Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_11.3595.705ON88884474e-59
YKR095W-A (PCC1)5.705ON88883911e-50
Skud_11.3355.705ON94943633e-46
Suva_11.3325.705ON1111113558e-45
Kpol_YGOB_1043.725.705ON88883086e-38
NCAS0A031805.705ON88873025e-37
TDEL0B021505.705ON91823001e-36
TBLA0G010305.705ON89872852e-34
KAFR0H001905.705ON82822818e-34
Kwal_YGOB_Anc_5.7055.705ON88882783e-33
KLTH0E00990g5.705ON89882774e-33
SAKL0E14982g5.705ON89882731e-32
NDAI0E050605.705ON86832704e-32
KNAG0C066205.705ON101892602e-30
ZYRO0B16368g5.705ON85792565e-30
KLLA0A00539g5.705ON87862462e-28
TPHA0E002005.705ON85742453e-28
Ecym_40165.705ON125742292e-25
AFR289W5.705ON81771941e-20
CAGL0G02535g5.705ON140541772e-17
AGR088W8.260ON288740631.3
TBLA0F031103.381ON65567622.0
KNAG0A042408.455ON69443612.8
KLLA0B14619gna 1ON53148604.3
Skud_2.2493.381ON66567587.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_11.359
         (88 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...   176   4e-59
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...   155   1e-50
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...   144   3e-46
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...   141   8e-45
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...   123   6e-38
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...   120   5e-37
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...   120   1e-36
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...   114   2e-34
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...   112   8e-34
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...   111   3e-33
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...   111   4e-33
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...   109   1e-32
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...   108   4e-32
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...   104   2e-30
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...   103   5e-30
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...    99   2e-28
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...    99   3e-28
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    93   2e-25
AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...    79   1e-20
CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)...    73   2e-17
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...    29   1.3  
TBLA0F03110 Chr6 complement(755461..757428) [1968 bp, 655 aa] {O...    28   2.0  
KNAG0A04240 Chr1 complement(577186..579270) [2085 bp, 694 aa] {O...    28   2.8  
KLLA0B14619g Chr2 complement(1284933..1286528) [1596 bp, 531 aa]...    28   4.3  
Skud_2.249 Chr2 complement(448964..450961) [1998 bp, 665 aa] {ON...    27   7.9  

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score =  176 bits (447), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60
          MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS
Sbjct: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60

Query: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88
          IDDRVLRVGVSSVIDSIKTVVEAMDELS
Sbjct: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score =  155 bits (391), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 83/88 (94%)

Query: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60
          M+SKRE  L HTLELK+PF+TE+QA IAT+VLSPDPILKPQDFQ+DYSSEKNVMLVQFRS
Sbjct: 1  MTSKREKSLDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRS 60

Query: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88
          IDDRVLRVGVSS+IDSIKT+VEAMD LS
Sbjct: 61 IDDRVLRVGVSSIIDSIKTIVEAMDVLS 88

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score =  144 bits (363), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 72/94 (76%), Positives = 83/94 (88%), Gaps = 6/94 (6%)

Query: 1  MSSKREMPLHHTL------ELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVM 54
          M+SKREM L +TL      EL++PF+TE QA IAT+VLSPDPILKPQDFQ+DYSSEKN+M
Sbjct: 1  MTSKREMSLDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIM 60

Query: 55 LVQFRSIDDRVLRVGVSSVIDSIKTVVEAMDELS 88
          LV+FRSIDDRVLRVGVSSVIDSIKT+VE +DELS
Sbjct: 61 LVRFRSIDDRVLRVGVSSVIDSIKTIVETIDELS 94

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score =  141 bits (355), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 74/111 (66%), Positives = 81/111 (72%), Gaps = 23/111 (20%)

Query: 1   MSSKREMPLHHTL-----------------------ELKVPFKTEQQAVIATRVLSPDPI 37
           M S+REMPL HTL                       ELK+PF+TE+QA IATRVLSPDPI
Sbjct: 1   MKSQREMPLDHTLVERIFKGRPSEVFTNYGMFQNTRELKIPFETEKQANIATRVLSPDPI 60

Query: 38  LKPQDFQIDYSSEKNVMLVQFRSIDDRVLRVGVSSVIDSIKTVVEAMDELS 88
           LKPQDFQ DYSSE NVML +FRSIDDRVLRVGVSSVIDSIKT++E MDELS
Sbjct: 61  LKPQDFQADYSSENNVMLARFRSIDDRVLRVGVSSVIDSIKTIIETMDELS 111

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  123 bits (308), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 55/88 (62%), Positives = 75/88 (85%)

Query: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60
          M ++R + + HTL+ ++PF+T +QA IA +VL PDPILKPQDFQ+ YSS  N+++++F+S
Sbjct: 1  MKTQRTIEMDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKS 60

Query: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88
          IDDRVLRVGVSSVIDS+KT++E MDELS
Sbjct: 61 IDDRVLRVGVSSVIDSVKTIIETMDELS 88

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score =  120 bits (302), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%)

Query: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60
          M + REM L + L L++PF T +QA IA +VL PDPILKPQDFQ++Y S+ N++ V FR 
Sbjct: 1  MKNGREMSLDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRG 60

