbjct: 127 LLDQLHEEF 135

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
           UBP16Deubiquitinating enzyme anchored to the outer
           mitochondrial membrane, probably not important for
           general mitochondrial functioning, but may perform a
           more specialized function at mitochondria
          Length = 499

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 39/82 (47%), Gaps = 11/82 (13%)

Query: 586 KLTTVKSSDFIVLPPILVIHLSRFYYD-LTRKNN----------TVITYPLILNVILKNN 634
           K   +K    + LP IL++HLSR  ++ +T   N          T+  Y L  +  +  N
Sbjct: 327 KGKVIKKDVVVQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAESGTITEN 386

Query: 635 KVVRYKLYGTVNHIGNLVNGHY 656
           + V+Y L   V H G+  +GHY
Sbjct: 387 RQVKYNLKSVVKHTGSHSSGHY 408

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 50/227 (22%), Positives = 79/227 (34%), Gaps = 59/227 (25%)

Query: 292 DSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFL----------- 340
           DS   + + +  GL N  N C+I S +Q L G   F +    K+ R  L           
Sbjct: 42  DSKQSIGKYTTVGLINRGNDCFITSSLQGLAGIPRFVEYL--KRIRTVLLELETKLSNNA 99

Query: 341 --------QTDKYPREVQLSRSIYVLFKKM---------YLNGGEAIAPNGFLKMCKKLR 383
                    T ++ R    S S+  L + +           +   +I+P   +   + + 
Sbjct: 100 KGDNPTVDNTTRHSRLENSSNSLAPLHESLTSLILDLISVKDRKTSISPKIVINTLESIF 159

Query: 384 PDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEG 443
               I   Q D  EF LI+L  L EE S          L+ Y      +N  K+      
Sbjct: 160 KS-KISSKQNDAHEFTLILLQTLQEERS---------KLIDYSKQICNLNIPKFP----- 204

Query: 444 SVLTDGLSPIDYIFRGQMENILKCQRC-GNSSHSYSTFYVLSLAIPK 489
                        F G+    L C +C G S  SY   ++  L++P+
Sbjct: 205 -------------FEGETSKFLVCLKCKGLSEPSYKQTFIRELSVPQ 238

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 48/241 (19%), Positives = 84/241 (34%), Gaps = 67/241 (27%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQ---TDKYPRE---VQLSRSIY 356
            G +N   TCY+NS++Q  F T  FR        RL  Q   + + P++   + L R+ Y
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFR--------RLVYQIPTSQENPKDSVVLALQRAFY 254

Query: 357 VLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVT 416
            L    Y        P   +++ +    D      Q D QE   I++ RL   +   TV 
Sbjct: 255 QLQVSQY--------PLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRMKGTTVE 306

Query: 417 EYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHS 476
                                             + ++ IF G+M++ +KC      S  
Sbjct: 307 ----------------------------------NKLNEIFVGKMKSFIKCINVDYESAR 332

Query: 477 YSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTK 536
              F+ + + +  +             L+D    +   E + G+N +   + G  D K  
Sbjct: 333 TEDFWDIQMNVKNLK-----------GLKDSFENYIEVELMDGENQYAAQDYGLQDAKKG 381

Query: 537 I 537
           +
Sbjct: 382 V 382

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 19/101 (18%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYPLILNV-------ILKNNKVVR-YKLY 642
           F   P +L + L RF YD       K N    +P  +++       +L+ N   R Y L+
Sbjct: 384 FESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRWYGLH 443

Query: 643 GTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           G + H G++  GHY + +        GL  Q W  FDD+ +
Sbjct: 444 GVLVHTGDISTGHYYALIKP------GLEDQ-WYRFDDERV 477

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 50/122 (40%), Gaps = 26/122 (21%)

Query: 598 LPPILVIHLSRFYYDL---TRKNNTVITYPLILNV---ILKNNKVVR-----YKLYGTVN 646
           LP +LV+ L RF + L   + K N  I YP  LN+       +  V      Y+L G V 
Sbjct: 351 LPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDVDVPDLIYELIGVVA 410

Query: 647 HIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEVSSSEVYVL 706
           H G +  GHY +             RQ W  F+D  +           + E  + + Y+L
Sbjct: 411 HKGTVNEGHYVATTKVA-------GRQ-WFKFNDSMVS-------SVTQEEALNEQAYLL 455

Query: 707 FY 708
           FY
Sbjct: 456 FY 457

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 101/256 (39%), Gaps = 54/256 (21%)

Query: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKY--RLFLQTDK 344
           +P++E    L       GL N  +TC+++SI+Q L     F +  +++ +  +  +Q  K
Sbjct: 127 VPSVERRDGL------HGLLNLGSTCFMSSILQILIRNPYFFNFSISQSHSKKCPIQDPK 180

Query: 345 YPREVQLSRSIYVLFKKMYLNGGEAIAPN-------GFLKMCKKLRPDLNIPDDQQDTQE 397
                 L + +   +     + G+ + P        G L    K+  +L     QQD  E
Sbjct: 181 SCISCALEKMVCEFYGSSAYSTGD-VEPQAMYSGFIGLLVCSWKINENL-AGYSQQDAHE 238

