Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_11.3605.706ON1180118058060.0
YKR096W5.706ON119593943080.0
Skud_11.3365.706ON118893841410.0
Suva_11.3335.706ON118793640430.0
TDEL0B021405.706ON114794028590.0
ZYRO0B16412g5.706ON137297828380.0
KAFR0H001805.706ON124197527360.0
CAGL0G02541g5.706ON129596826780.0
SAKL0E15004g5.706ON119697925880.0
Kpol_1043.735.706ON126096225650.0
NCAS0A031705.706ON1319104025560.0
KLTH0E00968g5.706ON114896525130.0
Kwal_55.196785.706ON117897724810.0
TPHA0E001905.706ON136198224300.0
Suva_9.375.706ON111795324140.0
Skud_9.175.706ON111895324020.0
YIL151C5.706ON111894423970.0
AFR290W5.706ON121797323850.0
Smik_9.185.706ON111894823640.0
Ecym_40155.706ON125797723680.0
KLLA0A00528g5.706ON122998223260.0
CAGL0H06611g5.706ON1282104423250.0
KNAG0C066305.706ON128172622360.0
NDAI0E050705.706ON155638013551e-163
TBLA0E017105.706ON152641311661e-136
TPHA0D046405.706ON9629343562e-33
TDEL0D051903.105ON303166762.2
ZYRO0A05632g5.615ON327106762.3
TBLA0J009405.655ON92137728.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_11.360
         (1180 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...  2241   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...  1664   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...  1599   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...  1561   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1105   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1097   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...  1058   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...  1036   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1001   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   992   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   989   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   972   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   960   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   940   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   934   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   929   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   927   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   923   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   915   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   916   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   900   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   900   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   865   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   526   e-163
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   453   e-136
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   141   2e-33
TDEL0D05190 Chr4 complement(943314..944225) [912 bp, 303 aa] {ON...    34   2.2  
ZYRO0A05632g Chr1 (457286..458269) [984 bp, 327 aa] {ON} similar...    34   2.3  
TBLA0J00940 Chr10 complement(209827..212592) [2766 bp, 921 aa] {...    32   8.3  

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score = 2241 bits (5806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1096/1180 (92%), Positives = 1096/1180 (92%)

Query: 1    MPKTSVQNPIRLSENENTRSIFLSISQPQRPSNISSFPRLVHNATTRLELSDFQVLNPSF 60
            MPKTSVQNPIRLSENENTRSIFLSISQPQRPSNISSFPRLVHNATTRLELSDFQVLNPSF
Sbjct: 1    MPKTSVQNPIRLSENENTRSIFLSISQPQRPSNISSFPRLVHNATTRLELSDFQVLNPSF 60

Query: 61   KRQNSNSVNDDINCSKRRISRSKFSNSEDRNDDSTQSEKTTTNHSRSNKSFKFMGRQKLS 120
            KRQNSNSVNDDINCSKRRISRSKFSNSEDRNDDSTQSEKTTTNHSRSNKSFKFMGRQKLS
Sbjct: 61   KRQNSNSVNDDINCSKRRISRSKFSNSEDRNDDSTQSEKTTTNHSRSNKSFKFMGRQKLS 120

Query: 121  MQEENLVEVTQSSALLSKPLNKQSKNTTYEKRGSQNVVKPKNISKSSFAFVDGESDGQSN 180
            MQEENLVEVTQSSALLSKPLNKQSKNTTYEKRGSQNVVKPKNISKSSFAFVDGESDGQSN
Sbjct: 121  MQEENLVEVTQSSALLSKPLNKQSKNTTYEKRGSQNVVKPKNISKSSFAFVDGESDGQSN 180

Query: 181  NGIVSNFQRESSNSENVCDEYKGEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
            NGIVSNFQRESSNSENVCDEYKGEK                                   
Sbjct: 181  NGIVSNFQRESSNSENVCDEYKGEKNDDNNENRNDDNDDSNNGNHDNNINNNDDENERDE 240

Query: 241  XXACKPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT 300
              ACKPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT
Sbjct: 241  NDACKPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT 300

Query: 301  ELVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDP 360
            ELVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDP
Sbjct: 301  ELVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDP 360

Query: 361  EVCCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT 420
            EVCCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT
Sbjct: 361  EVCCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYT 420

Query: 421  EAMKYTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV 480
            EAMKYTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV
Sbjct: 421  EAMKYTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFV 480

Query: 481  ERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDM 540
            ERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDM
Sbjct: 481  ERNNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDM 540

Query: 541  FIQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSN 600
            FIQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYL           TSN
Sbjct: 541  FIQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSN 600

Query: 601  NDSSVTESSTGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPILPSMLTNEAW 660
            NDSSVTESSTGNSRNGN               PDLLVEFFNDIDTLRRPILPSMLTNEAW
Sbjct: 601  NDSSVTESSTGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPILPSMLTNEAW 660

Query: 661  LETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFW 720
            LETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFW
Sbjct: 661  LETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFW 720

Query: 721  IVIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXP 780
            IVIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLC                     P
Sbjct: 721  IVIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLP 780

Query: 781  EIWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWK 840
            EIWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWK
Sbjct: 781  EIWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWK 840

Query: 841  RACRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLS 900
            RACRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLS
Sbjct: 841  RACRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLS 900

Query: 901  TLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASL 960
            TLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASL
Sbjct: 901  TLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASL 960

Query: 961  YTSWYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTTYFVFDATSWL 1020
            YTSWYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTTYFVFDATSWL
Sbjct: 961  YTSWYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTTYFVFDATSWL 1020

Query: 1021 RHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLP 1080
            RHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLP
Sbjct: 1021 RHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLP 1080

Query: 1081 LRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFNYVVL 1140
            LRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFNYVVL
Sbjct: 1081 LRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFNYVVL 1140

Query: 1141 ISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180
            ISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1141 ISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score = 1664 bits (4308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 807/939 (85%), Positives = 850/939 (90%), Gaps = 6/939 (0%)

Query: 243  ACKPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTEL 302
            +CKPA+NKRSGIALIQKLQELY+VIVKQEIELQERCSQLTNSQTTELKSLWTIYKINT+L
Sbjct: 262  SCKPASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDL 321

Query: 303  VNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 362
            VNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV
Sbjct: 322  VNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 381

Query: 363  CCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 422
            CCQFITHVF+SLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA
Sbjct: 382  CCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 441

Query: 423  MKYTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 482
            MKY YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER
Sbjct: 442  MKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 501

Query: 483  NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFI 542
            NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFN EDMF+
Sbjct: 502  NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFV 561

Query: 543  QNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNND 602
            QNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYL           +SNND
Sbjct: 562  QNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNND 621

Query: 603  SSVTESSTGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPILPSMLTNEAWLE 662
            SSVTESSTGNSRN N                DLL EFFNDIDTLRRPILPSMLTNEAWLE
Sbjct: 622  SSVTESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLE 681

Query: 663  TLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIV 722
            TLKFLNMTSLKCG+IVLRKFLHGPLG+ALPH+LPWIYFIISICLKS+QL+DP+SKEFW++
Sbjct: 682  TLKFLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMI 741

Query: 723  IIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEI 782
            I+KR FPWDTMVTFMNVLI YLLDN+TSNSIIGDLC                     PEI
Sbjct: 742  IVKRAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEI 801

Query: 783  WGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRA 842
             GCWGTLWFD IC+KNTHSISSEDNFQEIGI+DYMALDSPTDGIIFD+KDENGEKFWKRA
Sbjct: 802  LGCWGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRA 861

Query: 843  CRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTL 902
            CR IFLFRE+SRSFP+GVI+R+DPL+  SS Q+ NIL  LV+KLEPL NI +++PVL  L
Sbjct: 862  CRTIFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGAL 921

Query: 903  ESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYT 962
            ESI DISEARSE NTDLHAVPELSV  GDNIFHYVGYKKLR DYTCFDKNGEFLSASLYT
Sbjct: 922  ESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYT 981

Query: 963  SWYVPNCNN-NLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTTYFVFDATSWLR 1021
            +WYVPN NN N+E NI+Y +E+ENE LFLEC+KS      YPEIDFKTTYFVFDATSWLR
Sbjct: 982  TWYVPNSNNTNIEDNINYNSEKENEGLFLECIKS-----DYPEIDFKTTYFVFDATSWLR 1036

Query: 1022 HSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPL 1081
            HSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY E+KVLPL
Sbjct: 1037 HSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPL 1096

Query: 1082 RFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFNYVVLI 1141
            RFTGNVATHIEENLEFEEQITWRTHVDEFVIES+MKAQEKLE+A +P +S  RFNYVVLI
Sbjct: 1097 RFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLSPRRFNYVVLI 1156

Query: 1142 SDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180
            SDDD MKKKAEEK+I+TLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1157 SDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD 1195

 Score =  219 bits (558), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 146/200 (73%)

Query: 1   MPKTSVQNPIRLSENENTRSIFLSISQPQRPSNISSFPRLVHNATTRLELSDFQVLNPSF 60
           MP+TSVQNP+RLSENENTRS+FLS SQ QRPS   SFPRLV N T  L LSDFQVLNPS 
Sbjct: 1   MPETSVQNPLRLSENENTRSMFLSASQQQRPSATPSFPRLVRNTTANLSLSDFQVLNPSS 60

Query: 61  KRQNSNSVNDDINCSKRRISRSKFSNSEDRNDDSTQSEKTTTNHSRSNKSFKFMGRQKLS 120
           KRQNSNSV DDIN SKRRISR +FS+ E +N+D T  E+TT   S  N S +++   K +
Sbjct: 61  KRQNSNSVYDDINSSKRRISRPRFSDIEGKNNDHTYPERTTVKESEKNPSPRYVSSSKRA 120

Query: 121 MQEENLVEVTQSSALLSKPLNKQSKNTTYEKRGSQNVVKPKNISKSSFAFVDGESDGQSN 180
           ++ EN V +TQSSAL+SK  ++   +  +EK   +N++KP N+S++S AFVD  SD QS 
Sbjct: 121 LKRENSVGITQSSALISKSFSENGGSIAHEKWSPENMIKPLNVSQNSLAFVDAGSDEQSK 180

Query: 181 NGIVSNFQRESSNSENVCDE 200
           + IV  FQR+S+NS+ + D+
Sbjct: 181 SEIVGGFQRKSNNSQEINDK 200

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score = 1599 bits (4141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 779/938 (83%), Positives = 836/938 (89%), Gaps = 5/938 (0%)

Query: 243  ACKPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTEL 302
            AC+ AN+KRS IALIQKLQELY+VIVKQEIELQERCSQLTNSQTTELKSLWTIY+INTEL
Sbjct: 256  ACRSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTEL 315

Query: 303  VNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 362
            +NNYVTFITTALLPSQP HDL+IGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV
Sbjct: 316  INNYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 375

Query: 363  CCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 422
            CCQFITHVF+SLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA
Sbjct: 376  CCQFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 435

Query: 423  MKYTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 482
            MKY YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER
Sbjct: 436  MKYIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 495

Query: 483  NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFI 542
            NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVV+SYF+EKFGIDANGCNIFN EDMFI
Sbjct: 496  NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFI 555

Query: 543  QNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNND 602
            QNPDFFKYFFRH PSFAQSHILQIVGFGEPKNPFAILFELPKYL           +SNND
Sbjct: 556  QNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNND 615

Query: 603  SSVTESSTGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPILPSMLTNEAWLE 662
            SSVTESSTGNSRN N                D L EFFNDIDTLRRPILPSMLT+EAWLE
Sbjct: 616  SSVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTSEAWLE 675

Query: 663  TLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIV 722
            TLKFLNMTSLKCGMIVLRKFLHGPLG+ALPH+LPWIYFII+ CLKSNQL+DP SK+FW++
Sbjct: 676  TLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMI 735

Query: 723  IIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEI 782
            I+KR+FPWDT+VTFMNVLIAYLLDNE  N IIG+LC                     PEI
Sbjct: 736  IVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEI 795

Query: 783  WGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRA 842
            W CWGTLWFD ICQKN HSISS+DNFQEIGI+DYMALD+PTDGIIFDDKDE+GEKFWKRA
Sbjct: 796  WNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRA 855

Query: 843  CRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTL 902
            CRIIFLFRE+SR+FP+GVIV +DPL+ CSS QS+ ILR+LVYKLEPL+NIRS+ P+L+ L
Sbjct: 856  CRIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTAL 915

Query: 903  ESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYT 962
            E+  DISEARS+ N DL+AVPELSV +GDNIFHY GYKKLRPDYTCFD+NGEFLSASLYT
Sbjct: 916  ENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYT 975

Query: 963  SWYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTTYFVFDATSWLRH 1022
             WY+PN NN  E  ++   E+ +E LFLECMK   P+   P IDF+TTYFVFDATSWLRH
Sbjct: 976  RWYLPNGNNISEALVNSDIEKGDEDLFLECMK---PDC--PGIDFETTYFVFDATSWLRH 1030

Query: 1023 SARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLR 1082
            SARIFKLAQNRLL+FAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY EDKVLPLR
Sbjct: 1031 SARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYEDKVLPLR 1090

Query: 1083 FTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFNYVVLIS 1142
            FTGNVATHIEENLEFEEQITWRTHVDEFVIESI KAQEKLENA QP+++    NYVVLIS
Sbjct: 1091 FTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQPHVTPRHSNYVVLIS 1150

Query: 1143 DDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180
            DDDTMKKKAEEK+I+TLST+FVFSLCTKLGE+RHLCTD
Sbjct: 1151 DDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188

 Score =  212 bits (539), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 144/199 (72%), Gaps = 5/199 (2%)

Query: 1   MPKTSVQNPIRLSENENTRSIFLSISQPQRPSNISSFPRLVHNATTRLELSDFQVLNPSF 60
           MP+ SVQNP+RLSEN NTRS+FLS SQPQRP     FP  V NATTRL+LS+FQVLNPS 
Sbjct: 1   MPEASVQNPLRLSENGNTRSMFLSASQPQRPP----FPMSVRNATTRLDLSNFQVLNPSA 56

Query: 61  KRQNSNSVNDDINCSKRRISRSKFSNSEDRNDDSTQSEKTTTNHSRSNKSFKFMGRQKLS 120
           KRQNS+SV +DIN SKRRI+ S+F + ED  +DST SE+T   HSR   S ++    K S
Sbjct: 57  KRQNSSSVYNDINSSKRRINESRFLDVEDNTNDSTPSERTIICHSRPKPSPRYSNSPKRS 116

Query: 121 MQEENLVEVTQSSALLSKPLNKQSKNTTYEKRGSQNVVKPKNISKSSFAFVDGESDGQSN 180
           ++ EN VEVT S  L+SKP ++  KN  Y+KR S+N +   N SKSS AFVD E+DGQSN
Sbjct: 117 LKRENSVEVTGSYPLISKPASQSGKNNAYDKRSSKN-LSLLNPSKSSLAFVDAEADGQSN 175

Query: 181 NGIVSNFQRESSNSENVCD 199
           N I+ NFQ +S+N E++ D
Sbjct: 176 NDIIGNFQHKSNNREHIHD 194

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score = 1561 bits (4043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 775/936 (82%), Positives = 827/936 (88%), Gaps = 5/936 (0%)

Query: 245  KPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVN 304
            +PANNK+S IALIQKLQELY+VIVKQEIELQERCSQLTNSQTTELKSLWTIY+INTELVN
Sbjct: 257  RPANNKKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVN 316

Query: 305  NYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 364
            NYVTFITTALLPSQP HDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC
Sbjct: 317  NYVTFITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 376

Query: 365  QFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 424
            QFITHVF+SLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK
Sbjct: 377  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 436

Query: 425  YTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 484
            Y YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN
Sbjct: 437  YVYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 496

Query: 485  GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQN 544
            GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYF+EKFGIDANGCNIFN EDMFIQN
Sbjct: 497  GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQN 556

Query: 545  PDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSS 604
            PDFFKYFFRH PSFAQSHILQIVGFGEPKNPFAILFELPK+L           +SNN+SS
Sbjct: 557  PDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESS 616

Query: 605  VTESSTGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPILPSMLTNEAWLETL 664
            +TESST NSRN N                D L+EFFNDIDTLRRPI+ SMLTNEAWLE+L
Sbjct: 617  ITESSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESL 676

Query: 665  KFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVII 724
            KFLNMTSLKCGMIVLRKFLHGPLG+ALPH LPWIYFIISICLKS+QL+DPISKEFWIVI+
Sbjct: 677  KFLNMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIV 736

Query: 725  KRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWG 784
            KR+FPWDTMVTFMN+LIA +LDNE ++ IIG LC                     PEIWG
Sbjct: 737  KRIFPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWG 796

Query: 785  CWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACR 844
            CWGTLWFD ICQKNT+SISS+D+F+E+GI+DYMALDSP DGIIFD  DENGEKFWKRACR
Sbjct: 797  CWGTLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACR 856

Query: 845  IIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLES 904
             IFLFRE+SRSF +GVI+ ++  +N SSLQSNNIL +L YKLEPL+ + SS+P L+TLE 
Sbjct: 857  TIFLFRELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEG 916

Query: 905  IFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSW 964
            I D+ E RSE N DLHAVPELSVI G +IF+Y GYKKL P+YTCFDKNGEFLSASLYTSW
Sbjct: 917  IIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSW 976

Query: 965  YVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTTYFVFDATSWLRHSA 1024
            YVPN +NN ETNI+   E+ENE  FLEC+KS        EID  TTYFVFDATSWLRHSA
Sbjct: 977  YVPNGSNNPETNINSNCEKENEGQFLECLKSDD-----REIDLNTTYFVFDATSWLRHSA 1031

Query: 1025 RIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFT 1084
            RIFKLAQNRLL+FAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY E+KVLPLRFT
Sbjct: 1032 RIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKVLPLRFT 1091

Query: 1085 GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFNYVVLISDD 1144
            GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENA Q  +SS RFNYV+LISDD
Sbjct: 1092 GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFNYVILISDD 1151

Query: 1145 DTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180
            DTMKKKAEEKKI+TLSTRFVFSLCTKLGEQRHLCTD
Sbjct: 1152 DTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187

 Score =  209 bits (531), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 115/202 (56%), Positives = 149/202 (73%), Gaps = 6/202 (2%)

Query: 1   MPKTSVQNPIRLSENENTRSIFLSISQPQRPSNISSFPRLVHNATTRLELSDFQVLNPSF 60
           MP+ SVQNP+RLSEN N RS+FLS SQPQRPS  SSFP  VHNA  RL+LS+FQVLN S 
Sbjct: 1   MPEISVQNPLRLSENGNARSMFLSASQPQRPSTASSFPMSVHNAA-RLDLSNFQVLNSSA 59

Query: 61  KRQNSNSVNDDINCSKRRISRSKFSNSEDRNDDSTQSEKTTTNHSRSNKSFKFMGRQKLS 120
           KRQNSNSVN+DIN SKRRISR  F + E  N+ S+QSEKTT  +SR N S +++G  K +
Sbjct: 60  KRQNSNSVNEDINSSKRRISRPNFLDIEYTNNASSQSEKTTLYNSRPNPSARYLGSPKRA 119

Query: 121 MQEENLVEVTQSSALLSKPLNKQSKNTTYEKR--GSQNVVKPKNISKSSFAFVDGESDGQ 178
           +Q EN VEVT+SS L+SKP +   K+  Y+K   GS +++   N+SKSS A+V+ E DGQ
Sbjct: 120 LQRENSVEVTRSSPLISKPASHNGKHIAYDKHTTGSNSLL---NMSKSSLAYVEAEPDGQ 176

Query: 179 SNNGIVSNFQRESSNSENVCDE 200
           S+N I+ NFQ + + S+++ +E
Sbjct: 177 SSNEIIENFQHKETESDDIHNE 198

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1105 bits (2859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/940 (58%), Positives = 681/940 (72%), Gaps = 33/940 (3%)

Query: 249  NKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVT 308
            +K+S  AL+QKLQ++Y+VIVKQEIELQERCSQLTNSQTTELK LW IYK+N++L+NNYVT
Sbjct: 233  SKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSDLINNYVT 292

Query: 309  FITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 368
            FITTALLP Q   DL IGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFIT
Sbjct: 293  FITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCAQFIT 352

Query: 369  HVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYN 428
            HVFIS+S M++DIPS+Y+I W QRLGDLSRMAIALYPS FIDWKLSAEHWY EAMKY Y 
Sbjct: 353  HVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKYIYG 412

Query: 429  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 488
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQRAFVERNNGN R
Sbjct: 413  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVERNNGNHR 472

Query: 489  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFF 548
            NS LIEYLKHSE MLLPSFLES DLQ VVL YF +KFG+D N  NIF+   MF QNPD  
Sbjct: 473  NSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMFDQNPDQL 532

Query: 549  KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTES 608
            KYFFRH P+FA+SHILQ+VGFG+PKNPFA+LFELP+ L           T +  S  TE+
Sbjct: 533  KYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKS--SVTTET 590

Query: 609  STGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPIL--PSMLTNEAWLETLKF 666
            S+  + +                    + +FF++ID+L  P L  PS+   E W  +LK+
Sbjct: 591  SSAMAIDEEEYIDSSFSLGAQ------VQQFFDNIDSLTSPYLFPPSL---EVWNCSLKY 641

Query: 667  LNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKR 726
            LN+TSL C MIVL+KFL GP+ VALPH+LPW YFII++  K   + D  S+EFW+ ++ R
Sbjct: 642  LNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNR 701

Query: 727  MFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCW 786
            +FPW+T+V F+NVLIAY LDN   +  I  LC                     PE+W CW
Sbjct: 702  IFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCW 761

Query: 787  GTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRII 846
            G LWFDAIC K+   +   D+++  GI+D+M LD P DGI FD  DE+G KFWKRACR+I
Sbjct: 762  GLLWFDAICDKDKVQM---DSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVI 818

Query: 847  FLFREVSRSFPLGVIVRHDPLVNCSSLQS-NNILRDLVYKLEPLTNIRSSVPVLSTLESI 905
            FLF+ ++ +F   ++V     V+C      N++L+   +KL       +SV     L++ 
Sbjct: 819  FLFKRIAENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLRDTFYNSNSV-----LQNT 873

Query: 906  FDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWY 965
             ++ E  S+ N D+   P+LSV+  ++IF YVGYK+L  D +C+D+ GEF+S SLYTSW 
Sbjct: 874  IEVFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWG 933

Query: 966  VPNCNNNLETNISYANERENEA-LFLECMKSVHPE--IAYPE--IDFKTTYFVFDATSWL 1020
                 N +  +     +  NEA LF+E + +   E  I +PE  ++ K T+FV DATSWL
Sbjct: 934  NETSKNEIPQSEPTQQQTANEADLFIEGINTSLTEFNIDFPECKMNGKDTFFVLDATSWL 993

Query: 1021 RHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLP 1080
            RH A ++KLA N++L+FAICLTTFQELRFLRKSKDENV+EAATR +IT+RQLY E+++LP
Sbjct: 994  RHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVVEAATRAVITVRQLYTENRILP 1053

Query: 1081 LRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFNYVVL 1140
            LRFTGNVATHIEE+LEFEEQITWR+HVDEFV E+I KAQ +L    +       F++VVL
Sbjct: 1054 LRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQARLSQENRD------FHHVVL 1107

Query: 1141 ISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180
            ++DD  M++KA++  I TLSTRFVF+ C  +G +  +CT+
Sbjct: 1108 VTDDANMRRKAQQHAIHTLSTRFVFATCNAVGNRLKICTN 1147

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/978 (55%), Positives = 682/978 (69%), Gaps = 61/978 (6%)

Query: 249  NKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVT 308
            +KRS  AL+QKLQ++Y+VIVKQEIELQERCSQLT SQTTELK+LWTIYKIN++L+NNYVT
Sbjct: 410  SKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNYVT 469

Query: 309  FITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 368
            F+TTALLPSQ   D++IG+EIVEIYRIERRLWVYGTITFLD+ KNFSNFMDPEVCCQFIT
Sbjct: 470  FLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQFIT 529

Query: 369  HVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYN 428
            HVFIS+S M+ DIP KY I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+TY+
Sbjct: 530  HVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 589

Query: 429  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 488
            HGKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAFVERNNGN R
Sbjct: 590  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVERNNGNHR 649

Query: 489  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFF 548
            N+ LIEYLKHSE MLLPSFLES DLQ VVL YF  KFG D+N  NIF+   MF QNPD+ 
Sbjct: 650  NTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMFCQNPDYL 709

Query: 549  KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTES 608
            +YFFRH P+FA+SHILQ+VGFG+PKNPFA+LFELP++L           T +   + T S
Sbjct: 710  RYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKSTTVTETSS 769

Query: 609  STGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFL 667
            +                       P+    FF +I+TLR P  +PS L  E W E+L ++
Sbjct: 770  TMA-------IDDLEDEQSDRMSTPE---GFFGNIETLRFPYSVPSNL--EIWNESLNYI 817

Query: 668  NMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRM 727
            NMTSLKC M+VL+KFL GPL VALPH +PW YFIIS+  K   LN   S++FW+  + R+
Sbjct: 818  NMTSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRI 877

Query: 728  FPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCWG 787
            FPW+T+V+F+NVLIAY+LDN   +S++  LC                     PE+W CWG
Sbjct: 878  FPWNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWG 937

Query: 788  TLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIF 847
            TLWFD IC K    +   ++ + +GI+++M LD+P DGI FD  DE+GE FWKRACRIIF
Sbjct: 938  TLWFDTICNKEQSHV---EDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIF 994

Query: 848  LFREVSRSFPLGVIVRHDPLVNC--SSLQSNNILRDLVYKLE--------PLTNIRSSVP 897
            LF+ ++ +FP+G+ +     V C  + +   +IL+   +KL         P+   + S  
Sbjct: 995  LFKGLAENFPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTT 1054

Query: 898  V--LSTLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEF 955
               L  L++  +I E  S  N  +  +P LSVI G++IF Y GY++L PDY  +DKNGEF
Sbjct: 1055 AIDLDHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEF 1114

Query: 956  LSASLYTSWYVPNCNNNLETNISYANERENEALFLECMKSVH------------------ 997
            LSASLYTSWY  N  NN     ++ ++ +++   ++ ++ +H                  
Sbjct: 1115 LSASLYTSWYANNNTNNTGVIPAHGSDVDSQRDAVQSVQEMHIFNQIMEPGYCGGFADDL 1174

