Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_11.3585.702ON1878187885000.0
YKR095W (MLP1)5.702ON1875184861740.0
Skud_11.3345.702ON1885185459840.0
Suva_11.3315.702ON1898186058170.0
ZYRO0G06600g5.702ON1820179724950.0
TDEL0B021905.702ON1810178424610.0
SAKL0E14916g5.702ON1779169423550.0
Ecym_40185.702ON1769173221780.0
NCAS0A032005.702ON1788178021520.0
CAGL0G02497g5.702ON1780171020290.0
Kwal_55.196975.702ON1760168219770.0
KLLA0A00594g5.702ON1748181218140.0
KLTH0E01056g5.702ON1771134618090.0
AFR286W5.702ON1758172217390.0
NDAI0E050405.702ON1973171717080.0
TBLA0E017305.702ON1820111211881e-133
YIL149C (MLP2)5.702ON1679156210351e-114
Suva_9.395.702ON1682156010281e-113
Smik_9.205.702ON1682156710141e-111
Skud_9.195.702ON1680157310071e-110
KAFR0D022205.702ON167415939021e-97
NCAS0G002305.702ON173515778272e-88
KNAG0C065905.702ON165114037913e-84
KNAG0L021405.702ON160815886672e-69
KAFR0H002105.702ON145410685482e-55
Kpol_1043.705.702ON13214584622e-45
NDAI0F002905.702ON15545584221e-40
TPHA0E002305.702ON12844803146e-28
TPHA0D046105.702ON11836272412e-19
Kwal_55.203477.201ON816165900.11
KLLA0D07370gsingletonON59957890.13
Kpol_2001.755.702ON1006527870.30
TBLA0B028908.849ON648116811.4
AER045C4.238ON1292155811.5
TBLA0E044108.259ON1422283801.9
ZYRO0C17094g3.393ON482263791.9
Kwal_27.101998.849ON572144782.4
CAGL0C05577g2.16ON619121773.5
KLLA0C17204g4.46ON768193765.2
TPHA0B008304.238ON253676765.9
Kwal_26.90958.737ON45995746.8
TBLA0C025603.443ON257883756.9
TDEL0E035905.267ON1882127757.2
ZYRO0F09570g5.414ON835231757.2
YER071C (TDA2)7.259ON12645698.6
TDEL0B070902.616ON773225749.1
KAFR0G032004.238ON1869213749.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_11.358
         (1878 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...  3278   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...  2382   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...  2309   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...  2245   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   965   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   952   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   911   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   843   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   833   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   786   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   766   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   703   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   701   0.0  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   674   0.0  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   662   0.0  
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   462   e-133
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   403   e-114
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   400   e-113
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   395   e-111
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   392   e-110
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   352   1e-97
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   323   2e-88
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   309   3e-84
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   261   2e-69
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   215   2e-55
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   182   2e-45
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   167   1e-40
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   125   6e-28
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    97   2e-19
Kwal_55.20347 s55 (364795..367245) [2451 bp, 816 aa] {ON} YIL026...    39   0.11 
KLLA0D07370g Chr4 complement(630095..631894) [1800 bp, 599 aa] {...    39   0.13 
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    38   0.30 
TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...    36   1.4  
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    36   1.5  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...    35   1.9  
ZYRO0C17094g Chr3 complement(1327234..1328682) [1449 bp, 482 aa]...    35   1.9  
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...    35   2.4  
CAGL0C05577g Chr3 (536419..538278) [1860 bp, 619 aa] {ON} weakly...    34   3.5  
KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some...    34   5.2  
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    34   5.9  
Kwal_26.9095 s26 (1071970..1073349) [1380 bp, 459 aa] {ON} YMR22...    33   6.8  
TBLA0C02560 Chr3 (604893..612629) [7737 bp, 2578 aa] {ON} Anc_3....    33   6.9  
TDEL0E03590 Chr5 complement(670913..676561) [5649 bp, 1882 aa] {...    33   7.2  
ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} simila...    33   7.2  
YER071C Chr5 complement(301947..302327) [381 bp, 126 aa] {ON}  T...    31   8.6  
TDEL0B07090 Chr2 complement(1249326..1251647) [2322 bp, 773 aa] ...    33   9.1  
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    33   9.8  

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 3278 bits (8500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1701/1878 (90%), Positives = 1701/1878 (90%)

Query: 1    MPDHDISIKSVQNSDNTDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSEN 60
            MPDHDISIKSVQNSDNTDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSEN
Sbjct: 1    MPDHDISIKSVQNSDNTDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSEN 60

Query: 61   LQITVSFDELKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNEL 120
            LQITVSFDELKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNEL
Sbjct: 61   LQITVSFDELKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNEL 120

Query: 121  ESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLE 180
            ESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLE
Sbjct: 121  ESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLE 180

Query: 181  TKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIR 240
            TKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIR
Sbjct: 181  TKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIR 240

Query: 241  NELNHLRSDFQVEKTKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQ 300
            NELNHLRSDFQVEKTKNDVLTQKND                 DCLSSEKQEFSTEINLKQ
Sbjct: 241  NELNHLRSDFQVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQ 300

Query: 301  RLVDLLESQLNAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRL 360
            RLVDLLESQLNAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRL
Sbjct: 301  RLVDLLESQLNAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRL 360

Query: 361  XXXXXXXXXXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSF 420
                                 FILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSF
Sbjct: 361  SSIIGETDEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSF 420

Query: 421  KERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQV 480
            KERTDT             HTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQV
Sbjct: 421  KERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQV 480

Query: 481  QYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQE 540
            QYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQE
Sbjct: 481  QYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQE 540

Query: 541  KNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXX 600
            KNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKA             
Sbjct: 541  KNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELE 600

Query: 601  XXXXXXXALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKE 660
                   ALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKE
Sbjct: 601  KECENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKE 660

Query: 661  IQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQ 720
            IQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQ
Sbjct: 661  IQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQ 720

Query: 721  DSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMV 780
            DSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMV
Sbjct: 721  DSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMV 780

Query: 781  TQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWY 840
            TQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWY
Sbjct: 781  TQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWY 840

Query: 841  QNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDDS 900
            QNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDDS
Sbjct: 841  QNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDDS 900

Query: 901  LRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSS 960
            LRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSS
Sbjct: 901  LRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSS 960

Query: 961  LEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSK 1020
            LEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSK
Sbjct: 961  LEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSK 1020

Query: 1021 IQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLEST 1080
            IQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLEST
Sbjct: 1021 IQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLEST 1080

Query: 1081 LKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALN 1140
            LKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALN
Sbjct: 1081 LKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALN 1140

Query: 1141 SILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQ 1200
            SILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQ
Sbjct: 1141 SILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQ 1200

Query: 1201 QHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALKYS 1260
            QHEDIMEKLNQLNLLRESNITLR         KRVLQSELDKLKQDIAPIESELAALKYS
Sbjct: 1201 QHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKYS 1260

Query: 1261 MQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAE 1320
            MQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAE
Sbjct: 1261 MQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAE 1320

Query: 1321 AEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAKAE 1380
            AEERFNRLRRQAQER            EQVNDLKNAKIKLEKSLDDANTKIEELENAKAE
Sbjct: 1321 AEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENAKAE 1380

Query: 1381 QDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXXXX 1440
            QDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIIT             
Sbjct: 1381 QDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITLREEIEKQRRIQQ 1440

Query: 1441 XXXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNINIDE 1500
               SEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNINIDE
Sbjct: 1441 QLQSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNINIDE 1500

Query: 1501 LKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIK 1560
            LKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIK
Sbjct: 1501 LKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIK 1560

Query: 1561 LLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKM 1620
            LLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKM
Sbjct: 1561 LLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKM 1620

Query: 1621 RKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESPSKHVNHTQN 1680
            RKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESPSKHVNHTQN
Sbjct: 1621 RKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESPSKHVNHTQN 1680

Query: 1681 QLLGLPRKIEENSSSSFNPXXXXXXXXXXXXXXXXXXXFNPFTSPSPNKSSQKVDDQREL 1740
            QLLGLPRKIEENSSSSFNP                   FNPFTSPSPNKSSQKVDDQREL
Sbjct: 1681 QLLGLPRKIEENSSSSFNPLLSGEKLLKLNSKSSSSGGFNPFTSPSPNKSSQKVDDQREL 1740

Query: 1741 TTNKADPPTHLTPSFNIPAGRGLIXXXXXXXXXXNDEELTGNEQNNSSDGNTQLXXXXXX 1800
            TTNKADPPTHLTPSFNIPAGRGLI          NDEELTGNEQNNSSDGNTQL      
Sbjct: 1741 TTNKADPPTHLTPSFNIPAGRGLISSSSTLSTDTNDEELTGNEQNNSSDGNTQLEAGIEK 1800

Query: 1801 XXXXXXXXXXXXXXXXTTSHKRPIDEVRELKDDDDEVSAEFSNXXXXXXXXXXXXXXXXX 1860
                            TTSHKRPIDEVRELKDDDDEVSAEFSN                 
Sbjct: 1801 AEEKEFAEKKKEVEGETTSHKRPIDEVRELKDDDDEVSAEFSNEPKKVKTDDEEEEKAKV 1860

Query: 1861 XNERKDEGENSSKDSEQD 1878
             NERKDEGENSSKDSEQD
Sbjct: 1861 DNERKDEGENSSKDSEQD 1878

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score = 2382 bits (6174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1286/1848 (69%), Positives = 1495/1848 (80%), Gaps = 11/1848 (0%)

Query: 1    MPDHDISIKSVQNSDNTDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSEN 60
            M DHD  ++S+QN +N+DERL AIASFFG S EQV+S + D++KHLNDKLLQFNELKSEN
Sbjct: 1    MSDHDTPMESIQNGENSDERLNAIASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSEN 60

Query: 61   LQITVSFDELKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNEL 120
            L++TVSFDELK +S KKID LK EMEN+I++ND IRKER+DT  K ES +NEK K+S+EL
Sbjct: 61   LKVTVSFDELKASSLKKIDGLKTEMENVIRENDKIRKERNDTFVKFESVENEKMKLSSEL 120

Query: 121  ESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLE 180
            E +KR+ DDL EEKKE Q NQQRTLKILDERLKE+E+ R +NNRS++ECK+LRSTI+DLE
Sbjct: 121  EFVKRKLDDLTEEKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLE 180