Query: 398 FLLIILARLHEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDY-I 456
           F   +L +LH +                    FQV   K       ++  D  + I +  
Sbjct: 239 FWQFLLNQLHHD--------------------FQVCSGK---GVNDAISDDLCTCIAHST 275

Query: 457 FRGQMENILKCQRCGNSSHS-YSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDE 515
           F+G +++ + C  C N S +    F  LSL I             K  L +C++ F   E
Sbjct: 276 FQGLLKSSIVCPDCQNDSKTTIDPFMDLSLDI-----------KDKSNLYNCLDSFHKKE 324

Query: 516 ELSGDNSWDCPNCGTT 531
            L  D ++ CPNC T+
Sbjct: 325 RLH-DFNYHCPNCNTS 339

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
           YPL072W
          Length = 471

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 57/143 (39%), Gaps = 30/143 (20%)

Query: 599 PPILVIHLSRFYYDLTR--KNNTVITYPLILNVI---LKNNKVVR--YKLYGTVNHIGNL 651
           P IL +HLSR  ++     +N   + YP  L V+   ++N    R  Y+L   + H G  
Sbjct: 328 PSILSLHLSRSMFNGASFTRNPCRVEYPETLIVLQRDVENGTAERITYRLRSMIKHTGTH 387

Query: 652 VNGHYTS-----DVNKEKNHEIGLNRQVWITFDDDYIKQHHHD----------------- 689
            +GHY       D+ K     + +NR   +      I++                     
Sbjct: 388 YSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKSVRRWPYWFISDAVV 447

Query: 690 -DFEAGKTEVSSSEVYVLFYERM 711
            +  AGK    S  VY+LFYER+
Sbjct: 448 RESNAGKMLRESKYVYMLFYERV 470

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar
           to gnl|GLV|KLLA0E23463g Kluyveromyces lactis
           KLLA0E23463g and some similarites with YPL072W
           uniprot|Q02863 Saccharomyces cerevisiae YPL072W UBP16
           Putative ubiquitin-specific protease
          Length = 767

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 586 KLTTVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNV---ILKNNKV---- 636
           K T VK +  +  P +L+IHLSR  ++     +N+  + +   L +   I++ NK     
Sbjct: 440 KSTIVKKTVVVDSPELLIIHLSRSVFNGMNYTRNSCNVAFEEDLGLQEQIIEKNKCVGVN 499

Query: 637 -VRYKLYGTVNHIGNLVNGHY 656
            V+Y+L  TV H G    GHY
Sbjct: 500 NVKYRLRATVRHQGTHSAGHY 520

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 69/190 (36%), Gaps = 42/190 (22%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTL--FRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFK 360
            GL N  N+CY+NSI+Q LF   +  + D+ +    + F     YP    +   +  L  
Sbjct: 319 CGLINLGNSCYLNSILQALFAQDVSQWADVLMDTIGKDFPVDVVYPSN-NVKCQLIKLLN 377

Query: 361 KMYLNGG---EAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTE 417
            M +N     E I P  F K C          + QQD  EFL   +  L ++L    +T 
Sbjct: 378 AMKINPSRYPEGIKPRSF-KNCIGQNNKEFTSNKQQDALEFLSYFVNELDKKLFKKELT- 435

Query: 418 YYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSY 477
                          NP    + Y                   ME+ L+C RC +  +SY
Sbjct: 436 ---------------NPGDLMRCY-------------------MEDRLQCLRCKHVKYSY 461

Query: 478 STFYVLSLAI 487
                + L +
Sbjct: 462 QANESIQLPL 471

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 58/137 (42%), Gaps = 12/137 (8%)

Query: 292 DSTSLLSQLSIT--GLQNPCNTCYINSIIQCLFGTTLFRDLFLT--KKYRLFLQTDKYPR 347
           D +  + +LS T  GL+N  NTCY+N+ +Q L+  T  R+  L   KK   F   D+   
Sbjct: 91  DPSVQMQKLSSTPIGLKNMGNTCYMNATLQALYQITPLREAILNFDKKSGNFPADDE--S 148

Query: 348 EVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDD------QQDTQEFLLI 401
              L + +   F+++     E++ P   L + ++  P     D       QQD +E    
Sbjct: 149 HFLLVQELKRCFQQLKDKPQESVTPILLLSVLRRCYPQFAERDSQSGFYKQQDAEELFTQ 208

Query: 402 ILARLHEELSNGTVTEY 418
           +   L      G   ++
Sbjct: 209 LFHSLKVVFGEGLTDKF 225

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 94/245 (38%), Gaps = 43/245 (17%)

Query: 301 SITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLS-RSIYVLF 359
            ++GL N  +TCY++ IIQCL     F    L + +    +T      +  +  SI   F
Sbjct: 135 GLSGLVNMGSTCYVSCIIQCLVRNPYFLKYSLNQSHFKICKTHDPTTCISCALDSIVTDF 194