Query: 998  --PEIAYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKD 1055
               +  Y      TTYFV D T+WLRH   I+KLA + +L+FAICLTTF ELRFLRK KD
Sbjct: 1175 FLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKD 1234

Query: 1056 ENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESI 1115
            ENV+EAATR IIT+RQLY E K+LPLRFTGNVATHIEE+LEFEE+ITWR+HVDEFVIE++
Sbjct: 1235 ENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAV 1294

Query: 1116 MKAQEKLEN-------------AKQPNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTR 1162
             KAQ K +                + +       +VVL++DD  M+KKA+++ +RT ST+
Sbjct: 1295 YKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTK 1354

Query: 1163 FVFSLCTKLGEQRHLCTD 1180
            FVFSLC  +G +  +CT+
Sbjct: 1355 FVFSLCNSIGLRSKICTN 1372

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score = 1058 bits (2736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/975 (55%), Positives = 675/975 (69%), Gaps = 55/975 (5%)

Query: 250  KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309
            K++   LI+KLQ +Y++IVKQE+ELQ+RCSQLT SQTTELK+LW+IYK+NT+L+NNY+TF
Sbjct: 278  KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYITF 337

Query: 310  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369
            ITTALLPSQ   D+ IG+EIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 338  ITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 397

Query: 370  VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429
            VFISLSTM+ D+P K+SI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+TY+H
Sbjct: 398  VFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 457

Query: 430  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 488
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN NGN+R
Sbjct: 458  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGNVR 517

Query: 489  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFF 548
            NS LI+YLKHSE MLLPSFLE+ DLQ VVL+YF ++FG+D N  NIF  +DMF Q P   
Sbjct: 518  NSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMFFQVPASL 577

Query: 549  KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTES 608
            +++FRH P+FA+SHILQ+VGFG PKNPFA+LF+LP +L           + ++    T S
Sbjct: 578  RFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSSTEISTMS 637

Query: 609  STGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFL 667
               N   G                 +++ E+F++ID+LR PI  P++L    WL++L+ L
Sbjct: 638  IDTNDSRG-----PILNTSAYVNEGNIVTEYFDNIDSLRLPIDHPNIL---VWLKSLEHL 689

Query: 668  NMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRM 727
            NMTSLKC +IVLRKFL GPL +ALPHVLPW YFII+  LK+    +  S +FW ++++R+
Sbjct: 690  NMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRRI 749

Query: 728  FPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXX-XXXXXXXXXXXXXXXXPEIWGCW 786
             PW+T+ +F+NVL+AY+LDN      I  LC                      PEIW CW
Sbjct: 750  LPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWKCW 809

Query: 787  GTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRII 846
            GTLWFD I  K      + D F  +GI D+M LD P DGI FD+ DE GE FW RA RI+
Sbjct: 810  GTLWFDVISNKRA---LNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIV 866

Query: 847  FLFREVSRSFPLGVIVRHDPLVNC--SSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLES 904
            FLF+ ++ +   G+ V     V+C    +  N+IL+   +K+E       S    ST+  
Sbjct: 867  FLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINK 926

Query: 905  IFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSW 964
            +  + E   E N D  A P LSV+ G+NIF YVGYKKL  +   FD+NGE +S+S+YT+W
Sbjct: 927  LLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAW 986

Query: 965  YVPNCN--NNLETNISYANER-----------ENEALFLECMKS-------------VHP 998
             + N N  NN + N   +N +           E +   +    S             ++P
Sbjct: 987  VIDNDNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMNP 1046

Query: 999  E-------------IAYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQ 1045
            E              A  EI+   TYFVFDATSWLRH A I+KL+ N +L FA+CLTTFQ
Sbjct: 1047 EKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTFQ 1106

Query: 1046 ELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRT 1105
            ELRFLRKSKDENV+ AA R IIT+RQLY E K+LPLRFTGNVAT IEE+LEFEEQITWR+
Sbjct: 1107 ELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWRS 1166

Query: 1106 HVDEFVIESIMKAQEKLENAKQPNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVF 1165
            HVDEFVIE+++KAQ K  +A +       FN+VVL++DD  MK+KA+E+ I+T +T F+F
Sbjct: 1167 HVDEFVIEAVVKAQNKFISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTFTTHFIF 1226

Query: 1166 SLCTKLGEQRHLCTD 1180
            S+C KLG Q ++CT+
Sbjct: 1227 SVCRKLGIQDNVCTN 1241

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/968 (53%), Positives = 680/968 (70%), Gaps = 63/968 (6%)

Query: 245  KPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVN 304
            K  N+ +   AL+QKLQ++Y+ IV+QE+ELQE+C+QLT+SQTT+L S+W+IY+IN ELV 
Sbjct: 359  KANNSNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVT 418

Query: 305  NYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 364
            NYVTFI+TALL SQ  +DL+IGQEIVE YRI RRLWVYGTITFLDVLKNFS+FMDPEVC 
Sbjct: 419  NYVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCS 478

Query: 365  QFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 424
            QFITHVFIS+STM++DIP+KYSI W+QRLGDLSRMAIALYPS FIDWKLS+E+WY +A+K
Sbjct: 479  QFITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALK 538

Query: 425  YTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 484
            YTY +GKLYYHMST+QQNTLEAFVNLGKSVFCQ+TF PSPQYMQLVIDNIYQRAF+ER +
Sbjct: 539  YTYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGS 598

Query: 485  GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQN 544
             N RNS LIEYLKHSE MLLP+F+ + +LQ VV++YF  KFG D +  NIF   D+F+QN
Sbjct: 599  NNTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQN 658

Query: 545  PDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSS 604
            P+  KYFFRH P+FA+SHILQ VGFG+ KNPFA+LF+LPK+L           T ++   
Sbjct: 659  PENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEP 718

Query: 605  VTESSTGNSRNGNXXXXXXXXXXXXXXXPDLLV---EFFNDIDTLRRPILPSMLTNEAWL 661
             +  S  +  N                  D L+   ++F+++++++ P LP     + WL
Sbjct: 719  TSNESVMSLDN---------------ISTDSLISSDQYFSNLESMQHPYLPPPRY-DIWL 762

Query: 662  ETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWI 721
            ++L +LN+T+++CG+IVLRKFLHGP  VALPH++ W YFIIS+CLKS  L D  S+ FW 
Sbjct: 763  KSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWS 822

Query: 722  VIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPE 781
              ++R+ P +++V+F+NVLIAY LDN   +++I  +                      PE
Sbjct: 823  SFMRRLLPLNSIVSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPE 882

Query: 782  IWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKR 841
            +W CWGTLWFDAI  K+    +S   +++IG+ D++  DSP DGI+FD KDENGEKFWKR
Sbjct: 883  VWKCWGTLWFDAITDKSNTDTNS---YEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKR 939

Query: 842  ACRIIFLFREVSRSFPLGVIVRHDPLVNC--SSLQSNNILRDLVYKLEP--LTNIRSSVP 897
            A RIIFLF++++ +F +G+ + H   V C    ++ N+IL    +K+E   L      V 
Sbjct: 940  ALRIIFLFKKIAETFDIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVE 999

Query: 898  VLSTLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLS 957
            + + L +I +++E  +E+N  + A P +S+   +NIF Y GYK++ P+   FDKNGE  S
Sbjct: 1000 IENCLGAIIEMTEMPNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRS 1059

Query: 958  ASLYTSWY-----VPNCNNNLETNIS--------------------YANERENEALFLEC 992
            A+ YTSWY     VP    + E +++                    + NE EN    L+ 
Sbjct: 1060 AANYTSWYSAQEIVPKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDG 1119

Query: 993  MKSVHPEIAYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRK 1052
            +            + +TT FV DATSWLRHSA I+KLA N  L F+ICLTTFQELRFLRK
Sbjct: 1120 L------------NLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLRK 1167

Query: 1053 SKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1112
            SKDENVMEAA R II IRQLY + KV+PLRFTGN+ATHIEE+LEFEEQITWR+HVDEFVI
Sbjct: 1168 SKDENVMEAAARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVI 1227

Query: 1113 ESIMKAQEKLENAKQPNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLG 1172
            ESI KAQ+K       N   +   + VL+SDD+ MK+KA EK+IRT +TRFVF+LC+++G
Sbjct: 1228 ESISKAQKKFLQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMG 1287

Query: 1173 EQRHLCTD 1180
            + R +CT+
Sbjct: 1288 KGRLICTN 1295

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1001 bits (2588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/979 (51%), Positives = 671/979 (68%), Gaps = 74/979 (7%)

Query: 250  KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309
            K +  AL+QKLQ++YR IVKQEIELQERCSQLTNSQTT++K+LW IYK+N EL+NNY++F
Sbjct: 240  KHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAELINNYISF 299

Query: 310  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369
            ITTALLPSQP  DL+IGQEIVEIYR+ERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI+H
Sbjct: 300  ITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISH 359

Query: 370  VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429
            VF+S+S M+ D+P +YSI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY++A+ YTY H
Sbjct: 360  VFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGH 419

Query: 430  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 489
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TF PS QYMQLVIDNIYQRAF ER+ G+ RN
Sbjct: 420  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSSRN 479

Query: 490  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFK 549
              ++EYLKHSE MLLPSFLESP+LQ VVL++F ++FG+  N  + F+ + +FIQ+ +  +
Sbjct: 480  FPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLR 539

Query: 550  YFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTESS 609
            YFF H P+FA+SHILQ+VGFG+P+NPFAILFELPK+L           + ++    T   
Sbjct: 540  YFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSSPPLPTNLD 599

Query: 610  TGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLN 668
             GN  +                    +  +F +ID+ R P   P  +  + W ++L +LN
Sbjct: 600  DGNGSSSIS-----------------VDHYFENIDSHRVPYSFPQDI--QIWQQSLSYLN 640

Query: 669  MTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMF 728
            +TS++C M VL+KFLH PL  ALPH+LPW +F++S+ ++ + L+    K+FW+V ++R+F
Sbjct: 641  LTSMECSMSVLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIF 700

Query: 729  PWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCWGT 788
            PW+++V+F+N L+A+LLDN  + S +  LC                     PE+W CWGT
Sbjct: 701  PWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGT 760

Query: 789  LWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFL 848
            LWFD I  K+    SS    Q  GIRD++ LD+P DGI FD  DE+G KFWKRACR+IF+
Sbjct: 761  LWFDTISNKSELKASS---VQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFM 817

Query: 849  FREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLESIFDI 908
            F+ +++ F  G+ V   P+     + + + L+   +K E L     +   L + ++   +
Sbjct: 818  FKGMAKEFHYGIRVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQS-DNFIKV 876

Query: 909  SEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWYVP- 967
             E  S IN++  AVP LS+I+G++IF + GY+++ PDY CF+KNG+ ++ SLYTS  +  
Sbjct: 877  FEPISPINSNFEAVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLER 936

Query: 968  ---------NCNNNLETNISYA--------NERENEAL----------------FLECMK 994
                     N   ++E  +  A        NER  E +                F+E ++
Sbjct: 937  VAIQGGDDFNVKRHVENGVLLAAHNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLR 996

Query: 995  SV---HPEIAYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLR 1051
                 H ++A    D   TYFV DATSWLRH A ++KLA N +L+FAICLTTFQELRFLR
Sbjct: 997  DSRFPHGDLAC-NADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLR 1055

Query: 1052 KSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFV 1111
            KSKDE+V+EAATR +IT RQLY E K+LPLRFTGN+ATH+EE+LEFEEQITWR+HVDEFV
Sbjct: 1056 KSKDESVVEAATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFV 1115

Query: 1112 IESIMKAQEKLE-------NAKQPNISS-----HRFNYVVLISDDDTMKKKAEEKKIRTL 1159
            IE++ K+Q K +       +  Q  I +      +FN+VVL++DD  M+ KAE   I   
Sbjct: 1116 IEAVYKSQRKFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIF 1175

Query: 1160 STRFVFSLCTKLGEQRHLC 1178
            S+RF+F+ C +LG  + +C
Sbjct: 1176 SSRFMFAFCNQLGYNQKVC 1194

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/962 (53%), Positives = 652/962 (67%), Gaps = 66/962 (6%)

Query: 250  KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309
            ++S  AL+QKLQ++Y++I+KQE+ELQERCSQLTNSQTTE+K+LW IYK+N +L+NNYVTF
Sbjct: 312  RKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNYVTF 371

Query: 310  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369
            ITTAL PSQ   DL+IG+EIV+IY+IERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH
Sbjct: 372  ITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 431

Query: 370  VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429
            VFIS+S+M+ DIP KY+I WLQ+LGDLSRMA+AL+PS FIDWKLSAE WY  AM+Y+Y +
Sbjct: 432  VFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYSYGY 491

Query: 430  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 488
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQ TF PS QY+QLVIDNIYQRAF +RN + N R
Sbjct: 492  GKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSSNSR 551

Query: 489  N-SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNI--FNCEDMFIQNP 545
            N  LL++YLKHSE MLLP+F+ESPDLQ VVL YF+EKFGID N  N+  F    MFIQN 
Sbjct: 552  NCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQPRQMFIQNN 611