Query: 181  TKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIR 240
            TKQQ  IT+DLNSR ELERK QEL +LQS NDWLEKEL SKNEQYLSYR+KTDK+IL+IR
Sbjct: 181  TKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIR 240

Query: 241  NELNHLRSDFQVEKTKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQ 300
            NELN LR+DFQ+E+T NDVL QKN+                 D L+SEKQEFS E++LKQ
Sbjct: 241  NELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQ 300

Query: 301  RLVDLLESQLNAVKEELDSTRGLETS----NDSKKHMSEKEDLVKELQLTKEELAQCKSE 356
            RLVDLLESQLNAVKEEL+S R L T+    +DSKK   E EDL+KELQLTKE+LAQC+ E
Sbjct: 301  RLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKE 360

Query: 357  CIRLXXXXXXXXXXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPI 416
            C+RL                     FI LKKQLIKE+R KEHLQNQIE+FI+ELEHKVPI
Sbjct: 361  CLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPI 420

Query: 417  INSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDL 476
            INSFKERTD              HTSNEKNAK++EL+AK++KL +CEND+QTL KQRLDL
Sbjct: 421  INSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDL 480

Query: 477  CRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSII 536
            CRQ+QYLLITNSVS DSKGPLRKEEI FIQNI+Q D  T TE+DSQK+VTERLVEF++II
Sbjct: 481  CRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNII 540

Query: 537  ELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXX 596
            +LQEKN ELLK+VRNLAD+LES E +SKQSLQKIESET+NEAKEAI+TLK+         
Sbjct: 541  QLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKSEKMDLESRI 600

Query: 597  XXXXXXXXXXXALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSL 656
                         + NE+ S+ N TI+QL ETKR+LE Q+QDLQ+ ISQITRESTENMSL
Sbjct: 601  EELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSL 660

Query: 657  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQST 716
            LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFD LQ+T
Sbjct: 661  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNT 720

Query: 717  ILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGL 776
            ILKQDSKT ETLNEY+SCKSKL+I ETEL NLKEEQKL++  E+NLKQE+ KLS EK  L
Sbjct: 721  ILKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSL 780

Query: 777  RIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSS 836
            RIMVTQLQTLQKERE+LL+ETRKS Q KIDELE A +ELK E S KD  IKQLEEDNNS+
Sbjct: 781  RIMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSN 840

Query: 837  IEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTI 896
            IEWYQNKIE LKKD ES+I S++ KQ +IEKLQ+KVKSLEKEI+E+KIRLHTYNV+D TI
Sbjct: 841  IEWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETI 900

Query: 897  NDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTN 956
            NDDSLRKELEKSKI+LTDAYSQI+EYK+LYET ++SL+Q +SK +ES KDF+N+IKNLT+
Sbjct: 901  NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD 960

Query: 957  EKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYES 1016
            EK+SLE+KISLLKEQ+FNLNNELDLQ KGM++EKA+F+K+ISILQNNNKEVEAVKSEYES
Sbjct: 961  EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES 1020

Query: 1017 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQ 1076
            KLSKIQ DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTY+ QV TL LSR+Q
Sbjct: 1021 KLSKIQNDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQ 1080

Query: 1077 LESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDK 1136
            LE+ LKENE+SW+SQ+++L+EQL+ SNSRIEDL+SQNKLLYDQI++YT ADK V ++ + 
Sbjct: 1081 LENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNNSTNG 1140

Query: 1137 PALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRP 1196
            P LN+IL++LRRERDILDTKVTVAERDAKMLRQKISLMD+ELQ+ARTKLDNSR+E+E   
Sbjct: 1141 PGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHS 1200

Query: 1197 TIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAA 1256
            +IIQQH+DIMEKLNQLNLLRESNITLR         K+ LQSELDKLKQ++APIESEL A
Sbjct: 1201 SIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTA 1260

Query: 1257 LKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTR 1316
            LKYSMQEKEQEL+L KEEVHRWKKRSQDILEKH Q+SSSDYEKLE EI++LK +L+ K R
Sbjct: 1261 LKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKER 1320

Query: 1317 QGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELEN 1376
            QGAEAEE+FNRLRRQAQER            EQVN L++AK  LE SL +AN +IEEL+N
Sbjct: 1321 QGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARIEELQN 1380

Query: 1377 AKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXX 1436
            AK  Q NNQL+AI++LQ+DAE +S+E + KLEE  T Y+STI  LNEEI T         
Sbjct: 1381 AKVAQGNNQLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQR 1440

Query: 1437 XXXXXXXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNI 1496
                   +  ANEQNDLS IVESMKK+FEEDKI FI+EKT+EVNEKILEAQERLNQPSNI
Sbjct: 1441 QIQQQLQATSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLNQPSNI 1500

Query: 1497 NIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVE 1556
            N++E+K KW++EHE+EV  +IREAEEALKKRIRLPTEEKI+KIIERK+E+LEKEF+EKVE
Sbjct: 1501 NMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVE 1560

Query: 1557 ERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEK----LKELSHSNSISIDERDQL 1612
            ERIK + QSG++DV  +KQ E ++QEKQKELE++YN+K    LK++ HS+ IS DERD+L
Sbjct: 1561 ERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKL 1620

Query: 1613 RAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESPS 1672
            RAEIE+++R+E +NELQ IKKKSF+EGKQQAMMKTTLLERKLAKMESQLSETK+  ESP 
Sbjct: 1621 RAEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPP 1680

Query: 1673 KHVNHTQNQLLGLPRKIEENSSSSFNPXXXXXXXXXXXXXXXXXXXFNPFTSPSPNKSSQ 1732
            K VN+ QN LLGLPRKIEENS+S FNP                   FNPFTSPSPNK  Q
Sbjct: 1681 KSVNNVQNPLLGLPRKIEENSNSPFNP-LLSGEKLLKLNSKSSSGGFNPFTSPSPNKHLQ 1739

Query: 1733 KVDDQRELTTNKADPPTHLTPSFNIPAGRGLIXXXXXXXXXXNDEELTGN--EQNNSSDG 1790
              +D+RE   NK DPPTHL PSFNIPA RGLI          NDEELT N   Q +SS+ 
Sbjct: 1740 NDNDKRESLANKTDPPTHLEPSFNIPASRGLISSSSTLSTDTNDEELTSNNPAQKDSSNR 1799

Query: 1791 NTQLXXXXXXXXXXXXXXXXXXXXXXTTSHKRPIDEVRELKDDDDEVS 1838
            N Q                       T S+KRPIDEV ELK+D+D+ +
Sbjct: 1800 NVQSEEDTEKKKEGEPVKRGEAIEEQTKSNKRPIDEVGELKNDEDDTT 1847

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score = 2309 bits (5984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1251/1854 (67%), Positives = 1474/1854 (79%), Gaps = 11/1854 (0%)

Query: 1    MPDHDISIKSVQNSDNTDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSEN 60
            M D  + +KS QN +   ERL  IASFF  S EQV+SI++D+I  LN+KL+QFNELKSEN
Sbjct: 1    MSDQGLLMKSTQNEEGASERLNVIASFFDCSLEQVKSIDTDIITRLNEKLIQFNELKSEN 60

Query: 61   LQITVSFDELKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNEL 120
            LQITVSFDELKTNS KKID LK EMEN+++QND IRKER+DT  K E  +NEK ++SNEL
Sbjct: 61   LQITVSFDELKTNSLKKIDGLKTEMENVLRQNDEIRKERNDTSAKFEFLQNEKIQLSNEL 120

Query: 121  ESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLE 180
            ES+KR+ +DL EEKKE+Q NQQRTLKILDERLKE+E+A+ +NNR++NEC+ LRST+++LE
Sbjct: 121  ESVKRKLNDLTEEKKEIQSNQQRTLKILDERLKEVEMAKVENNRTNNECRNLRSTVVELE 180

Query: 181  TKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIR 240
            TKQQ  IT+DLNSR+ELERK QELN+LQS  DWLEKEL SK+EQYLSYR++TD  I EIR
Sbjct: 181  TKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIR 240

Query: 241  NELNHLRSDFQVEKTKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQ 300
            +ELN L++DFQ+EKT NDVL QKN+                 D L++EKQEFSTEI LKQ
Sbjct: 241  SELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQ 300

Query: 301  RLVDLLESQLNAVKEELDSTRGLETSN----DSKKHMSEKEDLVKELQLTKEELAQCKSE 356
            RL+DLLE+QLNAVKEEL S R  ++SN    DS+K +SE E L+K+L+LTKE+LAQC+SE
Sbjct: 301  RLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLLKDLRLTKEKLAQCESE 360

Query: 357  CIRLXXXXXXXXXXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPI 416
            C+RL                     FILLKKQ IKEKRAKE LQNQIESFI+ELEHKVP+
Sbjct: 361  CLRLSSITEETGEESGTLTSRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPV 420

Query: 417  INSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDL 476
            INSFKERTD              HTSNEKNAKIREL+ K+EK+ +CENDI  L +QRLDL
Sbjct: 421  INSFKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDL 480

Query: 477  CRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSII 536
            CRQVQYLLITNSVS DSKGPLRKEEI FIQNILQND+   TE+DSQKI+T RLVEFR++I
Sbjct: 481  CRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVI 540

Query: 537  ELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXX 596
            ELQEKNTELL+I RNLAD+LESNE +SKQ+L KIE++TINEAKEAIL+L++         
Sbjct: 541  ELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKV 600

Query: 597  XXXXXXXXXXXALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSL 656
                       + +S + +S  NS IQQL +TKR LE Q+QDLQ+ ISQITREST+NMSL
Sbjct: 601  EELERERETLKSSISKQASSFNNSVIQQLTKTKRELESQVQDLQARISQITRESTQNMSL 660

Query: 657  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQST 716
            LNKEIQD+YDSKSDISI+LGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKR D LQS+
Sbjct: 661  LNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSS 720

Query: 717  ILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGL 776
            I KQDSKT ETLNEYISCKSKL++ ET L NLK EQKLKIDSE++LKQE+ KLSSEKT L
Sbjct: 721  ISKQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSL 780

Query: 777  RIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSS 836
            RIMVTQLQTLQKERE+LLDE RKS QNKI+E+E A+NELK E SHKDQ I QLEEDN S 
Sbjct: 781  RIMVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSK 840