Query: 61 IDDRVLRVGVSSVIDSIKTVVEAMDEL 87
          IDDRVLRVGVSSVIDSIKT++E +DEL
Sbjct: 61 IDDRVLRVGVSSVIDSIKTIIETIDEL 87

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 71/82 (86%)

Query: 7  MPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVL 66
          M L+H+L+L++PF+T  QA IA +VL PDPILKPQDFQ+DY++  NV++V F+SIDDRVL
Sbjct: 1  MSLNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVL 60

Query: 67 RVGVSSVIDSIKTVVEAMDELS 88
          RVGVSSVIDSIKT+VE +DEL 
Sbjct: 61 RVGVSSVIDSIKTIVETIDELG 82

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score =  114 bits (285), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 71/87 (81%), Gaps = 2/87 (2%)

Query: 3  SKRE--MPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60
          SKR+  M + HTL L +PF T +QA IA +VL PDPIL+PQDFQ+ Y+S+ N ++++F+S
Sbjct: 2  SKRDNNMQMEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQS 61

Query: 61 IDDRVLRVGVSSVIDSIKTVVEAMDEL 87
          IDDRVLRVGVSSVIDS+KT++E  DEL
Sbjct: 62 IDDRVLRVGVSSVIDSVKTIIETFDEL 88

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score =  112 bits (281), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 66/82 (80%)

Query: 7  MPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVL 66
          M L HTL+L++PF+  +QA IA  VL PDPIL+PQDFQ+ Y +  NV + +F SIDDRVL
Sbjct: 1  MNLDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVL 60

Query: 67 RVGVSSVIDSIKTVVEAMDELS 88
          RVGVS+VIDS+KT++E MDELS
Sbjct: 61 RVGVSNVIDSLKTIIETMDELS 82

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score =  111 bits (278), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 67/88 (76%)

Query: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60
          M S R + L +TL L+VPF+ ++QA  A +VL PDPILKPQDF ++Y+S  N + V F  
Sbjct: 1  MKSSRPLNLAYTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEG 60

Query: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88
          +DDRVLRVGVSSVI+SIKT+VE +DE S
Sbjct: 61 VDDRVLRVGVSSVIESIKTIVETIDEFS 88

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score =  111 bits (277), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 67/88 (76%)

Query: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60
          M   R+  L +TL L+VPFKT +QA  A +VL PDPILKPQDF ++YSS+ + + V F  
Sbjct: 1  MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEG 60

Query: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88
          +DDRVLRVGVSSVI+SIKT++E +DE S
Sbjct: 61 VDDRVLRVGVSSVIESIKTIIETIDEFS 88

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score =  109 bits (273), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 49/88 (55%), Positives = 67/88 (76%)

Query: 1  MSSKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRS 60
          M + R+M L H L L++P +T  QA+IA + L PDP+LKP+DFQ++YS+    + V F+S
Sbjct: 1  MKNTRQMSLDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKS 60

Query: 61 IDDRVLRVGVSSVIDSIKTVVEAMDELS 88
          IDDRVLRVGVSSVI+S+KT++E MDE  
Sbjct: 61 IDDRVLRVGVSSVIESVKTIIETMDEFG 88

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score =  108 bits (270), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 52/83 (62%), Positives = 69/83 (83%), Gaps = 4/83 (4%)

Query: 9  LHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDY----SSEKNVMLVQFRSIDDR 64
          L +TLE+++PF  E+ A IA +VLSPDPILKP+DFQ++Y    +   NV+LV+F+SID+R
Sbjct: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63

Query: 65 VLRVGVSSVIDSIKTVVEAMDEL 87
          VLRVGVSSV+DSIKT++E MDEL
Sbjct: 64 VLRVGVSSVLDSIKTILETMDEL 86

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score =  104 bits (260), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 68/89 (76%), Gaps = 2/89 (2%)

Query: 1  MSSKREMP--LHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQF 58
          M++K   P  L HTL L VPF+T +QA+IA++VL PDPILKPQDF + Y+++   +  +F
Sbjct: 1  MTTKTARPAALDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARF 60

Query: 59 RSIDDRVLRVGVSSVIDSIKTVVEAMDEL 87
             D RVLRVGVSSVIDS+KT++E++DEL
Sbjct: 61 CGRDARVLRVGVSSVIDSLKTIIESLDEL 89

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score =  103 bits (256), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 45/79 (56%), Positives = 64/79 (81%)

Query: 9  LHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRV 68
          L H L L +PF  ++ + +A +VL PDPIL+P+DFQ++Y S+ N++ + F+S+DDRVLRV
Sbjct: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63

Query: 69 GVSSVIDSIKTVVEAMDEL 87
          GVSSVIDS+KT+VE +DEL
Sbjct: 64 GVSSVIDSVKTIVETIDEL 82

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score = 99.4 bits (246), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 67/86 (77%)

Query: 3  SKREMPLHHTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSID 62
          +K +    H+L L++PF++ +QA +A +VL PDPI+KP+DFQ+ YS++   ++  F S+D
Sbjct: 2  NKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVD 61