Query: 546  DFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSV 605
            D  K++FRH  +FA++ ILQ+VG+G PKNPFA+LF LPKYL             N     
Sbjct: 612  DQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRKPKNQIVGE 671

Query: 606  TESSTGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLR-RPILPSMLTNEAWLETL 664
              SST  S                    D    FFN+ID L     +P+ ++   W ++L
Sbjct: 672  DGSSTTFSSVSGMEYMVNMETNVFLGSED----FFNNIDKLAINNFMPNSIS--LWNDSL 725

Query: 665  KFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVII 724
            K+ N T+ KC MIVL+KFL+GPL VALPH+LPW+YF+ISI L+  +  D    EFW   I
Sbjct: 726  KYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYAFI 785

Query: 725  KRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWG 784
            KR+FPW++MV F+NVL+AY++DN   NS + +LC                     PE+W 
Sbjct: 786  KRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEVWK 845

Query: 785  CWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACR 844
            C G+LWFD I +K      + D++ E GI+DY  LD P DGI FD+ DE G KFWKR+ R
Sbjct: 846  CRGSLWFDIIDEKRNS--QNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVR 903

Query: 845  IIFLFREVSRSF-PLG--VIVRHDPLVNCSSLQSNNILRDLVYKLEPLT-NIRSSVPVLS 900
            +IFLFR +   F   G   I  + P++N   L  N+ L    +KL   + +I     ++S
Sbjct: 904  VIFLFRGIVERFNGFGNLAISYNAPVINRRGLGVNSHLVGYSFKLMAKSDDIMFDDMLVS 963

Query: 901  TLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASL 960
              E I          N+D +A+P LS+I G+NIF YVGYK++  DY  FDKNG+ +S S 
Sbjct: 964  NFEEI-------DSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSF 1016

Query: 961  YTSWYVPNCNNNLETNISYA-----------------NERENEALFLECMKSVHPEI--- 1000
            Y +W +     N +T ++                   NE+E   LF +C    +  +   
Sbjct: 1017 YNTWSI-----NQDTGVNGGPLSNNSSSSNAASSDPMNEKE---LFNKCFDPEYDSVDEF 1068

Query: 1001 ----AYPEID-------FKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRF 1049
                 Y +I        ++ TYF+ DATSWLRH A ++K+A N +L+F+ICLTTFQELRF
Sbjct: 1069 WNKEIYDDIGRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRF 1128

Query: 1050 LRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDE 1109
            LRKSKDENV+EAATR IIT+RQL+ E K+LPLRFTGNVATHIEE+LEFEEQITWR+HVDE
Sbjct: 1129 LRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDE 1188

Query: 1110 FVIESIMKAQEKLENAKQPNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCT 1169
            FVIE+++KA+ K +  +  N+   +   +VL++DD  MK KA EK  +T STRFVF++  
Sbjct: 1189 FVIEAVIKAETKRKEQEMHNMKGFQ---IVLVTDDSNMKNKALEKGSKTFSTRFVFAISN 1245

Query: 1170 KL 1171
             L
Sbjct: 1246 YL 1247

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1040 (52%), Positives = 668/1040 (64%), Gaps = 123/1040 (11%)

Query: 250  KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309
            K++G AL++KLQ++Y+VIVKQEIELQERCSQLT SQTT+LK+LWTIYK+N +L+NNYVTF
Sbjct: 294  KKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTF 353

Query: 310  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369
            ITTALL SQ   DL IG+EI+EIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH
Sbjct: 354  ITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 413

Query: 370  VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429
            VFISLSTM++DIP+KYSI WLQRLGDLSRMAIALYPS FIDWKLSAE WY EAMK+TYNH
Sbjct: 414  VFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNH 473

Query: 430  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 489
            GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN
Sbjct: 474  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRN 533

Query: 490  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGI-------------------DAN 530
              LIEYLKHSE MLLP+FLE+ +LQ VVL YF EKFGI                   +  
Sbjct: 534  LQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTR 593

Query: 531  GCNIFNCEDMFIQNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXX-- 588
              ++F   DMFIQNP+  KYFFRH P+FA+SHILQ+VGFG+PKNPFA+LFELPKYL    
Sbjct: 594  TIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERK 653

Query: 589  -----------XXXXXXXXXTSNNDSSVTESSTGNSRNGNXXXXXXXXXXXXXXXPDLLV 637
                                ++  D S+   S  NS  G                     
Sbjct: 654  DKKEKKKSKSNSNSNNNNNASTAGDGSMM--SIDNSEMGEDDINNLFSDNVMNQVTS--E 709

Query: 638  EFFNDIDTLRRP-ILPSMLTNEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLP 696
            EFF +I+ LR    +P+ L  E W+ +L  +N+ SLKC MIVL+KFLHGPL +ALPH+LP
Sbjct: 710  EFFQNIEQLRFDYFIPNSL--EIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLP 767

Query: 697  WIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDTMVTFMNVLIAYLLDN--------- 747
            W YFIISI LK   L    SK FWI I+K +FPW+ ++ F+NVL+ Y LDN         
Sbjct: 768  WCYFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAV 827

Query: 748  -----ETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCWGTLWFDAICQKNTHSI 802
                 +  N  I DLC                     PE+W CWGTLWFD I  KN    
Sbjct: 828  NDTKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGM-- 885

Query: 803  SSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREVSRSF-PLGVI 861
               D+F+ +GI+D+M LD P DGI +  +DE GE FWKR  RIIFLF+ ++ +F  LG+ 
Sbjct: 886  -DADSFENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLK 944

Query: 862  VRHDPLVNC--SSLQSNNILRDLVYK----------------LEPLTNIRSSVPVLSTLE 903
            V ++       +++  +NIL+   +K                LE  TN      +++ + 
Sbjct: 945  VSYNAGTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNT-----IINRIT 999

Query: 904  SIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTS 963
               DI E   E N +    P  S+I  ++IF Y GYKKL P+   FDKNGEF S S+YT+
Sbjct: 1000 EFVDIKEPIHETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTA 1059

Query: 964  WYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAY-----PEIDFKT--------- 1009
            W +      L  N +      +E   L        E+++     PE   K+         
Sbjct: 1060 WPMDYDQLILAQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTE 1119

Query: 1010 ------TYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAAT 1063
                  TYFVFDATSWLRH A I+KLA N +L+FA+CLTTFQELRFLRKSKD NV+EA+T
Sbjct: 1120 PFNRYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEAST 1179

Query: 1064 RGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1123
            R IIT+RQLY +  +LPLRFTGNVAT IEE+LEFEEQITWR+HVDEFVIE++MKAQEK  
Sbjct: 1180 RAIITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFV 1239

Query: 1124 NAK-----------------------QPNISSHRFNYVVLISDDDTMKKKAEEKKIRTLS 1160
             +K                       +    S+ F YVVLI+DDD+M+ KA+ K I T  
Sbjct: 1240 KSKTVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFG 1299

Query: 1161 TRFVFSLCTKLGEQRHLCTD 1180
            T+ VFS+C+ +G    +CT+
Sbjct: 1300 TQVVFSVCSMMGIDEGVCTN 1319

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/965 (51%), Positives = 653/965 (67%), Gaps = 68/965 (7%)

Query: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314
            AL+QKLQ++YR IVKQE+ELQERCSQLT+SQTT+LK+LW IYK+NTEL+NNYV FITTAL
Sbjct: 213  ALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTAL 272

Query: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374
            LPSQP  DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEVCCQFITHVFIS+
Sbjct: 273  LPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISI 332

Query: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434
            S M+ D+P K++  WL+RLGDLSRMAIALYPS FIDWKLSAEHWYT+A+ + + HGKLYY
Sbjct: 333  SNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLYY 392

Query: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIE 494
            HMSTVQQNTLEAFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN GN RNSL++E
Sbjct: 393  HMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLMVE 452

Query: 495  YLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFKYFFRH 554
            YLKHSE MLL SFLESP+LQ VVLS+F  KFGI +N  + F+ + +F+Q+ +  KYFFRH
Sbjct: 453  YLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYFFRH 512

Query: 555  GPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTESSTGNSR 614
             P+FA+SHILQ+VGFG PKNPFA+LFELPK+L           + +++S  +  +     
Sbjct: 513  APAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSMEAPS--- 569

Query: 615  NGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLK 673
                              P   +E+   +D+ R     P+ L    W ++L  +N TS+K
Sbjct: 570  ------------------PTSPIEYLESVDSPRFVYEFPTDLA--IWQQSLSHINTTSIK 609

Query: 674  CGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDTM 733
            C  +VL+KFLHGPL  A  H+LPW YF++S+ ++ ++L  P  K+FWI + +++FPW+++
Sbjct: 610  CSAVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSI 669

Query: 734  VTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCWGTLWFDA 793
            V F+N++IA+ LDN    S I +LC                     PE+W CWG LWFD 
Sbjct: 670  VNFLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDV 729

Query: 794  ICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREVS 853
            I  K   S   ++      ++D+M  D P DGI FD+ DE G +FWKRACR++F+F+ ++
Sbjct: 730  ISDK---SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIA 786

Query: 854  RSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLESIFDISEARS 913
            + F +G+ +   PL +  SL + + L++  +K E       S  ++ST    F   E  S
Sbjct: 787  QEFNMGLTLASVPLQSRRSLAAGHPLQNFCFKFEDPPVDSESYALISTQMPAF---ENIS 843

Query: 914  EINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWYVP------ 967
            E N D +A P  S++ G ++F   GY++L  D+TCF+K G  ++ SLYTS  +       
Sbjct: 844  ERNLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHG 903

Query: 968  --NCNNNLETNISYANEREN---------EALFLE-CMKSVHPEIAYP----------EI 1005
              + N    +     N+ +N         E ++L+ CM     E  Y             
Sbjct: 904  GDDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNC 963

Query: 1006 DFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRG 1065
            D   +YFV DATSWLRH A ++KLA N +LRFAICLTTFQELRFLRKSKDE+V+EAATR 
Sbjct: 964  DSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRA 1023

Query: 1066 IITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE-- 1123
            +IT+RQLY E ++LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE++ KAQ K E  
Sbjct: 1024 VITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEAL 1083

Query: 1124 --NAKQ------PNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQR 1175
               AK+      P      F+++ L+SDD  M+ KA  ++IRT S+RF+F++C ++G   
Sbjct: 1084 NAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAH 1143

Query: 1176 HLCTD 1180
            H CT+
Sbjct: 1144 HACTN 1148

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  960 bits (2481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/977 (51%), Positives = 647/977 (66%), Gaps = 69/977 (7%)

Query: 243  ACKPANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTEL 302
            A  P+++  S  AL+QKLQ++YR IVKQE+ELQERC+QLT SQTT+LK+LW IYKIN EL
Sbjct: 232  AVSPSSSPTSQ-ALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIEL 290

Query: 303  VNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEV 362
            +NNYV FITTALLPSQP  DL+IGQEIV IYRIERRLWV+GTITFLDVLKNFSNFMDPEV
Sbjct: 291  INNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEV 350

Query: 363  CCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEA 422
            CCQFITHVFIS+STM+ D+P K+S  W +RLGDLSRMAIALYPS FIDWKLSAEHWY++A
Sbjct: 351  CCQFITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQA 410

Query: 423  MKYTYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER 482
            + + + HGKLYYHMSTVQQNTLEAFVNLGKSVFC++TF PSPQYMQLVIDNIYQRAF ER
Sbjct: 411  LSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAER 470

Query: 483  NNGNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFI 542
            N GN RNSL++EYLKHSE MLL SFLESP+LQ VVLS+F  KFG+  +  + FN  DMF+
Sbjct: 471  NGGNHRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFL 530

Query: 543  QNPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNND 602
            Q+ +  KYFFRH P+FA+SHILQ VGFG+PKNPFA+LFELPK+L           + ++ 
Sbjct: 531  QDGERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSH 590

Query: 603  SSVTESSTGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPI-LPSMLTNEAWL 661
            S  +  +T +                    P    E+  ++D+ R     P  L    W 
Sbjct: 591  SFTSIETTSH------------------LSPS---EYLENVDSPRYAYEFPEDLA--IWR 627

Query: 662  ETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWI 721
            E+L  +N+TS +C  IV +KFL GPL VA+ H+LPW YF++S+ LK + L     K FWI
Sbjct: 628  ESLSHINITSARCSSIVFQKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWI 687

Query: 722  VIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPE 781
             +++++FPW+++V F+N+L+A++LDN    S I  LC                     PE
Sbjct: 688  TLVRQIFPWNSIVDFLNMLMAFVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPE 747

Query: 782  IWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKR 841
            IW CWG LWFD I  K   S   + +    G +D+   D P DGI FD+ DE GEKFWKR
Sbjct: 748  IWRCWGALWFDVIADK---SNGEDGDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKR 804

Query: 842  ACRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLST 901
            ACR+IF+F+ +++ F LG+ +      +   + + + L++  +  E    I +   + S 
Sbjct: 805  ACRLIFIFKGIAQEFSLGLTLSAFAPQSRRPMTAGHPLQNFSFNFE---EIPAQSQIQSF 861

Query: 902  LESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLY 961
            + +   + E  +  N D +  P  S++ G++IF + GY+++  DYTCF+K+G  +S SLY
Sbjct: 862  VRNQIPLFEEIATGNLDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLY 921