Query: 837  IEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTI 896
            IEWYQNKIE LKKDN+S++  +N+KQ EIEKLQ+KVKSLEKEI+ENKIRLHTYNV+D TI
Sbjct: 841  IEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVMDETI 900

Query: 897  NDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTN 956
            NDDSLRKELE SKI+LT+AYSQIQEYK+LYE+ A+SL++M+SK +ES++ FSN+I++LT+
Sbjct: 901  NDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLTD 960

Query: 957  EKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYES 1016
            EK +LE+K+SLLKEQ FNLNNELDLQ   M+++K EF+K I+ILQNNNKE+E VKSEYES
Sbjct: 961  EKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYES 1020

Query: 1017 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQ 1076
            KLSKIQ DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYR QV TLTLSR++
Sbjct: 1021 KLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSE 1080

Query: 1077 LESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDK 1136
            LE+ LKENE+SWTSQ+++L+EQL+ SNSRIEDL+SQNKLLY+QIELYT A  GV D  + 
Sbjct: 1081 LENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNG 1140

Query: 1137 PALNS-ILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKR 1195
            P LN+ IL++LRRERDILDTKVTVAERDAKMLRQKI+LMD+ELQ+ARTKL+NSR+E ++R
Sbjct: 1141 PTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLNNSRVENDER 1200

Query: 1196 PTIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELA 1255
             +I+QQH+ IMEKLNQLNLLRESNITLR          + LQSEL KLK+ IAPIESEL+
Sbjct: 1201 SSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEIIAPIESELS 1260

Query: 1256 ALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKT 1315
            ALKYSMQEKEQE+RL KEEVHRWKKRSQDILEKH+Q+SS+DYEKLE E++SLK +L++K 
Sbjct: 1261 ALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKM 1320

Query: 1316 RQGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELE 1375
            +QG EAEERFNRLRRQAQE+            EQ+N+LK+AK+ LE+SL+DANT+I+ELE
Sbjct: 1321 QQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLNDANTRIQELE 1380

Query: 1376 NAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXX 1435
              K  +DNN+ + IKR Q+DAE SS+E + KLEE A  Y ST++KLNEEI T        
Sbjct: 1381 GEKVAEDNNRSEMIKRSQEDAEKSSRELEEKLEENAISYSSTVRKLNEEIATLKEEIEKQ 1440

Query: 1436 XXXXXXXXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSN 1495
                    +   +   DLS IVESMKK+FEEDKI FI EKT+EVN+KI EAQERLNQPS+
Sbjct: 1441 GQIQKQLQTAAGHRDEDLSNIVESMKKSFEEDKIKFIEEKTREVNKKIQEAQERLNQPSS 1500

Query: 1496 INIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKV 1555
            +NIDE+K +W+AEHEEEV  R+REAEEALKKRIRLPTEEKISKIIERK+EDLEKEF+EK+
Sbjct: 1501 VNIDEMKKQWEAEHEEEVAERVREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKL 1560

Query: 1556 EERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYN----EKLKELSHSNSISIDERDQ 1611
            EE++K +S S QM+   QKQ EIR+QEKQKELED+YN    EKLKE+SHS+SIS++E+D+
Sbjct: 1561 EEKVKSISGSEQMEAMLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDE 1620

Query: 1612 LRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESP 1671
            LRAEIE K+R+EL++ELQ++KKKSFEEGKQQA MKTTLLERKLAKMESQLSE K+  ESP
Sbjct: 1621 LRAEIEAKLREELNDELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESP 1680

Query: 1672 SKHVNHTQNQLLGLPRKIEENSSSSFNPXXXXXXXXXXXXXXXXXXXFNPFTSPSPNKSS 1731
             KH N+  N LLGLPRKIEENS+S FN                    FNPFTSPSP K  
Sbjct: 1681 PKHANNVPNPLLGLPRKIEENSNSPFNTLLSGEKLLKFNSKSSSSGAFNPFTSPSPKKLL 1740

Query: 1732 QKVDDQRELTTNKADPPTHLTPSFNIPAGRGLIXXXXXXXXXXNDEELTGNE--QNNSSD 1789
            QK D Q+E + NK DPPTHL PSFNIPA R L           NDEELT NE  Q  SS 
Sbjct: 1741 QKDDVQKETSNNKTDPPTHLAPSFNIPATRVLTSSSSTLSTDTNDEELTVNEPGQKISSA 1800

Query: 1790 GNTQLXXXXXXXXXXXXXXXXXXXXXXTTSHKRPIDEVRELKDDDDEVSAEFSN 1843
             N+                        T S+KRPIDEV ELKDDDDE SAEF+N
Sbjct: 1801 INSLSQTGSEQNQEEELFEIKNIAEEKTKSNKRPIDEVAELKDDDDEDSAEFTN 1854

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score = 2245 bits (5817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1219/1860 (65%), Positives = 1463/1860 (78%), Gaps = 17/1860 (0%)

Query: 1    MPDHDISIKSVQNSDNTDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSEN 60
            M D + S++S QN ++T ERL AIASFF  S EQV+SI+ D++ HLNDKLLQFNELKSEN
Sbjct: 1    MSDRNASMRSTQNDEDTGERLNAIASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSEN 60

Query: 61   LQITVSFDELKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNEL 120
            +QITV+ DELKTNS+KKI++LK EME++++QND IRKER+DT  K ES + EKT +SNEL
Sbjct: 61   IQITVTLDELKTNSAKKINSLKTEMEDVLRQNDEIRKERNDTSSKFESVQREKTHLSNEL 120

Query: 121  ESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLE 180
            ESIKR+  DL EEKKE+Q +QQRTLKILDERLKELE+ ++ +N SD+ECK+LRSTI++LE
Sbjct: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180

Query: 181  TKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIR 240
            TKQQ  I++DLNS+++LER+ QELN+LQS  DWLEKEL SKN+QYLSYR+KT+ II EIR
Sbjct: 181  TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR 240

Query: 241  NELNHLRSDFQVEKTKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQ 300
            N+LN +R+DFQ+EKT NDVL QKN+                 D  +SEK++FS EI LKQ
Sbjct: 241  NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ 300

Query: 301  RLVDLLESQLNAVKEELDSTRGLE----TSNDSKKHMSEKEDLVKELQLTKEELAQCKSE 356
            RL+DLLESQLNAVKEEL++TR        S+DSK+ +SE E L+K+LQLTK +L QC++E
Sbjct: 301  RLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENE 360

Query: 357  CIRLXXXXXXXXXXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPI 416
            C+RL                     FILLKKQLIKEKRAKEHLQNQIESFI+ELEHKVPI
Sbjct: 361  CLRLSSITEEAGKEDGILTSKSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPI 420

Query: 417  INSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDL 476
            INSFKERTDT             HTSNEKNAKI+EL  K+EKL + +++I  L KQRLDL
Sbjct: 421  INSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDL 480

Query: 477  CRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSII 536
            CRQ+QYLL+TNSVS DSKGPLRKEEI FIQNILQND    TE+DSQKIVTERLVEFR II
Sbjct: 481  CRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDII 540

Query: 537  ELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXX 596
            +LQEKN+ELL++ RNLAD+LESNEN+SK  L+ IE+ETINEAKEAILTL++         
Sbjct: 541  QLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKI 600

Query: 597  XXXXXXXXXXXALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSL 656
                           ++ETS  NS IQQL ETKR LE Q QDLQ+ ISQ+TRESTENMSL
Sbjct: 601  HELEKEREKFKNWTMDQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSL 660

Query: 657  LNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQST 716
            LNKE+QDLYDSKS +SI+LG+EKSSRILAEERFKLLSNTLDL KAENDQLRKR   LQ+ 
Sbjct: 661  LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA 720

Query: 717  ILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGL 776
            I KQDSKTQETLN+Y+SCKSKL+  ETEL NLK E+ LKI+ E+NLKQE+ +LSSEKT L
Sbjct: 721  ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEKTSL 780

Query: 777  RIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSS 836
             IMVTQLQTLQKERENLLDET+KS QNKID L++A NELK EA  KDQ IKQLEEDN+S 
Sbjct: 781  HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK 840

Query: 837  IEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTI 896
            IEWYQNKIE L+KD+ES++ S+N+KQ E+E+ Q+++KSLEKEI+ENKIRLHTYNV+D +I
Sbjct: 841  IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESI 900

Query: 897  NDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTN 956
            NDDSLR+ELEKSKI+LTDAYSQIQEYK+LYET  KSL++M S+ +ES+K FSN+I+NLT+
Sbjct: 901  NDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLTD 960

Query: 957  EKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYES 1016
            EK+SLE+K+SLL+EQ+ NLNNELDLQN+ M++EKAEF+KKISILQNNNKE+EAVK+EYES
Sbjct: 961  EKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTEYES 1020

Query: 1017 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQ 1076
            KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTY+ QV TL L+R Q
Sbjct: 1021 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQ 1080

Query: 1077 LESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDK 1136
             E  LKENE +W SQ+++L+EQL+ SNSRIEDL+SQNKLLYDQIELYTT     TD    
Sbjct: 1081 FEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSG 1140

Query: 1137 PALNS-ILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKR 1195
              LN+ IL++LRRERDILDTKV VAERDAKMLRQKISL+D+ELQEARTKL NS++E EKR
Sbjct: 1141 SVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLCNSKVENEKR 1200

Query: 1196 PTIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELA 1255
              IIQQH+++MEKLNQLNLLRESN TLR          + LQSEL++L+ +IAPIESELA
Sbjct: 1201 SFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELA 1260

Query: 1256 ALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKT 1315
            ALK+S+QEKEQE+RLTKEEVHRWKKRSQDI+EKH+Q+SS+DYEKLE EI+SLK +L++KT
Sbjct: 1261 ALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKT 1320

Query: 1316 RQGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELE 1375
            +QGA++EE+FNRLRRQAQE+            EQ+N+LK+AK+ LEKSL++AN +I+ELE
Sbjct: 1321 QQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELE 1380

Query: 1376 NAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXX 1435
            +AK  ++ NQL  IK+LQ+D E +SKE +TKLEE A  YDST+KKLNEEI          
Sbjct: 1381 DAKVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVKKLNEEIGILKEELEKQ 1440

Query: 1436 XXXXXXXXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLN---- 1491
                    +    EQ+DLSK+VESMK++FEEDKI FI EKT+EVN+KI E QE       
Sbjct: 1441 RQIQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQKIREFQEAQEAEET 1500

Query: 1492 --QPSNINIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEK 1549
              +PSNINIDE+K +W+AEH EEV  +IREAEEALKKRIRLPTEEKISKIIERK+EDLEK
Sbjct: 1501 GLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEK 1560

Query: 1550 EFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYN----EKLKELSHSNSIS 1605
            EFDEKVEER+K +SQSG+M+  FQKQ E RIQEKQKELE++YN    EKL+EL  S+ IS
Sbjct: 1561 EFDEKVEERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIIS 1620

Query: 1606 IDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1665
             D++D+LRA+IE ++R+E ++ELQ IKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK
Sbjct: 1621 SDDKDKLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1680

Query: 1666 KITESPSKHVNHTQNQLLGLPRKIEENSSSSFNPXXXXXXXXXXXXXXXXXXXFNPFTSP 1725
            +  +SP KH++   N LLGLPRKIEENS+  +NP                   FNPFTSP
Sbjct: 1681 QSVDSPPKHLSKMPNPLLGLPRKIEENSNPPYNPLLSGEKLLKLNSKSSSSGGFNPFTSP 1740

Query: 1726 SPNKSSQKVDDQRELTTNKADPPTHLTPSFNIPAGRGLIXXXXXXXXXXNDEELTGNEQ- 1784
            SPNK  Q  + +RE ++N+ +PPTHL PSFNIPA +GL           NDEE T NEQ 
Sbjct: 1741 SPNKPLQGDEAEREPSSNETEPPTHLAPSFNIPATQGLNSSSSTLSTDTNDEERTVNEQE 1800

Query: 1785 -NNSSDGNTQLXXXXXXXXXXXXXXXXXXXXXXTTSHKRPIDEVRELKDDDDEVSAEFSN 1843
             NN+ DG  Q                       + S+KRPIDEV ELKDDDDEV+ + +N
Sbjct: 1801 ENNAFDGIGQFQDRKVQEEGENLIEIAGASKDESKSNKRPIDEVGELKDDDDEVNTDSTN 1860

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/1797 (37%), Positives = 1044/1797 (58%), Gaps = 106/1797 (5%)

Query: 11   VQNSDN-TDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDE 69
            V + DN  D  L  +++F+G   +Q+  I+  ++  L +K+L FNELKS+NL++ V+ DE
Sbjct: 12   VTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDE 71

Query: 70   LKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADD 129
            +KT SSK+ + LK E+ENL+K ND IR ER    ++      +K KI NE+ES++ +  D
Sbjct: 72   IKTVSSKREEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSD 131

Query: 130  LIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITS 189
            L +E++ L+ +++  + +L+E++KELE  R+++ +S ++ KRLR  +++LET  Q+L + 
Sbjct: 132  LDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSK 191

Query: 190  DLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSD 249
            +L  ++E++   Q L ILQ  + WLE+E+ SK EQ +S R+K D  +  + +E    +++
Sbjct: 192  ELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNE 251

Query: 250  FQVEKTKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQ 309
             Q+EK++N V+T KN+                 D L  EKQEF+ E+++KQ+L+DLLE+Q
Sbjct: 252  LQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQ 311

Query: 310  LNAVKEELDSTRGLETSN----DSKKHMSEKEDLVKELQLTKEELAQCKSECIRLXX-XX 364
            + +++ EL+++  L+  N     S +  +E E L++EL   KE   + + E +RL     
Sbjct: 312  VKSLQGELNAS--LDKDNVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQ 369

Query: 365  XXXXXXXXXXXXXXXXXFI-------------LLKKQLIKEKRAKEHLQNQIESFILELE 411
                             FI             +LKK+LIKE+  KE LQ Q+ESFI+ELE
Sbjct: 370  ELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELE 429

Query: 412  HKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIK 471
            +K+P+INSFKERT               HTSNEK  + RE  A S+K+K  E+ I TL +
Sbjct: 430  YKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTR 489

Query: 472  QRLDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVE 531
            QR DL  QVQ+LL+  SV  DS G L  EE+ FI+ I+ ND D  +E+DSQ++++ERLVE
Sbjct: 490  QRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNND-DPNSESDSQRVISERLVE 548

Query: 532  FRSIIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXX 591
            F +I  LQEKN ELLK VR LA++LES E +  + +Q  E++TI EAKEAI++L+     
Sbjct: 549  FNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNAN 608

Query: 592  XXXXXXXXXXXXXXXXALLS---NEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITR 648
                            A+ S   +++   L++   Q N    + E +++ L++ ++ +T 
Sbjct: 609  LESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTV 668

Query: 649  ESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRK 708
            ES++N  +LN EI +LY SK+ ISI+L KE+SS+ L EER KL+ +TL+LT+ EN QL K
Sbjct: 669  ESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVK 728

Query: 709  RFDCLQSTILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQK 768
            R   LQS   +QDS+T ET+NE I+C SKL + ET++ NL+ E++L   SE+  ++   K
Sbjct: 729  RSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLK 788

Query: 769  LSSEKTGLRIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQ 828
            LS E+  LRIMV+QLQTLQ ERE  L E + +Y+  +D LE    + +     K +  + 
Sbjct: 789  LSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAED 848

Query: 829  LEEDNNSSIEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHT 888
            +E    + I+WYQ+K++ +  +++ +   +  K   +  L+ +V+ LEK+++E++ R+ +
Sbjct: 849  MENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQS 908

Query: 889  YNVIDG----TINDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESS 944
            Y V+ G    T  + SLRKELEK+KI+L+D Y++I +YK L  T  +SL Q+   +    
Sbjct: 909  YQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGK 968

Query: 945  KDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNN 1004
            ++   +++ L NEKS L++ ++ L E +  L   L   NK  + EK   +KKI+ L+  +
Sbjct: 969  QELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETES 1028

Query: 1005 KEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYR 1064
            K    +K EY++++ K+Q+DL+QQ  +AN AQ NYE+ELQK ++VSKTISELREQ    R
Sbjct: 1029 KGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDR 1088

Query: 1065 VQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYT 1124
            + +  L  S  Q+   L++NE+SW++Q++    QLE+S   +EDL++QN LLYDQIEL++
Sbjct: 1089 IAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIELFS 1148

Query: 1125 TADK-GVTDTNDKPALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEART 1183
              +  GV    +   +  IL +LRRERDIL TK+TV++R+ + LR  ++ ++ EL   + 
Sbjct: 1149 KDNSDGV--NGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTTKR 1206

Query: 1184 KLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKL 1243
            +L   + E      +I QHE I+E+LNQLNLLRESNITLR          R LQ EL++L
Sbjct: 1207 QLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEELNQL 1266

Query: 1244 KQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHE 1303
            ++ I P+ESEL  L  S+ EK+Q+L L KEE +RWK+RSQ+IL KH ++   D+++L+ +
Sbjct: 1267 RERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKELKEK 1326

Query: 1304 IDSLKVKLDEKTRQGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKS 1363
            +  L+ KLDE  ++  E ++RFNRL++QA E+             Q+N+L+ AK +LE  
Sbjct: 1327 VSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGK 1386

Query: 1364 LDDANTKIEELE---NAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKK 1420
             +    K+ EL+   NA    D   ++++++   DA   S+E +  L       +   KK
Sbjct: 1387 FEAEERKVHELQERLNAHG-NDTETVESVQKELSDALEHSRELEQNLSATLQQNEEITKK 1445

Query: 1421 LNEEIITXXXXXXXXXXXXXXXXSEPANEQNDLSKIVESMKKTFEEDKINFIREK----- 1475
            LN+EI +                    +E  DLS +VESM+++FEE+KINF++EK     
Sbjct: 1446 LNDEIDSLKLELHSLKEQSAATAKGEISE--DLSNVVESMRRSFEEEKINFLKEKTEELK 1503

Query: 1476 -------TKEVNEKILEAQERLNQPSNINIDELKIKWKAEHEEEVVNRIREAEEALKKRI 1528
                   T +VN       E   QP  +N +E+K +W++E EE ++ RI EAEE LKKRI
Sbjct: 1504 KLEEEKHTLQVN-----GNEPQQQP--VNYEEIKRQWESEQEESILKRIAEAEENLKKRI 1556

Query: 1529 RLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELE 1588
            RLPTEE+I +++E+K+  LE+ + +K+EE    L  S   +   +KQ E  +QEK     
Sbjct: 1557 RLPTEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGNNSDLKKQLEKDLQEK----- 1611

Query: 1589 DKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTT 1648
                                                + E+Q +KKK+FEEGKQQA MK+T
Sbjct: 1612 -----------------------------------FEAEVQAVKKKAFEEGKQQAAMKST 1636

Query: 1649 LLERKLAKMESQLSETKKITESPSKHVNHTQN-QLLGLPRKIEENS----SSSFNPXXXX 1703
            LLERK++K+ESQL       +SP K  + T +     LP KI+E S     S  NP    
Sbjct: 1637 LLERKISKLESQLHGK---VDSPDKSSSETSSVPKPNLPSKIDEKSVTTNQSVPNP-LVS 1692

Query: 1704 XXXXXXXXXXXXXXXFNPFTSPSPNKSSQKVDDQRELTTNKADPPTHLTPSFNIPAG 1760
                           F+ F+  +P  SS + +D    +     P   L+ + N  +G
Sbjct: 1693 GEKVLKLDPSKPTFNFSSFSGGNPFTSSPQNNDTMGTSAFGFKPTFTLSNNSNKSSG 1749

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  952 bits (2461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/1784 (37%), Positives = 1026/1784 (57%), Gaps = 88/1784 (4%)

Query: 13   NSDNTDERLKAIASFFGFSFEQVESINSD--LIKHLNDKLLQFNELKSENLQITVSFDEL 70
             S  TDE  + IA F G S ++++ + +D  L   L +KL +FN L+S NL++  + DEL
Sbjct: 9    GSSGTDELSQRIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDEL 68

Query: 71   KTNSSKKIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDL 130
            K   + K+D+LKKE E LI++ND  ++ R+   +++     EKT    ++E++K    + 
Sbjct: 69   KALCTSKVDSLKKETERLIRENDTEKQRRNRLEEQVSQLTKEKTLALGQMENVKFELQNT 128