Query: 360 KKMYLNGGEAIAPNG-----FLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGT 414
             +     +    N       L    K+  +L     QQD  EF   +L RLH E     
Sbjct: 195 YGISDLDDDVKKTNNDGLIDLLTCSWKINQNL-AGYSQQDAHEFWQFLLNRLHSE----- 248

Query: 415 VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDY--IFRGQMENILKCQRCGN 472
                     Y +N   + P+      EG+     L    Y  +F+G +++ + C  C +
Sbjct: 249 ----------YKSN---IGPTDTAPLKEGN---HELCNCIYHKVFQGFLKSSIVCPECNS 292

Query: 473 SSH-SYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTT 531
            +  +   F  LSL I             K  L +C+N F   E+L  D  + C NC T+
Sbjct: 293 DAKTTIEPFMDLSLDI-----------KGKNTLYECLNSFHKKEQLH-DFDYHCKNCNTS 340

Query: 532 DLKTK 536
              TK
Sbjct: 341 QDPTK 345

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 42/99 (42%), Gaps = 21/99 (21%)

Query: 598 LPPILVIHLSRFYYDLTR---KNNTVITYPLILNVILKNNKVVR----------YKLYGT 644
           L P+L+    RF + L+    K N VI +PL LN+    +   R          Y+L G 
Sbjct: 352 LSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDVEQRDDSNSKPDLIYELIGI 411

Query: 645 VNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           + H G +  GHYT+     +          WI F+D  +
Sbjct: 412 ICHTGTVNEGHYTAICKIPEGQ--------WIKFNDSMV 442

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           + G +N  NTCY NS++QCL+  T FR   L
Sbjct: 114 VFGYENFGNTCYCNSVLQCLYNLTEFRTEIL 144

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 52/121 (42%), Gaps = 18/121 (14%)

Query: 598 LPPILVIHLSRFYYDLTRKNNTV----ITYPLILNVILKNNKVV--RYKLYGTVNHIGNL 651
           LP  L IHL RF Y   R  N      I YPL L V    +  V   Y+L G V  I   
Sbjct: 517 LPKTLAIHLKRFKYSEARNCNAKLFNRIHYPLDLRVCSSFDSAVCKDYELNGIV--IHMG 574

Query: 652 VNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHD---DFEAGKTEVSSSEVYVLFY 708
              H+   V   KN   G     W+ FDD+ ++  + +    F     E++++  YVL Y
Sbjct: 575 GGPHHGHYVAICKNDLFG-----WLLFDDETVESINEETVLKFIGDANELTTA--YVLIY 627

Query: 709 E 709
           +
Sbjct: 628 K 628

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 41/101 (40%), Gaps = 19/101 (18%)

Query: 595 FIVLPPILVIHLSRFYYDLTR----KNNTVITYPLILNVIL--------KNNKVVRYKLY 642
           F   PPIL + L RF YD       K N    +P   +            NN+   Y L+
Sbjct: 382 FESFPPILHLQLKRFEYDFNFDQLIKINDRYEFPESFDTSPYMEKKEDGSNNEPCIYNLH 441

Query: 643 GTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           G + H G++  GHY + +  +   +       W  FDD+ +
Sbjct: 442 GVLVHTGDISTGHYYAMIKPDLEDQ-------WYRFDDEKV 475

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 46/236 (19%), Positives = 82/236 (34%), Gaps = 57/236 (24%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQL-SRSIYVLFKK 361
            G +N   TCY+NS++Q  F T  FR L             K P E +  + S+ +  ++
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLVY-----------KIPTESETPNSSVPLALQR 249

Query: 362 MYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPD 421
            +     +  P   L++ +    D      Q D QE   I++ RL   +    V      
Sbjct: 250 AFYQLQVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMLGTPV------ 303

Query: 422 LVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFY 481
                               EG         +  +F G+M++ +KC      S     F+
Sbjct: 304 --------------------EGK--------LSELFVGKMKSYIKCVNVEYESSRVEDFW 335

Query: 482 VLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
            L L +  +             L+D    +   E ++G+N +   + G  D +  +
Sbjct: 336 DLQLNVKNLKC-----------LKDSFENYIEIELMNGENQYAAQDFGLQDAEKGV 380

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 35.8 bits (81), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 25/107 (23%)

Query: 595 FIVLPPILVIHLSRFYYD-----LTRKNN------TVITYPLILNVILK-------NNKV 636
           F   PP+L + L RF YD     + + N+      T+   P +   +LK       N   
Sbjct: 386 FESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGDNGNP 445

Query: 637 VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
             Y L+G + H G++  GHY + +        G+  Q W  FDD+ +
Sbjct: 446 YIYNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 485

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 46/235 (19%), Positives = 80/235 (34%), Gaps = 55/235 (23%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKM 362
            G +N   TCY+NS++Q  F T  FR L            +  P  + L R+ Y L    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVP--LALQRAFYQL---- 258

Query: 363 YLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDL 422
                 +  P   L++ +    D      Q D QE   I++ RL   +  GT  E     
Sbjct: 259 ----QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMK-GTPVE----- 308