Query: 962  TSW-----------------YVPNCNNNLETNISYAN-ERENEALFLECMKSVHPEIAYP 1003
            TS                  Y  + ++N   N      ER        CM     E AY 
Sbjct: 922  TSGKLERGPIQGGDDFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYE 981

Query: 1004 ----------EIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKS 1053
                        D   +YFV DATSWLRH A +FKLA N +LRF ICLTTFQELRFLRKS
Sbjct: 982  MKFPFGDLSCNCDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKS 1041

Query: 1054 KDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIE 1113
            KDE+V+EAATR +IT+RQLY + K+LPLRFTGNVATH+EE+LEFEEQITWR+HVDEFVIE
Sbjct: 1042 KDESVVEAATRAVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIE 1101

Query: 1114 SIMKAQEKLE----NAKQPN------ISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRF 1163
            ++ KAQ+K E     AK+             F++V L+SDD  M+ KA  ++I+T STRF
Sbjct: 1102 AVYKAQKKFEAINAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRF 1161

Query: 1164 VFSLCTKLGEQRHLCTD 1180
            +F++C ++G     CT+
Sbjct: 1162 MFAVCNQIGLAHQACTN 1178

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/982 (50%), Positives = 653/982 (66%), Gaps = 77/982 (7%)

Query: 250  KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309
            ++S   L+QKLQ++Y+ IVKQEIELQERC +LTNSQTTELK+LWTIY++N+ELV+NY+TF
Sbjct: 378  RKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNYITF 437

Query: 310  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369
            ITTA+ P+QP  D  IG+EI+EIY+IERRLWVYGTITFLD+LKNFSNFMDPEVCCQFI H
Sbjct: 438  ITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQFIFH 497

Query: 370  VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429
            VFIS+S M++DIP KY ++W Q+LGDLSRMAIALYPS+FIDWKLSAE WY  AM++TY H
Sbjct: 498  VFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFTYGH 557

Query: 430  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGN--L 487
            GKLYYHMSTVQQNTLEAFVNLGKS+FC+ TF PS QY+QLVI NIYQRA+ + NN N   
Sbjct: 558  GKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYADSNNSNNGR 617

Query: 488  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGC--NIFNCEDMFIQNP 545
             + LL++Y+KH E  LLP+F ES +LQ VVL YFI+KFG+D N    N+F    MF+QN 
Sbjct: 618  NDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFISRKMFVQNN 677

Query: 546  DFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNN-DSS 604
            D FK F+R+  +FA+S ILQIVG+G  K+PF++LFELPKYL                   
Sbjct: 678  DQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRKPKTMLILK 737

Query: 605  VTESSTGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRP-ILPSMLTNEAWLET 663
            +T+    +   G                     EFF +IDT+  P  +P+ +  + W  +
Sbjct: 738  ITQPRLYHRWVGTTLPTMPNNNVFLTAE-----EFFENIDTINYPSFMPNSV--DIWNHS 790

Query: 664  LKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVI 723
            L++ N  S+KC MIV +KFLH P  +ALPH LPW YFIISI L+ ++  +    EFW+  
Sbjct: 791  LQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVEF 850

Query: 724  IKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIW 783
            ++R+FPW+++V F+NVL+AY++DN    SI+ +LC                     PE+W
Sbjct: 851  VRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEVW 910

Query: 784  GCWGTLWFDAICQ-------KNTHSISSED----NFQEIGIRDYMALDSPTDGIIFDDKD 832
             C G+LWFD I +       KN   I+  D    +++  G++DY   D P DG  FD+ D
Sbjct: 911  KCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDESD 970

Query: 833  ENGEKFWKRACRIIFLFREVSRSFP--LGVIVRHD-PLVN--CSSLQSNNILRDLV---Y 884
            E GE+FWKRA R+IFLF++++ S+    G+I+ ++ P+ N      + N + ++L+   +
Sbjct: 971  EIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRRKDEYKVNTVCQELLEFSF 1030

Query: 885  KLEPLTNIRSSVPVLSTLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRP 944
            KL       SS  V+  L+ I +  E   E+N D H  P LS+++GD+IF YVGYK++ P
Sbjct: 1031 KLNA-----SSDGVM--LDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVCP 1083

Query: 945  DYTCFDKNGEFLSASLYTSWYVPNCNNNLETNI--------------------SYANERE 984
            ++  FDKNG+F+S S + SW + N  N L  N                     S  N+  
Sbjct: 1084 NFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDPM 1143

Query: 985  NEAL-FLECMKSVHPEIA-------YPE----IDFK-TTYFVFDATSWLRHSARIFKLAQ 1031
            NE L F EC    +  +        YP+    I  +  TYF+ DATSWLRH A I+K+A 
Sbjct: 1144 NELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIAT 1203

Query: 1032 NRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHI 1091
            +++L+FAICLTTFQELR+LRKSKD NV+EAATR IIT+RQLY E+ +LPLRFTGNVATHI
Sbjct: 1204 SKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATHI 1263

Query: 1092 EENLEFEEQITWRTHVDEFVIESIMKAQEK----LENAKQPNISSHRFNY-VVLISDDDT 1146
            EE+LEFEEQITWR+HVDEFVIE+++KA+EK    L +         +  + ++L++DD T
Sbjct: 1264 EEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFGIILVTDDIT 1323

Query: 1147 MKKKAEEKKIRTLSTRFVFSLC 1168
            MK KA ++KI+T STRF+FS+ 
Sbjct: 1324 MKNKAMDRKIKTFSTRFIFSMA 1345

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/953 (49%), Positives = 633/953 (66%), Gaps = 67/953 (7%)

Query: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314
              I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IYK+NTEL+ NY+ FI TAL
Sbjct: 205  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLNTELIKNYINFIITAL 264

Query: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVCCQFIT+ FI +
Sbjct: 265  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMDPEVCCQFITYAFICI 324

Query: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY Y  GKLYY
Sbjct: 325  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 384

Query: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 487
            H++T+QQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++GN        
Sbjct: 385  HIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGNTNNNETAH 444

Query: 488  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDF 547
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F+ +DMF QNP+ 
Sbjct: 445  RNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGNDVFSTKDMFCQNPES 504

Query: 548  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTE 607
             +Y+FRH P+FA+S ILQ++GFG PKNPFA+LF+LPK+L           +    + +  
Sbjct: 505  LRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDKREKKKSGA--AEIPH 562

Query: 608  SSTGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPILPSMLTNEAWLETLKFL 667
                    G+                     +F +IDTL             WL++L ++
Sbjct: 563  YRDPFDDQGSSE------------------SYFQNIDTLNSDFNDPPTNIGIWLDSLNYI 604

Query: 668  NMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRM 727
            NMTS++C + VL KFLH PL VALPH L W++FII++  K   +N      FWI  ++R 
Sbjct: 605  NMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRT 664

Query: 728  FPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCWG 787
             PW++MVTF NVL+ Y+LDN   +  +                         PE+W CWG
Sbjct: 665  MPWNSMVTFSNVLVCYMLDN--LHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWG 722

Query: 788  TLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIF 847
            +LWFDA+ + +   I         G++D++  DSP DGI+FD KDE GEKFW R+ R I 
Sbjct: 723  SLWFDAVKKCDVMEIP--------GVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTIL 774

Query: 848  LFREVSRSFP-LGVIVRHDPLVNC--SSLQSNNILRDLVYKLEPL-TNIRSSVPVLSTLE 903
              + +++ FP LG+ V     V C  + +  +  L++L +KL+P   +  +    L  L 
Sbjct: 775  TLKGIAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELY 834

Query: 904  SIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTS 963
               +I+E    +N DL A P+LSV++G++IF Y GY +L  DY CFDKNG F SA +YT 
Sbjct: 835  DTIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQ 894

Query: 964  WYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFK--------------- 1008
            W   N  N +  ++S      +E+L+      +   + + +I F                
Sbjct: 895  W--SNVGNGVTLDVS------SESLYDSTTNDL--SLHWAKILFDKVFTIGKNTDDDGSC 944

Query: 1009 TTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIIT 1068
            + YFV DATSWLRH A IFKLA+N +L+FAICLTTFQELR+LR SKD+NV+EAATR +IT
Sbjct: 945  SVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVIT 1004

Query: 1069 IRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQP 1128
            IRQLY E K++P+RFTGN+ATHIEENLEFEEQITW+THVDEFVI++I K  +  +  +  
Sbjct: 1005 IRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTI 1064

Query: 1129 NISSHRFN-YVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180
            + +  R   + VL++DDD M +KA++K I+T +T+++FSL +KLG    LCT+
Sbjct: 1065 DKNKGRSKEFAVLVTDDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/953 (50%), Positives = 631/953 (66%), Gaps = 67/953 (7%)

Query: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314
              I+KLQE+YR+IV QE ELQ+RC  LT SQTTELKSLW IY++NTEL+ NY+ FI TAL
Sbjct: 206  TFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265

Query: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS+
Sbjct: 266  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325

Query: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434
            S+M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY Y  GKLYY
Sbjct: 326  SSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385

Query: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 487
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++          
Sbjct: 386  HIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAH 445

Query: 488  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDF 547
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG +IF+ +DMF QNP+ 
Sbjct: 446  RNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPES 505

Query: 548  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTE 607
             +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+LPKYL                S  TE
Sbjct: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKR-----EKKKSGATE 560

Query: 608  SSTGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPI--LPSMLTNEAWLETLK 665
                     +                     +F +ID+L      +P+ L    WL++L 
Sbjct: 561  VPQYRDPFDDQISSE---------------SYFQNIDSLTSNFDDIPTNLN--IWLDSLN 603

Query: 666  FLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIK 725
             +NMTS++C + VL KFLH PL VALPH L W++FI++I  K   +N      FWI  ++
Sbjct: 604  HINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLR 663

Query: 726  RMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGC 785
            R  PW++MV   NVL+ Y+LDN   +  +                         PEIW C
Sbjct: 664  RTMPWNSMVNLANVLVCYMLDN--IHPFLERELERFYSLELDDLIEYFNENENLPEIWKC 721

Query: 786  WGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRI 845
            WG+LWFDAI + +   I         G++D++  DSP DGI+FD+KDE GE+FW R+ R 
Sbjct: 722  WGSLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRT 773

Query: 846  IFLFREVSRSFP-LGVIVRHDPLVNC--SSLQSNNILRDLVYKLEPL-TNIRSSVPVLST 901
            I + + V++ FP LG+ V     V C  + +  +  L++  +KL+    N  +    L  
Sbjct: 774  ILILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDE 833

Query: 902  LESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLY 961
            L    +I+E    +N DL A P LSV++G+NIF Y GY +L PDY CFDKNG F SA +Y
Sbjct: 834  LYDTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIY 893

Query: 962  TSWYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTT----------- 1010
            + W   N  N +  ++S      +E+++     ++ P       D  TT           
Sbjct: 894  SQW--SNVGNGMVLDVS------SESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNC 945

Query: 1011 --YFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIIT 1068
              YFV DATSWLRH A IFKLA+N +L+FAICLTTFQELR+LR SKD+NV+EAATR +IT
Sbjct: 946  SVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVIT 1005

Query: 1069 IRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQP 1128
            IRQLY E K++PLRFTGN+AT++EENLEFEEQITW THVDEFVI++I K  +  +  +  
Sbjct: 1006 IRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLI 1065

Query: 1129 NISSHRFN-YVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180
            + + ++ N Y VL++DDD M  KA++K I+T +T+++FSL +K+G    LCT+
Sbjct: 1066 DKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/944 (50%), Positives = 631/944 (66%), Gaps = 51/944 (5%)

Query: 256  LIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTALL 315
             I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IY++NTEL+ NY+ FI TALL
Sbjct: 207  FIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266

Query: 316  PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLS 375
             +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS+S
Sbjct: 267  TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326

Query: 376  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYYH 435
             M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY Y  GKLYYH
Sbjct: 327  NMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386

Query: 436  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL-------R 488
            ++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++G+        R
Sbjct: 387  IATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSANNNEIAHR 446

Query: 489  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFF 548
            NS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG ++F+ +DMF QNP+  
Sbjct: 447  NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMFCQNPESL 506

Query: 549  KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTES 608
            +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+LPKY                 S  TE+
Sbjct: 507  RYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKY-----LKLKKDKREKKRSEATET 561

Query: 609  STGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPILPSMLTNEAWLETLKFLN 668
            S+                       D L   FNDI        P+ L    WL++L  +N
Sbjct: 562  SSYTD-----PFDVQISSESYFQNIDALNSSFNDI--------PTNLN--IWLDSLNHIN 606

Query: 669  MTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMF 728
            MTS++C + VL KFLH PL VALPH L W++FI++I  K   +N      FWI  ++R  
Sbjct: 607  MTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTM 666

Query: 729  PWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCWGT 788
            PW+++VT  NVL+ Y+LDN   +  +                         PEIW CWGT
Sbjct: 667  PWNSIVTLGNVLVCYMLDN--LHPFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGT 724

Query: 789  LWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFL 848
            LWFDAI + +   I         G++D++  DSP DGI+FD+KDE GEKFW R+ R + L
Sbjct: 725  LWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLL 776