Query: 63 DRVLRVGVSSVIDSIKTVVEAMDELS 88
          +R+LRVGV+SVI+SIKT+VE +DEL 
Sbjct: 62 ERILRVGVNSVIESIKTIVETIDELC 87

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score = 99.0 bits (245), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 64/74 (86%)

Query: 14 ELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRVGVSSV 73
          +L +PF+T +QA IA +VL PDP L+P++F++DYSS+ + ++V F+S+DDRVLRVGVS+V
Sbjct: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68

Query: 74 IDSIKTVVEAMDEL 87
          IDSIKT++E +DEL
Sbjct: 69 IDSIKTIIETIDEL 82

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 92.8 bits (229), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 57/74 (77%)

Query: 15  LKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRVGVSSVI 74
           L+VPF+  +QA IA  VL  DP+L+P+DF++DY+ +   +LV F SID R LRVGVSSVI
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 75  DSIKTVVEAMDELS 88
           +SIKTVVE MDE S
Sbjct: 111 ESIKTVVETMDEFS 124

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score = 79.3 bits (194), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 55/77 (71%)

Query: 11 HTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRVGV 70
          HTL L VPF++ + A IA R L+PDP+L+P++  + ++S+   + ++  +ID RVLRV  
Sbjct: 3  HTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRVAT 62

Query: 71 SSVIDSIKTVVEAMDEL 87
          +S+ +++KTVVE  DEL
Sbjct: 63 NSIFEALKTVVETADEL 79

>CAGL0G02535g Chr7 (230231..230268,230360..230570,230769..230942)
          [423 bp, 140 aa] {ON} similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein of
          unknown function
          Length = 140

 Score = 72.8 bits (177), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 44/54 (81%)

Query: 14 ELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLR 67
          +L VPF+T + A+IA RVL PDPIL+P+DFQ++Y ++  V+ + F++IDDRVLR
Sbjct: 30 DLHVPFETARDALIAQRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLR 83

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score = 28.9 bits (63), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 29   TRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRV 68
            TR   PD I     F++D+S E    L++ R IDDR+ +V
Sbjct: 1879 TRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKV 1918

>TBLA0F03110 Chr6 complement(755461..757428) [1968 bp, 655 aa] {ON}
           Anc_3.381 YPR081C
          Length = 655

 Score = 28.5 bits (62), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 1/67 (1%)

Query: 15  LKVPFKTEQQAV-IATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRVGVSSV 73
           +K+PFK +   V I  R    D +  P    ID+ S K+  +        + +R  +S +
Sbjct: 570 IKIPFKIDDSGVSIGKRYARNDELGTPFGITIDFDSLKDESVTLRERDSTKQIRGSISDI 629

Query: 74  IDSIKTV 80
           I SIK +
Sbjct: 630 IQSIKDI 636

>KNAG0A04240 Chr1 complement(577186..579270) [2085 bp, 694 aa] {ON}
           Anc_8.455 YDR234W gene spans a gap in the genome
           sequence
          Length = 694

 Score = 28.1 bits (61), Expect = 2.8,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 2/43 (4%)

Query: 28  ATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRVGV 70
           AT+V +P  I+   D  I  +SEKN  L ++R+I++   + G+
Sbjct: 71  ATKVANPKQIVNTLDHDIQNTSEKN--LTKYRNIENFAGKHGI 111

>KLLA0B14619g Chr2 complement(1284933..1286528) [1596 bp, 531 aa]
           {ON} some similarities with uniprot|P38866 Saccharomyces
           cerevisiae YHR176W FMO1 Flavin-containing monooxygenase
           localized to the cytoplasmic face of the ER membrane
           catalyzes oxidation of biological thiols to maintain the
           ER redox buffer ratio for correct folding of disulfide-
           bonded proteins
          Length = 531

 Score = 27.7 bits (60), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 24/48 (50%)

Query: 16  KVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDD 63
           + P K E    + T  +S D + KP+   +DY++ K V  V    I+D
Sbjct: 310 RTPGKKEIYDWLNTAAVSKDIVAKPRVSSVDYANGKTVHFVDGTKIED 357

>Skud_2.249 Chr2 complement(448964..450961) [1998 bp, 665 aa] {ON}
           YBR121C (REAL)
          Length = 665

 Score = 26.9 bits (58), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 1/67 (1%)

Query: 16  KVPFKTEQQAV-IATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRVGVSSVI 74
           ++PFK +   V I  R    D +  P    ID+ S K+  +        + +R  V SVI
Sbjct: 574 QIPFKIDDSGVSIGKRYARNDELGTPFGVTIDFESAKDHSVTLRERDSTKQVRGSVESVI 633

Query: 75  DSIKTVV 81
           ++I+ + 
Sbjct: 634 EAIRDIT 640

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,035,551
Number of extensions: 272997
Number of successful extensions: 701
Number of sequences better than 10.0: 27
Number of HSP's gapped: 698
Number of HSP's successfully gapped: 27
Length of query: 88
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 28
Effective length of database: 46,601,439
Effective search space: 1304840292
Effective search space used: 1304840292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)