Query: 131  IEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSD 190
            IE+K  L+ N+Q  +K+L+E++ ELE ++ ++    N+ K LR  +++ + + Q L  + 
Sbjct: 129  IEQKNVLKSNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNG 188

Query: 191  LNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDF 250
            L  ++ELE   Q++ +L  +N+WLEKE+ SK EQ + YR++ D  + +   E+  L++D+
Sbjct: 189  LGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDY 248

Query: 251  QVEKTKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQL 310
            Q+EK+  + L +KN                  D L++EKQEFS E++LKQ+L+DL + QL
Sbjct: 249  QLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQL 308

Query: 311  NAVKEELDSTRGLETSNDSKKHMSEKED-LVKELQLTKEELAQCKSECIRLXXXXXXXX- 368
             + KEEL  T     S ++    S ++   + +L   +++L +   E +RL         
Sbjct: 309  QSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVMG 368

Query: 369  --------XXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSF 420
                                   +LKKQLIKE+  KE+LQ QIESF++ELE+KVP+INS 
Sbjct: 369  DSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVINSL 428

Query: 421  KERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQV 480
            KER+ T             HTS+EK  K REL + + K+KQ E +  TLI+QR DL RQV
Sbjct: 429  KERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLARQV 488

Query: 481  QYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQE 540
            Q+LL   ++  DS+GPL  +E+ FI+ I++N+ + + E+DSQ I+TERLVEF+ I  LQE
Sbjct: 489  QFLLFNGTLQNDSRGPLTADEVAFIKKIIENE-NPSNESDSQSIITERLVEFKDIATLQE 547

Query: 541  KNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXX 600
            +NTELLK  R LADRLE  E  S   +  +E +TI+EAKEAI+TL+              
Sbjct: 548  RNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVSTIE 607

Query: 601  XXXXXXXALLSNEETSHLN-STIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNK 659
                   A+LS    S  N     ++ +++ N E  I+ L+  +S +T E+++N  LLN+
Sbjct: 608  KERDAYKAILSQTSQSFDNLGDADRMKDSQENQEL-IKSLEDKLSTLTTETSKNNELLNQ 666

Query: 660  EIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILK 719
            EI++LY SK+ ++I   KE+SSR LAE+R KLL +TL++TK EN +L +R   LQS + K
Sbjct: 667  EIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSILSK 726

Query: 720  QDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIM 779
            Q+++  ET+N+YISC+SKL++ E    NL  E+ L   S  +L++E+QK+S E+  L +M
Sbjct: 727  QEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLNLM 786

Query: 780  VTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEW 839
            VTQLQTLQ ERENLL E++ S++  I +LE   +ELK E S KD  IK  E+   +  +W
Sbjct: 787  VTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQTKW 846

Query: 840  YQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDD 899
            +Q KI+ +  D   I   +  K A + +L+ +V  L+K+I+E+  R+ +Y  ++   N +
Sbjct: 847  FQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGNGE 906

Query: 900  S----LRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLT 955
            +    LRK+LEK+ I L  AYSQ +E+K++  T  ++LK + ++FEE ++   +  +   
Sbjct: 907  TTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYL 966

Query: 956  NEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYE 1015
             EK  LE+ +S LK+ I  LNNE  LQ    +EEK E  KK+  L+++   +  VK EY+
Sbjct: 967  AEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYD 1026

Query: 1016 SKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRN 1075
             KL ++QKDL+QQT YAN AQ NYE+ELQKHA+VSK IS+LR ++ + R ++  L  S  
Sbjct: 1027 QKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKASEQ 1086

Query: 1076 QLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTND 1135
            Q +  L+  E+SW +Q+  L   ++    ++++++SQNKLL+ Q+EL + +++   +   
Sbjct: 1087 QAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREF-ENKL 1145

Query: 1136 KPALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKR 1195
             P  + +L+SLRRERDIL+TK+TV++R+ K+L QK   ++ EL EAR KL   +  +   
Sbjct: 1146 LPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNH 1205

Query: 1196 PTIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELA 1255
              I +QHEDIME+LNQ+NLLRESN+TLR            LQSEL+ L+  I P+ SEL+
Sbjct: 1206 SDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPLNSELS 1265

Query: 1256 ALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKT 1315
              + S++EK+Q + L  +E  RWK+RS DIL +H ++   +Y KLE EI +LK +L+ K+
Sbjct: 1266 ECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEAKS 1325

Query: 1316 RQGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELE 1375
            ++  +  +RF RL++QA E+             +VN+L+  K K+E+ L +  TK+  LE
Sbjct: 1326 KENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLE 1385

Query: 1376 NAKAEQDNNQLDA--IKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXX 1433
                E+D+   +   ++    DA    KE + KL E     +    +LNEEI +      
Sbjct: 1386 KLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQVR 1445

Query: 1434 XXXXXXXXXXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLN-- 1491
                       E +     LS +VESMKK FEE+KI FI+EKT+E N+K  E + +L+  
Sbjct: 1446 IFKEKENDSTLEGS---QGLSNVVESMKKAFEEEKIKFIQEKTEEYNKKFEEEKAKLSSE 1502

Query: 1492 -----QP-SNINIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKRE 1545
                 +P S  +++ LK +W+ E+E     RI+EAEE LKKRIR+PTEE+I K++++++ 
Sbjct: 1503 NGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKRKT 1562

Query: 1546 DLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSIS 1605
            +LE+EF  +++E   L  + G                                       
Sbjct: 1563 ELEEEFQRRLKEN-NLQPEGG--------------------------------------D 1583

Query: 1606 IDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK 1665
              ER++L+ ++E++   +    L   KKK+FEEGKQQA MK+TLLERK++K+ESQL+ + 
Sbjct: 1584 AKEREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSN 1643

Query: 1666 KITESPSKHVNHTQNQLLGLPRKIEENSSSSFNPXXXXXXXXXXXXXXXXXXXF------ 1719
              T  P K    +    +GLP KI+E+ + +                      F      
Sbjct: 1644 NPT--PEKAAATS----VGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKS 1697

Query: 1720 NPFTSPSP-NKSSQKVDDQRELTTNKADP---PTHLTPSFNIPA 1759
            NPFTS  P N +   +      T   + P   PT  +  FN  A
Sbjct: 1698 NPFTSALPGNNNVFGMKPTFSFTPGSSQPESRPTFGSTGFNTTA 1741

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/1694 (36%), Positives = 1013/1694 (59%), Gaps = 95/1694 (5%)

Query: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83
            I+SF      +V +++  +++ L+ K  QF +LK++NL+ +V+ DELK++S ++ +  K 
Sbjct: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERRSEAFKL 80

Query: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143
            ++E + +  + +RKE+D   D+     +EK   S E+  +K +  +L ++ +  + ++Q 
Sbjct: 81   QLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQLTELKQQNEIFRSSKQD 140

Query: 144  TLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELERKAQE 203
             +++L+E++ +LE ++ +  +     K LR  +++LE + Q   ++DL  +AE++R  QE
Sbjct: 141  VVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENEVQTFKSNDLRGKAEMQRLTQE 200

Query: 204  LNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQK 263
            +N+L+S N WLEKEL SK+E++ SYR++ +  +    +ELN +RS+ ++E++ +  L  +
Sbjct: 201  MNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIERSSSQTLKSR 260

Query: 264  NDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELDSTRGL 323
             +                 D  S EKQEF+ E+ LKQRL+DLLE Q+ + K EL+S R  
Sbjct: 261  ANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESARNK 320

Query: 324  ETSNDSKKHM-SEKEDLVKELQLTKEELAQCKSECIRLXXXXXXXXXXXXXXXXXXXXX- 381
              SN    H+ +E+E +++EL  TK++L   +S+ ++L                      
Sbjct: 321  SVSNSD--HVDAEREKIIEELIETKKKLEISESKAVKLEETVDELLSTDGERGAGNTSKV 378

Query: 382  ---------------FILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDT 426
                             LLKK+LI+E+R KE LQ Q+E+F+LELEHKVP++NSFKERT+ 
Sbjct: 379  SLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFKERTEM 438

Query: 427  XXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLIT 486
                          TS +K  K  EL++   K+   E  I +L++QR DL  QVQ+LLI 
Sbjct: 439  LEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQRSDLAHQVQHLLIQ 498

Query: 487  NSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELL 546
             SV  DS GPL  EE  FI+ I+ N S++  E D+Q+I++ERLV F S++ELQEKN ELL
Sbjct: 499  VSVRNDSNGPLTPEETNFIKKII-NSSESPVEQDAQRIISERLVRFESMVELQEKNMELL 557

Query: 547  KIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXX 606
              +RNLAD+LE+ E ESK   +++ESET+ EAKEAILTL+                    
Sbjct: 558  NSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLESQLEIIAKERDAF 617

Query: 607  XALLSNEETSHLNSTIQQLNETKRNL---ECQIQDLQSNISQITRESTENMSLLNKEIQD 663
              L S++ TS+  S +   +   R+L   E +I++L++++S +T ES +N+ LLN+EI  
Sbjct: 618  KILASDKGTSNGPSNVN--SSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLNEEIHS 675

Query: 664  LYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSK 723
            LY +++D S+ L KE+SSRILAE+R KL+SNTL++TK END+LRKRF  LQ  ILKQDSK
Sbjct: 676  LYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDELRKRFHSLQENILKQDSK 735

Query: 724  TQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQL 783
            TQ+T+   ISCKS+L+  +++L N + E+ L    ++NLK+E + LS E+  +RI++TQL
Sbjct: 736  TQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLSEERNNMRILITQL 795

Query: 784  QTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNK 843
            QTLQ ERE+LL+ET+K++Q K ++LE   ++   +   K + I       +S  +WYQ K
Sbjct: 796  QTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQEKWYQEK 855

Query: 844  IEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDDS--- 900
             + L ++  +    ++ K  +I+ L+ KV+SL  +++E++ R+  +N ++ + + +S   
Sbjct: 856  FDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNALNYSESVESQTE 915

Query: 901  -LRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKS 959
             LR+ELEK++I L DAYSQ+++YK + +++ +S   +    E+S  +++ +I+ LT E+ 
Sbjct: 916  TLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIETLTKERD 975

Query: 960  SLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLS 1019
              ++++ +LK+QI NLNNEL+ Q    + + +++ + +  L+    E++ +K+EYE K+S
Sbjct: 976  MFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRNLEDLKAKQSELDNMKAEYEQKIS 1035