Query: 849  FREVSRSFP-LGVIVRHDPLVNC--SSLQSNNILRDLVYKLEPLT-NIRSSVPVLSTLES 904
             + +++ FP LG+ V     V C  + +  +  L++L +KL+    +  +    L  L  
Sbjct: 777  LKGIAKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYD 836

Query: 905  IFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSW 964
              +I+E    +N D  A P LSV++G++IF Y GY +L PDY CFDKNG F SA +Y+ W
Sbjct: 837  TIEINEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQW 896

Query: 965  YVPNCNNNLETNISYAN--ERENEALFLECMKSVHPEIAYPEIDFK-----TTYFVFDAT 1017
               N  N +  ++S  +  +  N  L L   K    +IA            T YFV DAT
Sbjct: 897  --SNVGNGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDAT 954

Query: 1018 SWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDK 1077
            SWLRH A IFKLA+N  L+FAICLTTFQELR+LR SKD+ V+EAATR +ITIRQLY E K
Sbjct: 955  SWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKK 1014

Query: 1078 VLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSHRFN- 1136
            ++P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  ++ +  +  + + ++   
Sbjct: 1015 IIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKE 1074

Query: 1137 YVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180
            + VL++DDD M +KA+++ I+T +T+++FSL +KLG    LCT+
Sbjct: 1075 FAVLVTDDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/973 (49%), Positives = 638/973 (65%), Gaps = 76/973 (7%)

Query: 250  KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309
            K+S  AL++KLQE+YR IV+QE ELQ+RCSQLT SQTT+LK+LW IYK+N EL++NY  F
Sbjct: 279  KQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMF 338

Query: 310  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369
            ITTALLP+QP  DL+IG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +
Sbjct: 339  ITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIY 398

Query: 370  VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429
            VFIS+S M+ DIP K+SI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KYT+ H
Sbjct: 399  VFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGH 458

Query: 430  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 489
            GKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ RN
Sbjct: 459  GKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRN 518

Query: 490  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFK 549
            + L+EYLKH+E MLLPSFLES +LQ+VVL++F +KFG+ +N  + F+   +F+Q+ +  K
Sbjct: 519  AHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVFVQDSERLK 577

Query: 550  YFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTESS 609
            +FFRH   +A+SH+LQ+VGFG+P+NPFA+LFELPK+L           + ++ S+  ++S
Sbjct: 578  HFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSSTSTQYDTS 637

Query: 610  TGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLN 668
              +                    P    EFF  ID+ +     P  +    W E+L + N
Sbjct: 638  IDDD--------------CAFAAPS---EFFETIDSTKYIYKFPDDIN--IWKESLSYAN 678

Query: 669  MTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMF 728
            +T++KC MIVLRKFLHGPL  ALPH+LPW YF+ +   +   +     + FW+ +++++F
Sbjct: 679  VTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLF 738

Query: 729  PWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCWGT 788
            P++T++TF+NVL+ Y+ +   +N    +                       PE+W CWGT
Sbjct: 739  PFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGT 798

Query: 789  LWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFL 848
            LWFDA+   NT  I++  +    G++D+M +DSP DGI FD  DE+GEKFWKR  R+I L
Sbjct: 799  LWFDAL---NTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILL 855

Query: 849  FREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLESIFDI 908
            FR ++   P+G+            +      R LV+K E   +    +  L     +FD 
Sbjct: 856  FRALALECPVGL----------REISGGRNWRSLVFKFEEPPSEWCDM-YLEPFTLVFDT 904

Query: 909  SEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWYVP- 967
             E  S +N D  A P   +    +I    GY+ L PDY CF++NG+ ++ SLYT   +  
Sbjct: 905  FEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLES 964

Query: 968  ---------NCNNNLETNISYANERENEALFLE---------------CMKSVHPEIAYP 1003
                     N    LE     + ER +    ++               C   V  E   P
Sbjct: 965  SGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLP 1024

Query: 1004 EIDF------KTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDEN 1057
              D         TYFV DAT+WLRH   ++KLA N +L+FAICLTTFQELRFLRKSKDE+
Sbjct: 1025 RGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDES 1084

Query: 1058 VMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMK 1117
            V+EAATR +IT+RQLY E K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDEFVIE+I K
Sbjct: 1085 VLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHK 1144

Query: 1118 AQEKL----ENAKQ------PNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSL 1167
            AQ+K     ++AK       P  +  RFN++ L++DD  M+ KA  + I+  STRF+FS+
Sbjct: 1145 AQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSV 1204

Query: 1168 CTKLGEQRHLCTD 1180
            C +LG  +++CT+
Sbjct: 1205 CNELGHAKNVCTN 1217

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/948 (50%), Positives = 629/948 (66%), Gaps = 57/948 (6%)

Query: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314
              I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IY++NTEL+ NY+ FI TAL
Sbjct: 206  TFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265

Query: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374
            L +QP +DL++GQEI++IY +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS+
Sbjct: 266  LTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325

Query: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434
            S M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY Y  GKLYY
Sbjct: 326  SNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385

Query: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVER-------NNGNL 487
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R       N    
Sbjct: 386  HIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTNNNETAH 445

Query: 488  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDF 547
            +NS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF  KFG D NG ++F+ +DMF QNP+ 
Sbjct: 446  KNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMFCQNPES 505

Query: 548  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTE 607
             +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+LPKYL           +S  ++    
Sbjct: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSSATETPQYR 565

Query: 608  SSTGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPI--LPSMLTNEAWLETLK 665
                + ++                 P+    +F +ID L      +P+ L    WLE+L 
Sbjct: 566  DPFHDKKS-----------------PE---SYFQNIDALSSNFDDIPTNLN--IWLESLN 603

Query: 666  FLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIK 725
             +NMTS++C + VL KFLH P  +ALPH L W+YF+++I  +   +N      FWI  ++
Sbjct: 604  HINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLR 663

Query: 726  RMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGC 785
            R  PW++MV+  NVL+ Y+LDN   +  +                         PEIW C
Sbjct: 664  RTMPWNSMVSLANVLVCYMLDN--LHPFLKKELESFYSFELDDLIEHFNENENLPEIWKC 721

Query: 786  WGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRI 845
            WG+LWFDAI + +   I         G++D++  DSP DGI+FD+KDE GE+FW R+ R 
Sbjct: 722  WGSLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRA 773

Query: 846  IFLFREVSRSFP-LGVIVRHDPLVNC--SSLQSNNILRDLVYKLEPLTN--IRSSVPVLS 900
            I L + +++ FP LG+ V     V C  + +  +  LR   +KL+         +  +  
Sbjct: 774  ISLLKGIAKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDE 833

Query: 901  TLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASL 960
              E+I +I+E    +N DL A P LSV+ G++IF Y GY +L PDY CFDKNG F SA +
Sbjct: 834  LYETI-EINEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFI 892

Query: 961  YTSWYVPNCNNNLETNIS----YANERENEALFLECMKSVHPEIAYP---EIDFKTTYFV 1013
            Y+ W   N  N +  ++S    Y     + +L  E +       AY    E D  T YFV
Sbjct: 893  YSQW--SNVGNGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFV 950

Query: 1014 FDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLY 1073
             DATSWLRH A IFKLA+N +L FAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY
Sbjct: 951  VDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLY 1010

Query: 1074 CEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNISSH 1133
             E K++P+RFTGN+ATH+EENLEFEEQITW+THVDEFVI++I K  +  +  +    + +
Sbjct: 1011 DERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKN 1070

Query: 1134 R-FNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180
            +   + VL++DDD M KKA++K I+T +T+++FSL +KLG    LCT+
Sbjct: 1071 KNKQFAVLVTDDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/977 (49%), Positives = 644/977 (65%), Gaps = 80/977 (8%)

Query: 249  NKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVT 308
            +K S   L++KLQE+Y+ IVKQE ELQERCSQLT SQTT+LK+LW IYK+N EL++NY T
Sbjct: 316  SKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELIDNYFT 375

Query: 309  FITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIT 368
            FITTALLP+QP  DL+IGQEI+E+YRIERRLW+YGTITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 376  FITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVCCQFIV 435

Query: 369  HVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYN 428
            +VFIS+S ++ +IP  +S+ WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY + 
Sbjct: 436  YVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEALKYNFG 495

Query: 429  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLR 488
            HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ R
Sbjct: 496  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHR 555

Query: 489  NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFF 548
             S ++EYLKH+E MLLPSFLE+ + Q VVL++F +KFG   +  N F+   +F+Q+ +  
Sbjct: 556  YSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSA-NFFDPSLIFVQDCERL 614

Query: 549  KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTES 608
            K+FFRH   +A+SHILQ+VGFG+P+NPFA+LFELPK +           + +  S+ ++ 
Sbjct: 615  KHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTASNQSDM 674

Query: 609  STGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPILPSMLTNEAWLETLKFLN 668
            S  ++  G+                   V+FF  +++ +     S   N  W E+L ++N
Sbjct: 675  SIDDTFLGDP------------------VQFFETLNSTKTAYRFSQDLN-IWKESLNYVN 715

Query: 669  MTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMF 728
             TS++C M+VLRKFL+  L  ALPH+LPW YF++++ L+ + + +  SK FWIV I+++F
Sbjct: 716  KTSMRCSMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIF 775

Query: 729  PWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCWGT 788
            PW+++  F+NVL+ Y+ D + +   I +                       PE+W CWGT
Sbjct: 776  PWESITNFLNVLLLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGT 835

Query: 789  LWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFL 848
            LWFD I   N+  +S+  +    G++D+M LD+P DGI FD  DE+GEKFWKR  R+I L
Sbjct: 836  LWFDVI---NSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILL 892

Query: 849  FREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKL-EPLTNIRSSVPVLSTLESIFD 907
            FR ++  FP G           +    ++  + LV+K  EP    +     L +    + 
Sbjct: 893  FRGIAYQFPFGF----------TEFNGSDDWKSLVFKFNEPPAEWKEQ--YLGSFSKEYG 940

Query: 908  ISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWY-- 965
              E+ S +NTDL + P   ++ G +I    GYK+L PDY CF+KNG+ ++ SLYTS    
Sbjct: 941  EFESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSE 1000

Query: 966  ----VPNCNNN-------LETNISYANER---------ENEALFLECMKSVHP------E 999
                VPN + +       LE  +   +ER         E   +  E +K  +       E
Sbjct: 1001 GGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWE 1060

Query: 1000 IAYPEIDFK------TTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKS 1053
               P  D +       TYFV DAT+WLRH   ++KLA + LL+FAICLTTFQELRFLRKS
Sbjct: 1061 QCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLRKS 1120

Query: 1054 KDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIE 1113
            KDE+V+EAATR +IT+RQLY E K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDEFVIE
Sbjct: 1121 KDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIE 1180

Query: 1114 SIMKAQEKL----ENAKQPN------ISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRF 1163
            +I KAQ K     ++AK         I   +FN++ L++DD  M+ KA  + IR  ST+F
Sbjct: 1181 AIDKAQSKFNQLNKDAKASGRESITTIDDGKFNFIALVTDDINMRNKARAQSIRAFSTKF 1240

Query: 1164 VFSLCTKLGEQRHLCTD 1180
            +F++C ++G  + +CTD
Sbjct: 1241 MFAICHEIGLSKKVCTD 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/982 (49%), Positives = 637/982 (64%), Gaps = 93/982 (9%)

Query: 256  LIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTALL 315
            L++KLQE+Y+ IVKQE ELQERCS LT  QTT+LK+LW  YKIN EL++NY+ FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 316  PSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISLS 375
            PSQ    L IGQEIV++YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +VFI+LS
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 376  TMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYYH 435
             M+ D+P KYSI WL+RLGDLSRMAIALYPS F+DWKLSAEHWY E++K+T+ HGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 436  MSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEY 495
            MSTVQQNTLEAFVNLGKSVFC++ F PSPQYMQLVIDNIYQRAF ER++   R + +++Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 496  LKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFKYFFRHG 555
            LKH+E MLLPSFLES +LQNVV+ YF  KFG+ ++G N F+   +FIQ+ +  K+FFRH 
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSG-NFFDPNLIFIQDAERLKHFFRHS 582

Query: 556  PSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTESSTGNSRN 615
              F+QSHILQ+ GFG+PKNPFA+LFEL K+L            S  +    + ST ++  
Sbjct: 583  SLFSQSHILQLCGFGDPKNPFAMLFELSKHLK-----------SRKERKERKKSTKSTSE 631

Query: 616  GNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKC 674
            G+                    +FF+ ID+ + P   P  L    W  +L ++N+TS+KC
Sbjct: 632  GSLDPVEFSSQQQASTE-----DFFSTIDSPKVPYEFP--LDLGVWKRSLHYINVTSMKC 684

Query: 675  GMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDTMV 734
            GMIVLR+FL+GP+  ALPHVLPW+ FIISI ++ +Q+ND   K+FWIV I+R+FPWD+++
Sbjct: 685  GMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLI 744

Query: 735  TFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCWGTLWFDAI 794
            TFMN LI Y +   T N  I                         PE W CWG+LWF+ I
Sbjct: 745  TFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTI 804

Query: 795  CQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFR---- 850
             +K+   +++    +  G+ D + LDSPT+GI FDD DE G K+W+R CR + LF     
Sbjct: 805  SKKSDLDVTT---LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITE 861