Query: 423 VSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYV 482
                                         ++ IF G+M++ +KC      S     F+ 
Sbjct: 309 ----------------------------GKLNEIFVGRMKSYIKCINVDYESSRVEDFWD 340

Query: 483 LSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
           L + +                L++  + +   E ++G+N +   + G  D +  +
Sbjct: 341 LQMNVKNFK-----------NLQESFDNYIEMELMNGENQYAAQDYGLQDAQKGV 384

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
           (REAL)
          Length = 503

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 11/82 (13%)

Query: 586 KLTTVKSSDFIVLPPILVIHLSRFYYD-LTRKNN----------TVITYPLILNVILKNN 634
           K   +K    + LP +LVIHLSR  ++ +T   N           +  Y  I N+ L  N
Sbjct: 335 KGKVIKRDIAVKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLTEN 394

Query: 635 KVVRYKLYGTVNHIGNLVNGHY 656
           + + Y L   V H G+   GHY
Sbjct: 395 RQIVYNLKSVVKHTGSHSRGHY 416

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]
           {ON} YPL072W (UBP16) - putative deubiquitinating enzyme
           [contig 24] FULL
          Length = 749

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 586 KLTTVKSSDFIVLPPILVIHLSRFYYDLTR--KNNTVITYPLILNVI---LKNNKVV--- 637
           K T VK +     P IL++HLSR  ++     +N+  +T+   L+     ++NN+ V   
Sbjct: 434 KSTIVKKTVVTESPDILILHLSRSVFNGMNYTRNSCYVTFEEELHTQEQEIENNRCVGVK 493

Query: 638 --RYKLYGTVNHIGNLVNGHY 656
             +YKL   V H G    GHY
Sbjct: 494 PIKYKLKAMVKHEGTHSQGHY 514

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 88/198 (44%), Gaps = 32/198 (16%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLF---LQTDKYPREVQLSRSIYVLF 359
           TGL N    CY NS +Q L   + F  ++L K   +F   L+ +K  ++ + +   Y L+
Sbjct: 66  TGLVNTSTECYANSSVQVLASLSNF-TIYLNKVISIFELELKIEKVEKDAKEAFDTY-LY 123

Query: 360 KKMYLNGGEAIAPNGFLKMCKKLRPDLNIPD--DQQDTQEFLLIILARLHEELSNGT--- 414
           K         + P  +  +C+ L     + D   ++    F+ I+ A +H+ ++ G    
Sbjct: 124 K---------VIPVHY-ALCQLLADLQELIDRPRERSVSNFIRILEASIHKRITGGQQDA 173

Query: 415 --VTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGN 472
             +T+   +++  +  + +    KY    E S+         + F G++ + L C  CG 
Sbjct: 174 NELTQIVLEVLQNELESLK----KYVNRMELSIEVP-----RFPFEGKLASYLSCLNCGQ 224

Query: 473 SS-HSYSTFYVLSLAIPK 489
           +S  + STF +L +  P+
Sbjct: 225 TSIPNISTFNILPIQTPQ 242

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 11/82 (13%)

Query: 586 KLTTVKSSDFIVLPPILVIHLSRFYYD--LTRKNNTVITYPLILNVILKNN--------- 634
           K T +K +  I  P IL+IHLSR  Y+  +  +N+  + +   +++  +           
Sbjct: 331 KSTIIKKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDEKNENLKI 390

Query: 635 KVVRYKLYGTVNHIGNLVNGHY 656
           ++V Y+L   + H G   +GHY
Sbjct: 391 ELVDYQLQSIIKHTGTHNSGHY 412

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLT 333
           G QN  NTCY+NS +Q L+     R+L L+
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELILS 138

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 50/130 (38%), Gaps = 34/130 (26%)

Query: 598 LPPILVIHLSRFYYDL---TRKNNTVITYPLILNVIL----KNNKV------------VR 638
           L P+LV  L RF + L   T K N  I YPL LN+       NN              + 
Sbjct: 373 LSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESNSENVPDMI 432

Query: 639 YKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFEAGKTEV 698
           Y+L   ++H G +  GHY   V         +N   W  F+D  +           + E 
Sbjct: 433 YELTSIISHKGTVNEGHYIVVVK--------VNDGQWFKFNDSMVS-------AITEEEA 477

Query: 699 SSSEVYVLFY 708
              + Y+LFY
Sbjct: 478 LKQQAYLLFY 487

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 12/114 (10%)

Query: 295 SLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRS 354
           S  ++L I G +N  NTCY+N+ +Q LF     R+L L    + F  T+  P++    + 
Sbjct: 101 SRFNELPI-GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAF--TNLNPQDEMHHKL 157

Query: 355 IYVL---FKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPD------DQQDTQEFL 399
           I  L   F+ +     +++ P   + + +K+ P     D       QQD +E  
Sbjct: 158 ILELKHCFESLKQKNYQSVLPIVLINVLRKVYPQFAERDPQAGFYKQQDAEELF 211