Query: 1020 KIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLES 1079
            KIQ+DL+QQT YANTAQ NYEQELQKHADVSK IS LR +   Y+ +  TL  +    + 
Sbjct: 1036 KIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSETETLRNAAENAKK 1095

Query: 1080 TLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKG-VTDTNDKPA 1138
             L+++E SW  Q     ++L  ++ RIEDL +Q+K+LYDQI+  +   KG  T + D   
Sbjct: 1096 ALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLS---KGKPTSSEDLMP 1152

Query: 1139 LNS----ILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEK 1194
            +++    +L SLRRE+DIL+TK+ V+ R+ K+LRQK+ L++ +L+ +R +L   +     
Sbjct: 1153 ISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIELSKLQRAASG 1212

Query: 1195 RPTIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESEL 1254
                ++  E+IM +LNQLNLLRESNITLR          R L++ELD L   + P+ES++
Sbjct: 1213 NSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYGKVQPLESKV 1272

Query: 1255 AALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEK 1314
              L+ S++EK+ ++ L  EE  RWK+RSQDIL K+ ++   +++KL  ++  L+ ++  K
Sbjct: 1273 TLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSK 1332

Query: 1315 TRQGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEEL 1374
            + +  E + RF RL++QA E+             Q+NDLK  K KLE  L     +++ L
Sbjct: 1333 SDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNL 1392

Query: 1375 ENAKAEQDNNQLDAIKRLQQDAENSSK---EFKTKLEEKATFYDSTIKKLNEEIITXXXX 1431
            E+   + + N+      LQ+  ENS     E + KLE+  +      K+LNE I +    
Sbjct: 1393 ESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELNERIESLMNK 1452

Query: 1432 XXXXXXXXXXXXSEPANEQN-------DLSKIVESMKKTFEEDKINFIREKTKEVNEK-- 1482
                        +E  N+ +       + SKIVE++K  FEE+K   I +K  E+ E+  
Sbjct: 1453 IKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDKESELREQFE 1512

Query: 1483 -----ILEAQE----------RLNQPSNINIDELKIKWKAEHEEEVVNRIREAEEALKKR 1527
                 ILEA+E          +L+ P  +NIDE+K KW+ E+E++   RIRE+ E LKKR
Sbjct: 1513 EEKASILEAKEQELREQLATQKLDPP--VNIDEIKKKWEEEYEQKTSQRIRESNEQLKKR 1570

Query: 1528 IRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKEL 1587
            IRLPTEEKI+KI+E+KR +LE EF+  V+++ + +++S     +              E+
Sbjct: 1571 IRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNS-----------NSTEV 1619

Query: 1588 EDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKT 1647
             +K+ + L+ L                    +M+K+ D ++  IKK++FEEGKQQA MK+
Sbjct: 1620 LEKHKQDLENLKQ------------------EMQKKFDEDIAQIKKRAFEEGKQQASMKS 1661

Query: 1648 TLLERKLAKMESQL 1661
            T LE+K+AK+E+Q+
Sbjct: 1662 TFLEKKIAKLETQI 1675

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1732 (35%), Positives = 995/1732 (57%), Gaps = 152/1732 (8%)

Query: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83
            +A+F      +V+ ++  ++     K  +F+++K++N+++++S D LK N  +KI+  K+
Sbjct: 18   VAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFKE 77

Query: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143
            ++E L+      ++E+  T D+     NEK ++S E+  ++ + ++  +  + +   +Q 
Sbjct: 78   QVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIASAKQD 137

Query: 144  TLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELERKAQE 203
              K+L+E++ +L  ++ +++R     K LR + IDLE   Q   + +L  ++E++R  QE
Sbjct: 138  VTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQRLHQE 197

Query: 204  LNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQK 263
            LN+++S  DWL KEL SKNEQ  S+R+KT+  +     ++N L+S  +  +  N  L  K
Sbjct: 198  LNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNSTLKAK 257

Query: 264  NDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELDSTRGL 323
                               D L++EK+EF+ E++LKQRL+DLLESQ++++K +L++    
Sbjct: 258  TAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLEN--AY 315

Query: 324  ETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLXXXXXXXXXXXXXXXXXXXXXFI 383
            +++N +     EK+ L+ EL  TK+ L   ++E I+L                      +
Sbjct: 316  QSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGKNGVAVINSNV 375

Query: 384  --------------------LLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKER 423
                                +LKKQL++E+R KE LQNQ+ESF++ELEHK+PI+NSFKER
Sbjct: 376  SDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIPILNSFKER 435

Query: 424  TDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYL 483
            TD               T+ +++ K  EL+    K+   E+ + +LI QR DL  QVQYL
Sbjct: 436  TDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSDLAHQVQYL 495

Query: 484  LITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNT 543
            L+  SV  D+ GPL ++E+ F++ I+ ++ D A ++D+Q I++ERLV+F+S+IELQ KN 
Sbjct: 496  LMQLSVRDDAHGPLTEQEVEFVKRIISSE-DEAPKSDTQGIISERLVQFKSVIELQSKNA 554

Query: 544  ELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXX 603
            ELL  +R LAD+LE  E +S+  L+ +E++T+ EAKEAIL+L+                 
Sbjct: 555  ELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQLKIVSKER 614

Query: 604  XXXXALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQD 663
                  L+N      +S      ++K+ L+  I +L+  +  +  +S +N+ LLN EI+ 
Sbjct: 615  DAFK--LANSANKQGDSAPSSTYQSKK-LDEHIMELEKRLKNLAEQSQDNIKLLNDEIKA 671

Query: 664  LYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSK 723
            LY +KS++++ L +E+SS++LAEER KL+ +TL LTK EN +L KR D LQ  +LKQD K
Sbjct: 672  LYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQRVLLKQDEK 731

Query: 724  TQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQL 783
            TQ T++E I+ KS+L+   ++L  L  E+      E  LK E + L+ E T  +I+V+QL
Sbjct: 732  TQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTTSKILVSQL 791

Query: 784  QTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEE---DNNSSIEWY 840
            QTLQ+ER+ LL+E + +Y+  I++LE   +E +    H  +R ++ EE    + S  +W+
Sbjct: 792  QTLQRERDILLEEAQTNYRKNIEKLESDLHETR---EHLVRRTREYEEQRVSDTSQYKWF 848

Query: 841  QNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVI----DGTI 896
            Q K++ L +  ++   ++ +K   IE LQ   KSL  +++E ++R  +Y+V+    D T 
Sbjct: 849  QAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITD 908

Query: 897  NDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTN 956
              ++LRK LEK+ I+L DAYSQI++YK + + + +S  ++    EES  ++   I  L  
Sbjct: 909  KIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNIALLEQ 968

Query: 957  EKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYES 1016
            E+ SL ++I+LL +QI +LN+ELD Q    + EK+E  KK+SILQ + + ++ +KSEYE 
Sbjct: 969  ERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELKSEYEE 1028

Query: 1017 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQ 1076
            K+SK+Q+DL QQ  YAN AQ NYEQELQKHADV+KTIS LRE+   Y+ ++     S ++
Sbjct: 1029 KISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFKRSASE 1088

Query: 1077 LESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDK 1136
             +S L+ NE+SW  Q   L  QL  +  R E+L +QN+LLYDQ+EL + A    +D+   
Sbjct: 1089 AKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATS--SDSEAA 1146

Query: 1137 PALNS----ILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEE 1192
             ++++    ++++LRRERDIL+TK+ V+ R+ K+LRQ++ L       A+T+L+N RLE 
Sbjct: 1147 ASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGL-------AKTELENVRLEF 1199

Query: 1193 EK----RPTII---QQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQ 1245
             K     P  I   +  E IMEKLNQLNLLRESN+TLR          +  Q+E+ KL++
Sbjct: 1200 SKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQE 1259

Query: 1246 DIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEID 1305
             + P+ES+L +L  ++ E++Q++ L KEE  RWK+RSQDIL K+ ++   +++KL  E+ 
Sbjct: 1260 QLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVT 1319

Query: 1306 SLKVKLDEKTRQGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSL- 1364
             LK +L++K+ +  E++ERF +LR+QA ER             +   +  AK +LE  L 
Sbjct: 1320 ELKNELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELA 1379

Query: 1365 ---------------------DDANTKIEELENAKAE--QDNNQLDAIKRLQQDAENSSK 1401
                                  +A++  EELE  +A   + N   +A+  ++ +A +S K
Sbjct: 1380 QTLDKVSELESKLSSSANEKNGEADSLKEELEELRANFIEAN---EAVADIKAEAASSEK 1436

Query: 1402 EFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXXXXXXXSEPANEQNDLSKIVESMK 1461
            + K +++E        IK L  EI                  ++ +N+  D + IVE+MK
Sbjct: 1437 DLKNQIQE----LTEKIKTLESEI------------EHSELEAKNSNDSPDFAPIVENMK 1480

Query: 1462 KTFEEDKINFIREKTKEVNEKILEAQERL-----------------NQPSNINIDE--LK 1502
            K FEE+K   I+EK +E+  K+ E Q++                  + P+   IDE  LK
Sbjct: 1481 KKFEEEKQVLIQEKDEELRMKLEEIQKQYEEERERELSELKASLVESTPNAPLIDEETLK 1540

Query: 1503 IKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEER-IKL 1561
             K +AE+E++ + RIREAEEALKKRIRLP+EE+I+++IER++  L++EF+ +V  R ++L
Sbjct: 1541 SKLEAEYEKKTLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALEL 1600

Query: 1562 LSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMR 1621
              ++ +   +F       I+E Q+E++                              K+ 
Sbjct: 1601 FKENPE---SFVGDTAKLIKEHQEEMD------------------------------KLE 1627

Query: 1622 KELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESPSK 1673
             + D +L  ++KK+FEEGKQQ +MK  LLE K+AK+E Q ++       PSK
Sbjct: 1628 AKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSK 1679

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/1780 (34%), Positives = 994/1780 (55%), Gaps = 110/1780 (6%)

Query: 17   TDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSK 76
            T E L  I SF     EQ+ +I + ++ +L  K+ QF EL+S++L+  VS +EL+  S  
Sbjct: 9    TKEELTLIGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQG 68

Query: 77   KIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKE 136
            +I++L+ ++E+LI+QN    +E+     +L  EK E  ++S+  ++++    ++ E+   
Sbjct: 69   RINDLRTQLEDLIEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAELKEIQEKFDN 128