Query: 851  -EVSRSFPLGVIVRHDPLVNCSSLQSNNI-LRDLVYKLEPLTNIRSSVPVLSTLESIFDI 908
             E    +  G          C  L       ++LV++    TN + SV +       F  
Sbjct: 862  WEACDGYGHG----------CKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPF 911

Query: 909  SEARSEINTDLHAVPEL-----SVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTS 963
               + EI ++L+    L     S+I G +I +  G+K + PDY CF+KNG+ ++ASLYT 
Sbjct: 912  E--KFEIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTK 969

Query: 964  WYVPNCN----NNLETNISYANER--------------ENEALFLECMKSVHPEIAYPEI 1005
              +   N    ++   N    N R              + E  +LE    ++P+    E+
Sbjct: 970  GPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAF--MNPDFRQREL 1027

Query: 1006 -------------DFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRK 1052
                         D   T+FV DAT+WLRH A I+KLA + +L+FAICLTTFQELRFLRK
Sbjct: 1028 LNRSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRK 1087

Query: 1053 SKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVI 1112
            SKDE+V+EAATR +I +RQLY E K+L LRFTGNVA H+EE+LE EEQ+TW++HVDEFVI
Sbjct: 1088 SKDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVI 1147

Query: 1113 ESIMKAQEK--------LENAK------QPNISSHRFNYVVLISDDDTMKKKAEEKKIRT 1158
            ++I KAQ+K        +E  K      +   S+ RFN+V L++DD  M+ KA++  IRT
Sbjct: 1148 DAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRT 1207

Query: 1159 LSTRFVFSLCTKLGEQRHLCTD 1180
             STRFVF++C +LG +  +CT+
Sbjct: 1208 FSTRFVFAICRELGRETGVCTN 1229

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  900 bits (2325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1044 (45%), Positives = 638/1044 (61%), Gaps = 136/1044 (13%)

Query: 246  PANNKRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNN 305
            P    RS  ALI KLQ++Y+ I+ QE+ELQ  CS +T+SQTT+LK +W +YKIN ELVNN
Sbjct: 266  PTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNN 325

Query: 306  YVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 365
            YV FITTALLPSQ   DL+IGQEI+++Y+IERRLWVYGTITFLDVLK+FSNFMDPE+CCQ
Sbjct: 326  YVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQ 385

Query: 366  FITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKY 425
            FI HVFIS++ M   IP K+SI W  RLGDLSRMA ALYP    DWKLSAE+WY EAMKY
Sbjct: 386  FIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKY 445

Query: 426  TYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNG 485
            TY  GKLYYHM+TVQQN+L AF+NLGKSVFC++ F P+ QY+QLVIDNIYQRA++ R   
Sbjct: 446  TYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEE 505

Query: 486  NLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNP 545
            +  N  +++YLKH+E M+LP+F+E+ +LQ +   YF EKFG D  G N F+   MF+QN 
Sbjct: 506  SSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNL 565

Query: 546  DFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSV 605
            +  K++FRH P FAQ+HILQ+VG+G   N FA+L+ELPK++           +     ++
Sbjct: 566  ESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNM 625

Query: 606  TESSTGNSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETL 664
            +  +     +GN                  + E+FN ++ + +   LP  +  + W+++L
Sbjct: 626  SIDTLSFQVSGNEIHD--------------VGEYFNSLENIDKEFTLPPNV--DIWIQSL 669

Query: 665  KFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVII 724
            ++ N T + CGM+VL+KFL GP   ALPH+LPW+YF+IS+  K   L D  S+ FW + I
Sbjct: 670  QYTNTTGIFCGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFI 729

Query: 725  KRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWG 784
            +R+FPW+T++ F+NVLIA+L DN  S S++  LC                     PE+W 
Sbjct: 730  RRIFPWNTIINFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWN 789

Query: 785  CWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACR 844
            CWG+LWFD I  K+  S S     +  GI+D   LD+P DGI+FD++D+NG KFWKRACR
Sbjct: 790  CWGSLWFDTIKNKSETSYSG---LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACR 846

Query: 845  IIFLFREVSRSFPLGVIVRHDPLVNCSSLQS--NNILR--------DLVYKLEPLTNIRS 894
            I+FLF+  +  F  G+      L N +SL S   NI          D ++K +P  ++  
Sbjct: 847  ILFLFKGYAEKFDQGL-----RLTNINSLNSEEENIFTKKQEKRNIDFLFKFDPTYDL-- 899

Query: 895  SVPVLSTLESIFDIS----------EARSEINTDLHAVPELSVINGDNIFHYVGYKKLRP 944
             +P+       F +           E+ SE N  L AVP+LSVI+G++IF YVGYKKL P
Sbjct: 900  -LPIDEASNKYFQVYSLFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLP 958

Query: 945  DYTCFDKNGEFLSASLYTSWYVPNCNNN-----LETNISY------------ANERENEA 987
             Y  +DKNG     ++Y++W   N   N     +E   S+              E+   A
Sbjct: 959  CYYYYDKNGNVNKGAIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFA 1018

Query: 988  LFLECMKSVHPEIAYPEID-------------------------------FKT------- 1009
             +LEC +S        E++                               FKT       
Sbjct: 1019 KYLECDESQESSDHLAEVEREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEM 1078

Query: 1010 ------TYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAAT 1063
                  TYF+FDAT+WLRH A I+K+A + LL F ICLTTFQELRFLR+S+DENVMEAAT
Sbjct: 1079 RVAYYSTYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAAT 1138

Query: 1064 RGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKL- 1122
            R +I IR LY   KV+PLRF G +A+HIEE+LEFEEQITWR+HV+EFVIE++ K+QE   
Sbjct: 1139 RAVIVIRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGM 1198

Query: 1123 ------ENAK--------------------QPNISSHRFNYVVLISDDDTMKKKAEEKKI 1156
                  E+AK                      N S++     VL++DD  M  KA+E+ I
Sbjct: 1199 FDELHNESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGI 1258

Query: 1157 RTLSTRFVFSLCTKLGEQRHLCTD 1180
            RT STRF+FS+C++LG +  +CT+
Sbjct: 1259 RTCSTRFIFSICSQLGMKYGICTN 1282

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1281

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/726 (58%), Positives = 520/726 (71%), Gaps = 24/726 (3%)

Query: 250 KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309
           ++S  AL+QKLQ++Y+VIVKQEIELQERCSQLT SQTTELK+LWTIYKINT+L+NNY TF
Sbjct: 285 RKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTF 344

Query: 310 ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369
           ITTALLPSQP  D++IG+EIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFITH
Sbjct: 345 ITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 404

Query: 370 VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429
           VFISLS ++ DIP K++I WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+TY+H
Sbjct: 405 VFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 464

Query: 430 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERN-NGNLR 488
           GKLYYHMSTVQQNTLEAFVNLGKSVFCQ+TFTPS QYMQLVIDNIYQR FV+RN  GN R
Sbjct: 465 GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYR 524

Query: 489 NSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFF 548
           N  LI+YLKHSE MLLPSFL S DLQ VVL+YF ++FGID +  NIF+ +DMF Q P   
Sbjct: 525 NPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCL 584

Query: 549 KYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXX---XXXXXXXXXTSNNDSSV 605
           ++FFRH P+FA+SHILQ+VGFG PKNPFA+LFELPKYL              TS  D S 
Sbjct: 585 RFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVSS 644

Query: 606 TESSTGNSR---NGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPI-LPSMLTNEAWL 661
           T   T + +   N N               P    E+ ++I+TL+  I  P + T   W+
Sbjct: 645 TAPKTVDDQATDNVNEGTNDDHELTATLSGP----EYLDNIETLKYAIETPDICT---WI 697

Query: 662 ETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWI 721
           ++L F+NMTSLKC MIVL+KFLHGPL +ALPH LPW  FII+  +K N+L +  + +FW 
Sbjct: 698 KSLDFINMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWR 757

Query: 722 VIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPE 781
           +++KR+FPWDT+ +F+NVL+AY+LDN  + +II +LC                     PE
Sbjct: 758 ILMKRIFPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPE 817

Query: 782 IWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKR 841
           +W CWGTLW+DAIC KN+      D F   GI D+M LD P DGI FD +DE G KFWKR
Sbjct: 818 VWKCWGTLWYDAICNKNS---VDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKR 874

Query: 842 ACRIIFLFREVSRSFPLGVIVRHDPLVNCSSLQ-SNNILRDLVYKLEPLTNIRSSVPVLS 900
           A R+IFLF+ +S+ F  G+ + H+  V C + + +++ LR   +KLE         P  S
Sbjct: 875 ALRVIFLFKGISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLESYDE-----PTSS 929

Query: 901 TLESIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASL 960
                  + E  S IN D  A P LSV+ G+NIF Y+GY+ L  D   FDKNGE +S+S+
Sbjct: 930 KFNEFIPLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSI 989

Query: 961 YTSWYV 966
           YTSW +
Sbjct: 990 YTSWMI 995

 Score =  243 bits (621), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 118/195 (60%), Positives = 149/195 (76%), Gaps = 13/195 (6%)

Query: 999  EIAYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENV 1058
            E +  E+D   T+F+FDATSWLRH A I+K+A N +L+F +CLTTFQELRFLRKSKDENV
Sbjct: 1087 ESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRKSKDENV 1146

Query: 1059 MEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKA 1118
            +EAA R IIT+RQLY E+++LPLRFTGNVA  IEE+LEFEEQITWR+HVDEFVIE++MKA
Sbjct: 1147 VEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVIEAVMKA 1206

Query: 1119 QEKLENA---KQPN----------ISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVF 1165
            Q+K   A   KQP           +   RF+YV L+++D  MK+KA+++ I+T ST FVF
Sbjct: 1207 QDKFTTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVF 1266

Query: 1166 SLCTKLGEQRHLCTD 1180
            SLC+KLG    LCT+
Sbjct: 1267 SLCSKLGMSLDLCTN 1281

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  526 bits (1355), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 269/380 (70%), Positives = 302/380 (79%), Gaps = 43/380 (11%)

Query: 250 KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309
           K S  ALIQKLQ++Y++IVKQEI+LQ+RCSQLT SQTT+LK+LWTIYKIN +L+NNY+ F
Sbjct: 392 KTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINF 451

Query: 310 ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369
           IT ALLP+Q  +DL IG+EI+EIYRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQFI+H
Sbjct: 452 ITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISH 511

Query: 370 VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429
           VFI++S +++DIP KYSI WLQRLGDLSRMAIALYPS FIDWKLSAEHWY EAMK+TY+H
Sbjct: 512 VFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSH 571

Query: 430 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 489
           GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPS QYMQLVIDNIYQRAFVERNNGN RN
Sbjct: 572 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNHRN 631

Query: 490 SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGI---------------------- 527
             LIEYLKH+E MLLP+FLES DLQNVVL YF  KFGI                      
Sbjct: 632 LQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGANVN 691

Query: 528 ---------------------DANGCNIFNCEDMFIQNPDFFKYFFRHGPSFAQSHILQI 566
                                     +IF  +DMFIQNPD  KYFFRH  +FAQSHILQ+
Sbjct: 692 IPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHILQL 751

Query: 567 VGFGEPKNPFAILFELPKYL 586
           VGFG+PKNPFA+LFELPK+L
Sbjct: 752 VGFGDPKNPFALLFELPKFL 771

 Score =  398 bits (1023), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 235/580 (40%), Positives = 327/580 (56%), Gaps = 96/580 (16%)

Query: 638  EFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLP 696
            EFF +ID L+ P  +P  +  E WLE+LK +N+ SLKC +IVL+KFL+GP+ +ALPH+L 
Sbjct: 867  EFFENIDLLQFPYKIPQTI--EIWLESLKNINLISLKCSIIVLKKFLNGPILIALPHLLT 924

Query: 697  WIYFIISICLK-SNQLNDPISKEFWIVIIKRMFPWDTMVTFMNVLIAYLLDNETSNSI-- 753
            WI+FIISI LK  N + D  SK FW   +K + PW+++V F+NVL+ YLLDN    +   
Sbjct: 925  WIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDNINDENFKL 984

Query: 754  ---IGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCWGTLWFDAICQKNTHS--------- 801
               + +                       PEIW CWGTLWFD IC KN +S         
Sbjct: 985  IISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSDTTFLNQNN 1044

Query: 802  ------------------ISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRAC 843
                                ++   + +GI D+  LD P DGI F   DE+G  F+KR+ 
Sbjct: 1045 NNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDGINFYKRSI 1104

Query: 844  RIIFLFREVSRSFP-LGVIVRHDPLVNC--SSLQSNNILRDLVYKLEPL----------- 889
            R+IFL + +  +FP LG+ + H+    C  + +  N IL +  +KL  L           
Sbjct: 1105 RLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDPSLIIIPQT 1164

Query: 890  ------------TNIRSSVPVLSTLESIFDISEARSEINTDLHAVPELSVING-DNIFHY 936
                         ++  +  +LS +   F I E   EIN +L   P LS++ G +NIF+Y
Sbjct: 1165 EQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILGGNENIFNY 1224

Query: 937  VGYKKLRPDYTCFDKNGEFLSASLYTSW------------------YVPNCNNNLETNIS 978
            +GYK+L  +   F +NGE +S S+Y+SW                  ++ N +     N++
Sbjct: 1225 LGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDSTMKNENVT 1284