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           G QN  NTCY+N+ +Q L+     RD+ L
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMIL 138

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
           YBL067C
          Length = 714

 Score = 35.0 bits (79), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 18/27 (66%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFR 328
           I G +N  NTCY NSI+QCLF    FR
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFR 147

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 16/123 (13%)

Query: 598 LPPILVIHLSRFYYDLTRKNNT----VITYPLILNVILKNNKVV--RYKLYGTVNHIGNL 651
           LP  L +HL RF Y   +  NT     I YPLIL+V    N  +  +Y+L   V  +   
Sbjct: 504 LPHTLALHLKRFKYLEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELISIV--VHLG 561

Query: 652 VNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQHHHDDFE--AGKTEVSSSEVYVLFYE 709
              H+   V+  K+ + G     W+ FDD+ ++  + +      G  E  ++  YVLFY 
Sbjct: 562 GGPHHGHYVSICKSDKFG-----WLLFDDETVESINEETVLKFVGDPEDQTT-AYVLFYR 615

Query: 710 RMD 712
            +D
Sbjct: 616 EID 618

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 34.7 bits (78), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           TGL N  NTCY+NS++Q  F  +  RD  L
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRDYVL 730

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin- specific
           protease
          Length = 752

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 10/68 (14%)

Query: 599 PPILVIHLSRFYYDLTR--KNNTVITYPLILNV---ILKNNKVV-----RYKLYGTVNHI 648
           P IL++HLSR  ++ T   +N+  + +   L+     ++NN+ V     +YKL   V H 
Sbjct: 445 PEILILHLSRSVFNGTNYTRNSCYVNFDEELHTQEQTIENNRCVGVKPIKYKLKSMVKHQ 504

Query: 649 GNLVNGHY 656
           G    GHY
Sbjct: 505 GTHSQGHY 512

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 47/235 (20%), Positives = 80/235 (34%), Gaps = 55/235 (23%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKM 362
            G +N   TCY+NS++Q  F T  FR L            +  P  + L R+ Y L    
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVP--LALQRAFYQL---- 258

Query: 363 YLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDL 422
                 +  P   L++ +    D      Q D QE   I++ RL   +  GT  E     
Sbjct: 259 ----QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMK-GTPVE----- 308

Query: 423 VSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSHSYSTFYV 482
                                         ++ IF G+M++ +KC      S     F+ 
Sbjct: 309 ----------------------------GKLNEIFVGKMKSYIKCINVDYESARVEDFWD 340

Query: 483 LSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKI 537
           L L +                L++  + +   E ++G+N +   + G  D +  +
Sbjct: 341 LQLNVKNFK-----------NLQESFDNYIEMELMNGENQYAAQDYGLQDAQKGV 384

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 47/109 (43%), Gaps = 28/109 (25%)

Query: 595 FIVLPPILVIHLSRFYYD-----LTRKNN------TVITYPLILNVILKN---------N 634
           F   PP+L + L RF YD     + + N+      T+   P +   +LK          N
Sbjct: 386 FESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSENKDKN 445

Query: 635 KVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
             V Y L+G + H G++  GHY + +        G+  Q W  FDD+ +
Sbjct: 446 PYV-YNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 486

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 10/102 (9%)

Query: 303 TGLQNPCNTCYINSIIQCLF--GTTLFRDLFLTKKYR---LFLQTDKYPREVQLSRSIYV 357
            GL N  N+CYINS++QCL   G   +    L + +    L+  T+   + ++L+ +I  
Sbjct: 322 CGLINLGNSCYINSVLQCLLNGGVKTYSLSALGESFPLDVLYPSTNMKCQLIKLNNAIK- 380

Query: 358 LFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFL 399
           L  ++Y +G   I P  F K   +   + +  + QQD  EFL
Sbjct: 381 LEPELYPSG---IRPRSFKKCIGQAHEEFS-SERQQDALEFL 418

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 26/107 (24%)

Query: 290 IEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFL--------- 340
           I D T L  +    GL N  NTCY+NS++Q  F     RD  L  +Y++ +         
Sbjct: 749 IVDPTCLPVENWPAGLNNIGNTCYLNSLLQYYFSIKPLRDFIL--QYQMTMKHFQNEIVL 806

Query: 341 --QTDKYPR-------EVQLSRSIYV------LFKKMYLNGGEAIAP 372
             Q +K  R       E+++ RS+        LFK+M  +    ++P
Sbjct: 807 NKQLEKRRRIGGREVNELEVERSVQFIYQVRDLFKEMIFSQMRCVSP 853

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%)

Query: 291 EDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           E      +QL + G +N  NTCY+N+ +Q L+     RD+ L
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLRDMIL 138

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRD 329
           TGL N  NTCY+NS++Q  F  +  RD
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRD 773

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 47/109 (43%), Gaps = 28/109 (25%)

Query: 595 FIVLPPILVIHLSRFYYD-----LTRKNN------TVITYPLILNVILKN---------N 634
           F   PP+L + L RF YD     + + N+      T+   P +   +LK          N
Sbjct: 386 FESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGDKSRN 445