Query: 137  LQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAE 196
            LQ   Q T+K+LD ++ + E+ +    +  N+ +   +   DLE + Q L  +D  +   
Sbjct: 129  LQKQNQDTIKLLDRKISQNEVEKELTLKLTNQYRESTAKCHDLEDEIQSLKYNDSLTETT 188

Query: 197  LERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTK 256
            + + +Q+L  +    + LE EL +K+++   Y       I  +R +++ L ++  + K++
Sbjct: 189  MNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIKSE 248

Query: 257  NDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEE 316
            ND L ++N                  +  ++EK+E   E++LKQ ++D+L++Q+  +++ 
Sbjct: 249  NDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQD- 307

Query: 317  LDSTRGLET-----SNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLXXXXXXXXXXX 371
             D TR L T      ND ++++ E E+L ++L  T+ +L +   E               
Sbjct: 308  -DYTRILNTKQPIVQNDEERNL-EVEELKQKLIETETQLNKELEE-----RRNITMQTES 360

Query: 372  XXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTXXXXX 431
                         +KK+LI+E+  KE LQNQ+E FI+ELE KVP INSFK+RTD      
Sbjct: 361  STLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPTINSFKQRTDMLEKEL 420

Query: 432  XXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSK 491
                    +   EKN    EL A  +  K  + + ++L KQR DL  Q+QY+LI  SV  
Sbjct: 421  TDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDLAHQLQYILIHTSVQN 480

Query: 492  DSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKIVRN 551
            DS GPL  EE+ FIQ+IL N+S+  + +DSQ++++ERLV F++I+ELQ+KN +LLK VR 
Sbjct: 481  DSNGPLSAEEVRFIQDILDNESNEES-SDSQQVISERLVTFQNIVELQQKNIDLLKSVRE 539

Query: 552  LADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXXALLS 611
            LA +LE  E   + + Q +E + I+EAKEAI++L++                    +L  
Sbjct: 540  LARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIKTLNDELDCYKSLPK 599

Query: 612  NE---ETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDLYDSK 668
             +   ET HL     +LNE   +L   I++L++ ++    ES +  + LN EI D+  + 
Sbjct: 600  PDTKVETEHL-----RLNEENTDL---IKELETRLATSREESNKTFASLNNEIDDIRRNH 651

Query: 669  SDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETL 728
            S    +   E++SR LAE+R KL+ N+L L+K EN+QL+KR + LQ   LKQD +TQETL
Sbjct: 652  SQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQRTQETL 711

Query: 729  NEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQK 788
             EY+SCK  L+  + EL  ++ +  +   +E++LK ++  +S E+  L+ +V+QLQ+LQ 
Sbjct: 712  KEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDITIVSKERNELKELVSQLQSLQT 771

Query: 789  ERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLK 848
            ERE + + T+   Q ++D +E    ++  +  +KD+ IK+LE +  S IEWYQNKI+ +K
Sbjct: 772  EREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIKELESNRLSEIEWYQNKIDAIK 831

Query: 849  KDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTIND----DSLRKE 904
            +  ++    + +K  EI +L +++K L+K++  ++ R+  Y V++ + N     ++L+ E
Sbjct: 832  EKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVTAYKVLNNSDNVGTKMETLQNE 891

Query: 905  LEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEK 964
            LEKSKI+L++AY+++ +YK+      + L+   +  EE+ K+F  +I+ L  ++  L + 
Sbjct: 892  LEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEETKKEFIRKIETLQKDRDELLDT 951

Query: 965  ISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKD 1024
             S+L EQI +LNNELD QNK   EEK+E  KK++ L   N  +E V ++YE KLS +Q D
Sbjct: 952  KSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQND 1011

Query: 1025 LDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKEN 1084
            L+QQ  YAN AQNNYEQELQKHA+++KTIS+LRE  HTYR +++++  +    E  L++N
Sbjct: 1012 LEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRKN 1071

Query: 1085 ERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSILL 1144
            E+ W  QRK+  +Q+ +   RIEDL+SQNKLL+DQ++L + ++      +       ++L
Sbjct: 1072 EKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNEDLVL 1131

Query: 1145 SLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHED 1204
            SLR +RDIL T+++V E + K LR K+S ++ EL   R KL   R + E     +++H++
Sbjct: 1132 SLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTEIRQQYENTKISVEEHDN 1191

Query: 1205 IMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALKYSMQEK 1264
            IM +LNQLNLLRESNITLR          + LQ +L+ L++ + P+E+E   LK  ++E 
Sbjct: 1192 IMNQLNQLNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKEVIKEN 1251

Query: 1265 EQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEER 1324
            EQ+L   KEE +RWK+RSQDIL KH+++   ++EKLE EI +LK  L +K ++  E  +R
Sbjct: 1252 EQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADKKKENEELNDR 1311

Query: 1325 FNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNN 1384
            FNR+++QA ER            +Q+  L++    ++  L+     I+  E  K  Q N 
Sbjct: 1312 FNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNTE-EKFRQMNK 1370

Query: 1385 QLDAIKRLQQDAEN---SSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXXXXX 1441
            Q + +  L+   E    SSKEF+ K        D     LN+ I +              
Sbjct: 1371 QSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNELTHLKESKNN 1430

Query: 1442 XXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKI------LEAQERLNQPSN 1495
              +     Q DLS +VE MKK+FEE+KI F++++T E  EK+      +EAQ    Q  N
Sbjct: 1431 EATVTG--QPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQATDTQNKN 1488

Query: 1496 I----NIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEF 1551
            +    +I   + +W+ E+EE V+ RI +AEE LK+RIRLPTEEKI+ +I++K+ +LEKE+
Sbjct: 1489 VTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEY 1548

Query: 1552 DEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQ 1611
            DEKV +R K L  S + + TF              +ED                      
Sbjct: 1549 DEKVNQRAKELL-SSEENKTF--------------IED---------------------- 1571

Query: 1612 LRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITE-- 1669
            L+ +I+ ++ + +D EL++ K K+FEEGKQQAMMKTT LE+K++K+ESQL  +    E  
Sbjct: 1572 LKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANENK 1631

Query: 1670 --------SPS--KHVNHTQNQLLGLPR----KIEENSSSSFNPXXXXXXXXXXXXXXXX 1715
                    +PS   +V   Q + L  P+    +I     S+                   
Sbjct: 1632 NDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSRAPSSLQNG 1691

Query: 1716 XXXFNPFTSPSPNKSSQKVDDQRELTTNKADPPTHLTPSF 1755
                NPFTSP             + T N A+ P    P+F
Sbjct: 1692 SDSSNPFTSPF------------QQTKNDANIPAVTQPAF 1719

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/1710 (34%), Positives = 961/1710 (56%), Gaps = 118/1710 (6%)

Query: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83
            IA+F       VES+  +L   +  K  +F +L+S+NL+  V  +E K N S K + LK+
Sbjct: 9    IATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEKLKE 68

Query: 84   EMENLIKQNDGIRKERDDTCDK---LESEKNEKTKISNEL----ESIKRRADDLIEEKKE 136
            E++ +++ N  +R E     +K   LE+  N K    N+L    E ++   D   E  KE
Sbjct: 69   ELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKLAEINQLKTSNEGLQNNIDRANERYKE 128

Query: 137  LQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAE 196
            L  +        DE++ ELE  R +      + K L   I++LE K Q+  +S+LN ++E
Sbjct: 129  LNGS-------YDEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSE 181

Query: 197  LERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTK 256
            LER AQE+ +L+   +WLE+EL +KN+ ++ YRKKTD ++ +    +  L+SD ++EK+ 
Sbjct: 182  LERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSS 241

Query: 257  NDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEE 316
             ++L++K D                 D L+ EKQEF  E+++K +L+ L E+Q+ +++  
Sbjct: 242  KEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLEST 301

Query: 317  LDSTRGLETSNDSKKHMSEK-EDLVKELQLTKEELAQCKSECIRLXXXXXXXXXXXXXXX 375
            L   +  +T+  ++++ SE  + L +EL L + +L   + +C+RL               
Sbjct: 302  LQ--QKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQT 359

Query: 376  XXXXXXFI-----------------------------LLKKQLIKEKRAKEHLQNQIESF 406
                  +                              +LK+QL++EKR KE LQNQ+ESF
Sbjct: 360  KGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESF 419

Query: 407  ILELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDI 466
            ++ELEHK+P+INSF+ERT               H + E   K  EL +  +K+    + +
Sbjct: 420  VIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQL 479

Query: 467  QTLIKQRLDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVT 526
            + L++QR DL  Q+QYLLI  S+  D+   L ++EI FI+N++ ND + A+  DSQK+++
Sbjct: 480  EILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSND-NMASTNDSQKVIS 538

Query: 527  ERLVEFRSIIELQEKNTELLKIVRNLADRLESNENESKQSLQKI---ESETINEAKEAIL 583
            E L++F+ I +LQEKN EL+K VR LA +LE NE + K +       ++E   EAKEAIL
Sbjct: 539  EHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFAEAKEAIL 598

Query: 584  TLKAXXXXXXXXXXXXXXXXXXXXALLSNEETSHLNST--IQQLNETKRNLECQIQDLQS 641
            TL+                      L+S +   +  S+  + + +E K   E  ++DL++
Sbjct: 599  TLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLEN 658

Query: 642  NISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKA 701
             ++Q+T +S  +   L +E+  L+   S +++++ K +S++ LAEER K+  N+++L   
Sbjct: 659  RLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSK 718

Query: 702  ENDQLRKRFDCLQSTILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQN 761
            EN+QLR R   L+ ++L+QD +TQ+T + Y+   SK +  ET + NL+ E  L  D E +
Sbjct: 719  ENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREIS 778

Query: 762  LKQEMQKLSSEKTGLRIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASH 821
            LK E+   + EKT LRIMVTQLQ+LQ ERE LL+  +  ++ +I E+ + + +L  + S 
Sbjct: 779  LKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSE 838

Query: 822  KDQRIKQLEEDNNSSIEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDE 881
            +   I ++E++ N+  EWYQ KI+   +  + I   +  K  E+E+L  + K+LEKE++ 
Sbjct: 839  RVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELEG 898