Query: 979  YANERENEALFLECMK-SVHPEIAYPEIDFKT--------------TYFVFDATSWLRHS 1023
              +    +A F E MK S H +++    + +T              T+FVFDATSWLRH 
Sbjct: 1285 VGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFVFDATSWLRHF 1344

Query: 1024 ARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRF 1083
            A I+KL++N  L+FA+CLTTFQELRFLRKSKD NV+EA+TR IIT+RQLY E K+LPLRF
Sbjct: 1345 AHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLYKEGKLLPLRF 1404

Query: 1084 TGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLE 1123
            TGNVAT IEE+LEFEEQITWR+HVDEFVIE+I+++QE+ +
Sbjct: 1405 TGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFK 1444

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  453 bits (1166), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 224/413 (54%), Positives = 284/413 (68%), Gaps = 76/413 (18%)

Query: 250 KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309
           K+S   LIQKLQ +Y++IV QE+ELQ++C++L+ SQ+T+LK LW+IYK+N +L+NNY+ F
Sbjct: 263 KKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILF 322

Query: 310 ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369
           I T+L PSQ  +D +IG+EI+EIY+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFITH
Sbjct: 323 ILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITH 382

Query: 370 VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429
           VF S+S MISD+P  +   W QRLGDLSRMAIALYPS+FIDWKLS+E+WY E+MK+T++H
Sbjct: 383 VFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSH 442

Query: 430 GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN----- 484
           GKLYYH+STVQQN LEAFVNLGKSVFC +TF PS +YMQLVIDNIYQRAF+ERN+     
Sbjct: 443 GKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSS 502

Query: 485 ------------------GNLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFG 526
                              N +   LIEYLKHSE MLLP+FLE+  L+ VVL+YF   FG
Sbjct: 503 NNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562

Query: 527 ----------------------------------------------------IDANGCNI 534
                                                               +  N  N+
Sbjct: 563 KIAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINL 622

Query: 535 FNCEDMFIQ-NPDFFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYL 586
           FN  ++F Q N D  KYFF++  +FA+SHILQ++GFG+PKNPFA+LF+LPKYL
Sbjct: 623 FNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675

 Score =  259 bits (662), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 156/332 (46%), Positives = 195/332 (58%), Gaps = 71/332 (21%)

Query: 910  EARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWYVPNC 969
            E  S  NTDL+  P LS+I  +++F Y GYK+  PD++ FDKNGE +S SLYTS  +   
Sbjct: 1151 EKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDTI 1210

Query: 970  NN-----NLETNISYANER------------------------ENEALFLECMKSVHPEI 1000
            N      N+    + AN+                         +N+ LFL   K +  +I
Sbjct: 1211 NGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFL-MEKEIFNKI 1269

Query: 1001 AYPE-----------------IDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTT 1043
              P+                 I F  TYFV DATSWLRH A ++KLA N +L+FAICLTT
Sbjct: 1270 LDPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTT 1329

Query: 1044 FQELRFLRKSKDENVMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITW 1103
            FQELRFLRKSKDENVMEAATR IIT+RQLY E ++LPLRFTGN+ATHIEE+LEFEEQITW
Sbjct: 1330 FQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITW 1389

Query: 1104 RTHVDEFVIESIMKAQEKL---ENAKQPNISSHRFNY-----------------VVLISD 1143
            R+HVDEFVIE+I +AQ K     N +  N++S   N                   VL++D
Sbjct: 1390 RSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVLVTD 1449

Query: 1144 DDTMKKKAEEKK----IRTLSTRFVFSLCTKL 1171
            D +M KK +E+K    I T ST+FVFSLC  L
Sbjct: 1450 DISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  202 bits (514), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 104/257 (40%), Positives = 160/257 (62%), Gaps = 10/257 (3%)

Query: 638  EFFNDIDTLRRPI-LPSMLTNEAWLETLKFLNMTSLKCGMIVLRKFLHGPLGVALPHVLP 696
            +FFN++++L+    LP+ L  E W E+LK++N+ SL C +IVL+KFL+GPL V+LPH+LP
Sbjct: 790  DFFNNLESLKLSFFLPNSL--EIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHMLP 847

Query: 697  WIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWDTMVTFMNVLIAYLLDNETSNSIIGD 756
            W YFIIS+ L+   L +  S+ FW+  I+++FPW+++V+++NV+I+ LLDN   NS+I  
Sbjct: 848  WSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMITK 907

Query: 757  LCXXXXXXXXXXXXXX-XXXXXXXPEIWGCWGTLWFDAICQKNTHSISSEDNFQEIGIRD 815
            L                       PE+W C+G+LWFD I +   + I S D  + I ++D
Sbjct: 908  LINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAEN--YQIYSRDCSKNISMKD 965

Query: 816  YMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFREVSRSFP--LGVIVRHDPLVNC--S 871
               L+ P DG+ FD+ +ENG  FWKR+CR+IFLF+ +   F    G+ +  +  V C  S
Sbjct: 966  TKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSNTSVYCNRS 1025

Query: 872  SLQSNNILRDLVYKLEP 888
             + +N+ILR   +KL P
Sbjct: 1026 DIPNNHILRTFAFKLLP 1042

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  141 bits (356), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 200/934 (21%), Positives = 383/934 (41%), Gaps = 177/934 (18%)

Query: 292  LWTIYKINTELVNNYVTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVL 351
            L  ++K++T++V+ Y  FI  AL  +    DL+ G+E V   R+  RL  +     L+++
Sbjct: 144  LMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEII 203

Query: 352  KNFSNFM----------DPEVCCQFITHVFISLSTMISDIPSKYSITWLQRLGDLSRMAI 401
            +N+ N M          + +   +FI    I ++ M+ +IP K+   W   +GDL+R+ +
Sbjct: 204  ENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLM 263

Query: 402  ALYPSSFIDWKLSAEHWY-----TEAMKYTYNHGK----------LYYHMSTVQQNTLEA 446
             L       ++L++ H Y       A+ Y+ N+GK           Y+++S VQ ++L  
Sbjct: 264  LLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLAR 323

Query: 447  FVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLPS 506
             V L K +  + T        QL ID I  +   ++   NL+ S+    +      LL  
Sbjct: 324  IVTLSKCLCIENTNVYQKSMAQLAIDKIISKLLNKQ--VNLKQSMGGTTILMKYFTLLSL 381

Query: 507  FLESPD------LQNVVLSYFIEKFGIDANGCNI--------FNCEDMFIQNP-DFFKYF 551
            F  S        ++   L YF  +F   AN  ++         NC+  + Q   ++  ++
Sbjct: 382  FFGSTSSSQLSGMERSSLHYFWNEF---ANEYHLNYSSLRKPVNCK--YRQKEINYSMFY 436

Query: 552  FRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLXXXXXXXXXXXTSNNDSSVTESSTG 611
            F + P F+   I++ +   +  NPF  +++                 S++D  +   S  
Sbjct: 437  FNNAPLFSLISIVETIIMNKKLNPFFCVYK-----------------SSDDFEIKSVSLS 479

Query: 612  NSRNGNXXXXXXXXXXXXXXXPDLLVEFFNDIDTLRRPILPSMLTNEAWLETLKFLNMTS 671
            N +                    +L+E  +D                  L + K L    
Sbjct: 480  NWK--------------------ILIEQMDD----------------TLLHSNKLLFKKF 503

Query: 672  LKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMFPWD 731
            L   + + + F+       LP +L    F IS+  +   + D      W  +++ + PWD
Sbjct: 504  LMLNVAISQPFI-------LPWLL----FYISVASEVANVTDRHVLLLWKDLLQNLLPWD 552

Query: 732  TMVTFMNVLIAYLLDNETSNSIIGDLCXXXXXXXXXXXXXXXXXXXXXPEIWGCWGTLWF 791
             +VT++N  I  +  +  ++  +  L                       EI  C G +WF
Sbjct: 553  DIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWF 612

Query: 792  DAICQK-NTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFLFR 850
            D++  K    SI++ ++  +     + + ++  D +I+DD D+   K W RA  II L +
Sbjct: 613  DSLASKIKQASITTNESLMK-----FKSYNASEDSLIYDDDDQVYTKMWTRALLIILLIK 667

Query: 851  EVSRSFP--LGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLESIFDI 908
             V   +P  + V +R   L N S ++++          + LTN           + +FD 
Sbjct: 668  NVINDYPELIDVSIRGQSLTNSSCIKNS----------DSLTN-----------DYLFDW 706

Query: 909  SEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFL-SASLYTSW-YV 966
                 E+N +   + + ++   + IF +       PD+  FDKNG+     SL +++ Y+
Sbjct: 707  G---FELNNNNAVIIDDTLHGRNRIFKF----SYIPDFQDFDKNGDITWGYSLISNYDYI 759

Query: 967  PNCNNNLETNISYANERENEALFLECMKSVHPEIAY-PEIDFKTTYFVFDATSWLRHSAR 1025
             + + N E + ++        L      S      Y P+++    YF+ D  +WL+HS +
Sbjct: 760  YSNDFNSEEDGNFFQRYSRRLLSAHNDYSEDKSKKYLPKLE--NNYFMVDTLAWLKHSNK 817

Query: 1026 IFKLAQNRLLRFAICLTTFQELRFLRK-SKDENVMEAATRGIITIRQLYCEDKVLPLRFT 1084
            + +      ++  + ++   +L  L+  S+ E+V  +A+R +I I  LY  +++  L+  
Sbjct: 818  LKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAMNQINILK-- 875

Query: 1085 GNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLEN---------AKQPNISSHRF 1135
                       EFE  I+    +       I+    K +N          +Q N+   R 
Sbjct: 876  -----------EFESPIS--KALKNIDGSQILNFNGKFKNDLLTKENGPGQQLNMIELRM 922

Query: 1136 NYVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCT 1169
            + VV++SDD       ++K    +ST+ +FS+ +
Sbjct: 923  DNVVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956

>TDEL0D05190 Chr4 complement(943314..944225) [912 bp, 303 aa] {ON}
            Anc_3.105 YBR147W
          Length = 303

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 74/166 (44%), Gaps = 22/166 (13%)

Query: 877  NILRDLVYKLEPLTNIRSSVP-----VLSTLESIFDISEARSEI--NTDLH-AVPELSVI 928
            N+L+D+  + +PL + +SS P     V   +ES  D+ E+  E+     LH +V  LSVI
Sbjct: 114  NVLQDVFNENQPLLHAQSSAPLSRDNVGGIIESADDLLESEREVVKKNYLHDSVIVLSVI 173

Query: 929  NGDNIFHYVGY----KKLRPDYTCFDKN-----GEFLSASLYTSWYVPNCNNNLETNISY 979
                +  Y+ Y     + +PD    + N       ++SA LY    VP    N E     
Sbjct: 174  LAGFLSWYISYCQNPNRSKPDGPSLELNILAQVFGYISAVLYLGSRVPQILLNFERQ--- 230

Query: 980  ANERENEALFL-ECMKSVHPEIAYPEIDFKTTYFVFDATSWLRHSA 1024
            + E  +   FL  C+ +    I+   I F   Y + +A SWL  S+
Sbjct: 231  SCEGISFLFFLFACLGNTTFIISVLAISFDPQYLLLNA-SWLVGSS 275

>ZYRO0A05632g Chr1 (457286..458269) [984 bp, 327 aa] {ON} similar to
            uniprot|P26449 Saccharomyces cerevisiae YOR026W BUB3
            Kinetochore checkpoint WD40 repeat protein that localizes
            to kinetochores during prophase and metaphase delays
            anaphase in the presence of unattached kinetochores forms
            complexes with Mad1p-Bub1p and with Cdc20p binds Mad2p
            and Mad3p
          Length = 327

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 44/106 (41%), Gaps = 13/106 (12%)

Query: 906  FDISEARSEINTDL-HAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSW 964
            +D  E R  +NT L HA P LS      +F   GYK   P+  C D  G+ L   L    
Sbjct: 43   YDEQERRVSLNTVLRHAFPLLSCCV---LFPSGGYK---PEIYCGDVQGQVLLVDLELGK 96

Query: 965  YVPNCNNNLETNISYANERENEAL------FLECMKSVHPEIAYPE 1004
            ++P   N  +  IS     +N+ +      FL+ +      + Y +
Sbjct: 97   FIPMGGNTAQLGISSLCSYKNQVICGSWDGFLQVIDCRSQNVVYQQ 142

>TBLA0J00940 Chr10 complement(209827..212592) [2766 bp, 921 aa] {ON}
           Anc_5.655 YOR054C
          Length = 921

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 10  IRLSENENTRSIFLSISQPQRPSNISSFPRLVHNATT 46
           ++L+ N NT  + L+I QPQ+ + +SS P    NA+T
Sbjct: 624 VKLNNNPNTNGVLLTIEQPQQLAPLSSQPSNTSNAST 660

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 122,129,865
Number of extensions: 5402405
Number of successful extensions: 23201
Number of sequences better than 10.0: 292
Number of HSP's gapped: 24125
Number of HSP's successfully gapped: 331
Length of query: 1180
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1059
Effective length of database: 39,606,813
Effective search space: 41943614967
Effective search space used: 41943614967
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)