Query: 635 KVVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
             V Y L+G + H G++  GHY + +        G+  Q W  FDD+ +
Sbjct: 446 PYV-YNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 486

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
           weakly similar to uniprot|Q02863 Saccharomyces
           cerevisiae YPL072w UBP16
          Length = 483

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 39/87 (44%), Gaps = 11/87 (12%)

Query: 581 KWNSRKLTTVKSSDFIVLPPILVIHLSRFYYD---LTRK------NNTVITYPLILNVIL 631
           K N  + + +K   F+  P I VIHLSR  Y+    TR         T+  +  +     
Sbjct: 317 KNNVARRSILKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTS 376

Query: 632 KN--NKVVRYKLYGTVNHIGNLVNGHY 656
            N   K VRY+L   V H G+  +GHY
Sbjct: 377 SNEFTKRVRYRLKSIVIHTGSHYSGHY 403

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%)

Query: 290 IEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRD 329
           I D+  L S    TGL N  NTCY+NS++Q  F  +  RD
Sbjct: 683 IIDTNYLTSGNWPTGLNNIGNTCYLNSLLQYYFTISPLRD 722

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 11/80 (13%)

Query: 292 DSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRL--FLQTDKYPR-- 347
           D++ L ++   TGL N  NTCY+NS++Q  F  +  R   L  +  +  FL   +Y    
Sbjct: 722 DASCLPAENWPTGLNNIGNTCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRR 781

Query: 348 -------EVQLSRSIYVLFK 360
                  E ++ RS+  +++
Sbjct: 782 IGGREITEAEVERSVQFVYQ 801

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 46/108 (42%), Gaps = 26/108 (24%)

Query: 595 FIVLPPILVIHLSRFYYD-----LTRKNN------TVITYPLILNVIL--------KNNK 635
           F   PP+L + L RF YD     + + N+      T+   P +   +L        K+  
Sbjct: 386 FESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGDKDKN 445

Query: 636 VVRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
              Y L+G + H G++  GHY + +        G+  Q W  FDD+ +
Sbjct: 446 PYIYNLHGVLVHSGDISTGHYYTLIKP------GVEDQ-WYRFDDERV 486

>Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072W
           (REAL)
          Length = 523

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 40/105 (38%), Gaps = 28/105 (26%)

Query: 388 IPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLT 447
           I   Q D  EF L++L  L EE         +  LV+Y  N   +N  K+          
Sbjct: 183 ISSQQNDAHEFTLVLLQTLQEE---------HSKLVNYTKNMPDLNIPKFP--------- 224

Query: 448 DGLSPIDYIFRGQMENILKCQRCGN-SSHSYSTFYVLSLAIPKIS 491
                    F+GQ    L C +C   S  SY   ++  L +P+ S
Sbjct: 225 ---------FQGQTSKFLSCLQCHRLSKPSYQESFIRELMVPQRS 260

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 11/105 (10%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPR---EVQLSRSIYVLFK 360
           G +N  NTCY+N+ +Q L+     RD  L   + + +  DK       ++L   +   F+
Sbjct: 108 GFKNMGNTCYLNATLQALYRIDDLRDAVLN--FDVSINNDKNGENETHIKLVTELKRCFE 165

Query: 361 KMYLNGGEAIAPNGFLKMCKKLRPDLNIPD------DQQDTQEFL 399
            +     +++ P   L   +K  P     D       QQD +E L
Sbjct: 166 GLKNKSFKSVMPVVLLNALRKTYPQFAERDPQSGFYKQQDAEELL 210

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 10/128 (7%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLS-----RSIYV 357
            GL N  N+CY+NS++Q LF   +  D  L +    F     YP    L      R+   
Sbjct: 322 CGLINLGNSCYMNSVLQLLFNAGV-PDWSLEQIGTEFPLDVVYPSNNILCQLIKLRNAMK 380

Query: 358 LFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTE 417
           +  + Y NG   I P  F +   +   + +    QQD+ EF   ++ +L +++ N  V  
Sbjct: 381 IEPERYPNG---IKPTSFKRCIAQAHEEFS-SSRQQDSMEFFTFLIEQLDKKVLNKFVGT 436

Query: 418 YYPDLVSY 425
              DL+ +
Sbjct: 437 IPTDLLRF 444

>SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {ON}
           similar to uniprot|P43589 Saccharomyces cerevisiae
           YFR005C SAD1 Conserved zinc-finger domain protein
           involved in pre-mRNA splicing required for assembly of
           U4 snRNA into the U4/U6 particle
          Length = 472

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 51/116 (43%), Gaps = 12/116 (10%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYPREVQLSRSIYVLFKKMY 363
           GL N  N  Y N +IQ L      RD FL K        ++ P E QL R + ++ +KM+
Sbjct: 156 GLNNISNNDYANVVIQLLGHVPPIRDYFLLKG------LERNP-ESQLIRRLSIIVRKMW 208

Query: 364 LNG--GEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTE 417
                   I+P+  L+    +        + +D + F+L +L  L   LS+   TE
Sbjct: 209 SPKLFKPHISPHELLQYISLISKQKFSTKESKDPRNFILWLLTEL---LSSSNDTE 261

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 49/110 (44%), Gaps = 25/110 (22%)

Query: 585 RKLTTVKSSDFIVLPPILVIHLSRFYY---DLTRKNNTVITYPLILNV------ILKNNK 635
           R+L+  K      LPP+L++ L RF +     + K N  I + + LN+      +   + 
Sbjct: 353 RQLSMAK------LPPVLMLQLKRFEHLINGTSVKINDYIFFSVDLNMKDYCKPMDDQHP 406

Query: 636 V--VRYKLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYI 683
           V  + +KL   + H G +  GHYT+           +N  VW  F+D  +
Sbjct: 407 VPNLTFKLSAIIPHQGTVDKGHYTTICR--------INGDVWAKFNDSMV 448

>TPHA0H00210 Chr8 (29532..31136) [1605 bp, 534 aa] {ON} Anc_8.165
           YBL019W
          Length = 534

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 382 LRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTEYYPDLVSYDANAFQVNPSKYQKWY 441
           L  DLNI  D  D  E L +   R+  E +   +   YPDL    A++F + P + Q+  
Sbjct: 222 LMGDLNICRDLIDQAEALEVNGIRILPETTGNMIENEYPDL----ASSFILKPERVQRRL 277

Query: 442 EGSVLTD 448
              ++TD
Sbjct: 278 LNQIITD 284

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
           UBP1Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; cleaves at the C terminus
           of ubiquitin fusions irrespective of their size; capable
           of cleaving polyubiquitin chains
          Length = 809

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 75/187 (40%), Gaps = 45/187 (24%)

Query: 373 NGFLK-MCKKLRPDLNIPDDQQDTQEFLLIILARLH--------EELSNGTVTEY-YPDL 422
           N  LK M K  R ++ +  DQ+D QEF   ILA L         E+L    V +   PD 
Sbjct: 224 NSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAELESNVKSLNTEKLDTTPVAKSELPD- 282

Query: 423 VSYDANAFQVNPSKYQKWY-------EGSVLTDG----------LSPIDYIFRGQMENIL 465
              DA   Q+N  +    Y         S+L D           ++P+D    G     +
Sbjct: 283 ---DALVGQLNLGEVGTVYIPTEQIDPNSILHDKSIQNFTPFKLMTPLD----GITAERI 335

Query: 466 KCQRCG-NSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSGDNSWD 524
            C +CG N    YS F  LSL +P  ++ S       +KL   ++ ++  E + G    +
Sbjct: 336 GCLQCGENGGIRYSVFSGLSLNLPNENIGS------TLKLSQLLSDWSKPEIIEG---VE 386

Query: 525 CPNCGTT 531
           C  C  T
Sbjct: 387 CNRCALT 393

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 108/288 (37%), Gaps = 68/288 (23%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGT---TLFRDLFLTKKYRLFLQTDKYPR----------- 347
           + GL N  NTC++NS++Q L  +     F D  + KK++   Q +K              
Sbjct: 90  VGGLVNDGNTCFMNSVLQSLASSKELNAFLDDSIIKKFQ--EQEEKIQNEEDPNEKEEEE 147

Query: 348 ----EVQLSRSIYVLFKKM---YLNGGEAIAPNGFLK-MCKKLRPDLNIPDDQQDTQEFL 399
               +V+ S +   L  K+   Y         N  LK M      ++ +  DQ+D QEF 
Sbjct: 148 EKDVDVRFSVAFKELLDKLNSKYYRDKPYFRTNKLLKTMSNAPNKNMLLGYDQEDAQEFF 207

Query: 400 LIILARLHEELSN---------------------------GTVTEYYPDLVSYDANAFQV 432
             IL+ L + + +                           G V   +      + N+   
Sbjct: 208 QNILSELEKNVKSLDPKKFDNTPIPENELPDDAIIGQANLGDVGTVFLPTEQIEPNSVLN 267

Query: 433 NPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCG-NSSHSYSTFYVLSLAIPKIS 491
           N     K+Y    L   ++P+D I   +    + C +CG N    YS F  LSL +P  +
Sbjct: 268 NDENDTKFYTPFKL---ITPLDGISAER----IGCLQCGENGGIRYSVFSGLSLNLPGEN 320

Query: 492 LYSFTSKSKKIKLEDCINLFTSDEELSGDNSWDCPNCGTTDLKTKINE 539
           + S       +KL   +  +   E + G    +C  CG   +++ + E
Sbjct: 321 IGS------TLKLTGLLKEWIKPEIIEG---VECYRCGLEAIRSHLLE 359

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 303 TGLQNPCNTCYINSIIQCLFGTTLFRDLFL--TKKYRLFLQTDKYPREVQ 350
           TG+ N  NTCY+NS++Q  F  +  R+  L  +K Y  F    +  + ++
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDFYDAKRNAKTIR 801

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 32.3 bits (72), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 124 SNRISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHETPKVSAKSINDTSVKDIPGE 183
           S  +S T+ R+   SLPL PLP H+AS   L  L   R    K +   I D+S++ I   
Sbjct: 99  SQPLSSTLQRR---SLPLDPLPNHIAS---LQDLTPQRDHIVKRAPVPIIDSSMEPIVQA 152

Query: 184 RNQAHFS 190
           + Q H S
Sbjct: 153 QKQLHIS 159

>NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.540
           YPL072W
          Length = 495

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 76/195 (38%), Gaps = 50/195 (25%)

Query: 304 GLQNPCNTCYINSIIQCLF---GTTLFRDLFLTKKYRLFLQTDK---YPREVQLSRSIYV 357
           GL N  N C+INS +Q L      T++ +  L+K     LQ DK    P    L++++Y 
Sbjct: 75  GLINARNDCFINSSLQALVPLSSFTVYLNSILSK-----LQEDKNLSLPLHKNLAKTVYE 129

Query: 358 LFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLLIILARLHEELSNGTVTE 417
           L K   +   E+ +    +   + +     I   Q D  EF  ++L  L +EL       
Sbjct: 130 LQK--LIVDSESYSAELIISTMEHIFKG-TISRQQNDAHEFTQLLLETLFKEL------- 179

Query: 418 YYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRGQMENILKCQRCGNSSH-S 476
                                     +VL  G+  I+   +G + N L C RCG+ S   
Sbjct: 180 --------------------------AVLPKGV--IEVPMKGVVGNHLICIRCGHISQIK 211

Query: 477 YSTFYVLSLAIPKIS 491
              F +  L +P+ S
Sbjct: 212 EEMFSIYELNVPQCS 226

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 51/125 (40%), Gaps = 19/125 (15%)

Query: 302 ITGLQNPCNTCYINSIIQCLFGTTLFRDLFLT---------KKYRLFLQTDKYPREVQLS 352
           I GL N  NTC++NS++Q L  +    D   T         ++        K   ++  +
Sbjct: 127 IAGLLNDGNTCFMNSVLQSLASSKELMDFLDTTIKQEQEQEQEQEQVGDEKKEDVDIGFT 186

Query: 353 RSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPD-------DQQDTQEFLLIILAR 405
            S+  L  ++     +      + K  K L+   N P+       DQ+D QEF   IL+ 
Sbjct: 187 LSLNELLSQL---NAKYYKERPYFKTNKLLKTMKNAPNKNMLLGYDQEDAQEFFQNILSE 243

Query: 406 LHEEL 410
           L + L
Sbjct: 244 LEKNL 248

>KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 774

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 53/144 (36%), Gaps = 39/144 (27%)

Query: 598 LPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRYK----------------- 640
           LP  L+I   RF +      N +  Y      I K  K+V+Y                  
Sbjct: 637 LPQALLIQFKRFSFVSQSSKNDLSNYNSFNGRIEKIRKMVKYNHELTIPKESISPNLVST 696

Query: 641 ----------LYGTVNHIG-NLVNGHYTSDVNKEKNHEIGLNRQVWITFDD---DYIKQH 686
                     L G + H G +   GHYT DV     ++  L++  W   DD   D IK +
Sbjct: 697 SNSEESFKYYLSGVIYHHGVSPSGGHYTCDV-----YDKDLDK--WYRIDDVNVDEIK-N 748

Query: 687 HHDDFEAGKTEVSSSEVYVLFYER 710
             D   +G +   S   Y+L YE+
Sbjct: 749 KEDILRSGDSASDSRTAYILLYEK 772

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 32.0 bits (71), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 292 DSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFL 332
           D  SL  +   TG+ N  NTCY+NS++Q  F     R   L
Sbjct: 725 DPNSLPPENWPTGINNIGNTCYLNSLLQYYFSIAPLRSYIL 765

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 304 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKK 335
           GL N  NTCY+NS++Q  F     R+  L  K
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 31.6 bits (70), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 23/114 (20%), Positives = 52/114 (45%)

Query: 52  INQEMEALTAFIIGGYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKE 111
           I Q   A ++ ++  +Y   +  ++  FQT  +L  ++A  K +  DE    Y+ +   +
Sbjct: 726 IAQNHGATSSILMNSFYSNSIDSRAKVFQTAGSLPLAFAVAKANGNDELAAYYLEEAGLD 785

Query: 112 ESNMIVDRYLSDSNRISRTITRKRAYSLPLRPLPVHMASLSILNQLENPRHETP 165
           E ++++   ++ SN +      +   S PL+   +     ++L Q+E    + P
Sbjct: 786 EQDVVLPDGITPSNSVKTPAITEPLTSWPLKEAELSYFEKAVLGQIEEYDADEP 839

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,103,129
Number of extensions: 3343593
Number of successful extensions: 11982
Number of sequences better than 10.0: 251
Number of HSP's gapped: 11989
Number of HSP's successfully gapped: 449
Length of query: 721
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 604
Effective length of database: 40,065,477
Effective search space: 24199548108
Effective search space used: 24199548108
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)