Query: 882  NKIRLHTYNVIDGTINDD----SLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMH 937
             +IR+HTY  I+   +++     + KELEK+KI L DAYSQ++E+K L + +  +LK+++
Sbjct: 899  AQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELN 958

Query: 938  SKFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKI 997
            + F    +D+ + IK LT EK+ +E +  +LK+Q+ N+ NEL +Q++  + E+    + I
Sbjct: 959  ASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLTQTI 1018

Query: 998  SILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELR 1057
            + LQ   + +E VK  +E KL K++ DL++QT+YAN AQ NYEQELQ+HADVSKTISELR
Sbjct: 1019 AELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELR 1078

Query: 1058 EQLHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLY 1117
            EQ    +    +LT     L+  + +NE+   S+R     Q++ +  RI+D+T QN+LLY
Sbjct: 1079 EQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLY 1138

Query: 1118 DQIELYTTADKGVTDTNDKPALNS--ILLSLRRERDILDTKVTVAERDAKMLRQKISLMD 1175
            +QI+L   A+    +++D  A  S  ++LSLRRERDILDTK+ V E +   L+QK+   D
Sbjct: 1139 NQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLD--D 1196

Query: 1176 IELQEARTKLDNSRLEEE--KRPTIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXK 1233
            I+ +   TK   + LE E  +   +I  ++ I   L QLNLLRESN+TLR         K
Sbjct: 1197 IQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEK 1256

Query: 1234 RVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMS 1293
              +  +L   + ++ P++S L +    ++EK+ ++    +E  RWK R ++++EKH++++
Sbjct: 1257 DKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVN 1316

Query: 1294 SSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDL 1353
              DY KLE  ++  K  LD K ++  E  +RFNRL++QA E+            EQ+++L
Sbjct: 1317 VDDYTKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNL 1376

Query: 1354 KNAKIKLEKSLD---DANTKI-EELENAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEE 1409
             + K  + K LD   + N+++  EL N + +Q  N L+ ++       + S+E + KL+ 
Sbjct: 1377 ISEKDDIRKQLDVKTEENSELLSELNNFREKQ--NDLETLREELNKEISKSEELEVKLQN 1434

Query: 1410 KATFYDSTIKKLNEEIITXXXXXXXXXXXXXXXXSEPANEQNDLSKIVESMKKTFEEDKI 1469
            +        +  N+EI                  S  A+EQ +  + VE++K+ FE  K 
Sbjct: 1435 EIESSSLASRNTNKEI-EELQKVIDDLKTQLAANSTDADEQTN--RNVEAIKREFENQKT 1491

Query: 1470 NFIREKTKEVNEKILEAQERLN-------QPS---NINIDELKIKWKAEHEEEVVNRIRE 1519
             FI EKT+E N++++E  E++        +P    N++++ L+ +W+ + EE +  RI E
Sbjct: 1492 KFIAEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAE 1551

Query: 1520 AEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIR 1579
            AE+ LKKRIRLP+EEKI+KIIE++R +LE EFD+K+ ++ + L  +              
Sbjct: 1552 AEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMND------------- 1598

Query: 1580 IQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEG 1639
                                HSN  +    ++L+  +E ++++  ++ELQ  +KK+FEEG
Sbjct: 1599 --------------------HSNEFN----NELKEALEKELKERFEDELQAARKKAFEEG 1634

Query: 1640 KQQAMMKTTLLERKLAKMESQLSETKKITE 1669
            KQQA MKTTLLERK+ K+ESQ+ E +K +E
Sbjct: 1635 KQQATMKTTLLERKIQKLESQIQEKEKDSE 1664

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/1682 (33%), Positives = 944/1682 (56%), Gaps = 102/1682 (6%)

Query: 23   AIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLK 82
            A+ASF     E + +++  +   +  K+ +F +L++ENL+ +V+ DEL+++SS K+   K
Sbjct: 20   AVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGACK 79

Query: 83   KEMENLIKQNDGIRKE------RDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKE 136
             ++ +L+++ + +R E      R   CD       E+ +  N+ ++++ R + L ++K+ 
Sbjct: 80   DQIHSLLQEIEAVRAENLQLEQRRAQCDA------ERQRSINDSDTLRARNEALEQQKQV 133

Query: 137  LQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAE 196
            L+ N+    ++L+E++ ++   + +  R   E + LR   ++LE + +   + +L  +A+
Sbjct: 134  LEANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKAD 193

Query: 197  LERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTK 256
              + +Q++++L + N+WLE +L  KN ++ +YR++T   +  +   L     D Q     
Sbjct: 194  FHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKT 253

Query: 257  NDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEE 316
               L ++N                  D L+S KQEF+ E++LKQRLV+LLE Q++A+K E
Sbjct: 254  IKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSE 313

Query: 317  LDSTRGLETSNDSKKHMSE---KEDLV-KELQLTKEELAQCKSE-CIRLXXXXXXXXXXX 371
            L+     + S D+    S+   +++LV K  QL + EL   K E  +             
Sbjct: 314  LEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKTISG 373

Query: 372  XXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTXXXXX 431
                        +LKKQ+I E+R KE LQNQ+E+F++ELE+KVP+++SFK+R D      
Sbjct: 374  SQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKEL 433

Query: 432  XXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSK 491
                      S +K+    +L     +++  E+ I  L +QR DL RQVQYLLI  +V  
Sbjct: 434  AETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVRG 493

Query: 492  DSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKIVRN 551
            DS GPL  EE  F++ ++ N  +T  + D+Q I++ERLVEF++I+ELQ KN +LL  VRN
Sbjct: 494  DSHGPLSAEETAFVKKVV-NMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRN 552

Query: 552  LADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXXALLS 611
            LA++LE+ E + K   + IE++TI EAKEAI+TL+                     A+ S
Sbjct: 553  LANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAIQS 612

Query: 612  NEETSH--LNSTIQQLN-ETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDLYDSK 668
              +TSH   N  ++ +N +   N + +I++L+  +S   RE+  N+ LL  E Q+L  SK
Sbjct: 613  --QTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQELARSK 670

Query: 669  SDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETL 728
            S++ + + KEKSSR+LAEER K+  ++L LTK EN++L KR   L++ + KQD++TQET+
Sbjct: 671  SELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLAKQDTRTQETI 730

Query: 729  NEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQK 788
            +E I CKS+L     EL N   ++ L   S Q LK+  ++L+ E+  L I+VTQLQTLQK
Sbjct: 731  SELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNELTILVTQLQTLQK 790

Query: 789  ERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLK 848
            ER+ LL ++  +++ KID LE   ++L+   S K   +      ++S   WYQ KI+ L 
Sbjct: 791  ERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKIDALN 850

Query: 849  KDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGT----INDDSLRKE 904
            +  +S    +N K   I++LQ +   L  ++ + + +  +Y+V++ T       D+LR E
Sbjct: 851  ECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQTDALRSE 910

Query: 905  LEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEK 964
            LEK++I+L DA+SQ+ EYK LY +  ++L  M +  E S +D +  ++ L  E+ +L   
Sbjct: 911  LEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDALSND 970

Query: 965  ISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKD 1024
             ++LK+Q+ NLN+ELD Q   ++  K E  K    +++N   + ++K +Y+ +LSK+ +D
Sbjct: 971  AAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQYQLELSKLTED 1030

Query: 1025 LDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKEN 1084
            L+QQ +YAN AQ NYEQELQ+HADVSKTIS+LRE+   ++ +V++L  S  +L+ +L+EN
Sbjct: 1031 LNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELKKSLEEN 1090

Query: 1085 ERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSILL 1144
            E  W +Q++    Q   S+ RIEDL++QN+LL+DQI L  T    + D   K     ++ 
Sbjct: 1091 ESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPIND-ELKSEARELIS 1149

Query: 1145 SLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHED 1204
            +L+RE DIL TK+ +A+RD   L+QK+   + EL  A++++  S++  + R  +I+++  
Sbjct: 1150 TLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQVTSDTRSIMIEENSK 1209

Query: 1205 IMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALKYSMQEK 1264
            I+E+LNQ+NLLRESNITLR          + L+  +++L++ + P+E+++  L+ S+  K
Sbjct: 1210 ILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILTLQRSVGAK 1269

Query: 1265 EQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEER 1324
            ++++ L  EEV+RWK+RSQDIL K+ ++   +++KL  E+   + +     +Q +E E+R
Sbjct: 1270 DKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQQRSELEDR 1329

Query: 1325 FNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIE------------ 1372
            F RL++QA+ER             ++ + + ++  LE +LD    K              
Sbjct: 1330 FQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEEN 1389

Query: 1373 ELENAKAEQDNNQLDAIKRLQQDAENSSKEFKTK-------LEEKATFYDSTIKKLNEEI 1425
            E+EN+ A +D  Q DA+++L +DA+    E  T        L E+       +K+L E +
Sbjct: 1390 EIENSSATRDQLQ-DALQKL-EDAQARINEMSTAPSQEEQTLREELERTRQHVKQLEEHL 1447

Query: 1426 ITXXXXXXXXXXXXXXXXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILE 1485
                               E  N+ +     +  +K    +     + EK  E+ EK   
Sbjct: 1448 --------AKTQNEVRVLEEAKNQVSGTEAEIARVKTELIDHSNKLLAEKEAEIKEKY-- 1497

Query: 1486 AQERLNQPSNI-------------NIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPT 1532
             ++RL   + +             +I+ LK +W+ E+E+  + RI EA E L+KRIRLPT
Sbjct: 1498 EKQRLEDKAELEKSLASSESLKSSDIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPT 1557

Query: 1533 EEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYN 1592
            EEKI+KIIE ++ +L++EF+ K+++R   L+    +  TF    E+  + KQ        
Sbjct: 1558 EEKINKIIENRKRELDEEFEAKLQQRTSELAGEKPLPATF---TEVMKRHKQ-------- 1606

Query: 1593 EKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLER 1652
                           E ++L+A+    M++E+D E+   KKK+F+EGKQQA MK+  LE+
Sbjct: 1607 ---------------EVEKLKAD----MKREMDEEVAQAKKKAFDEGKQQASMKSMFLEK 1647

Query: 1653 KL 1654
            K+
Sbjct: 1648 KI 1649

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1812 (31%), Positives = 945/1812 (52%), Gaps = 195/1812 (10%)

Query: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83
            +A F     + ++ IN+D++  + +KL    + KSENL+IT + D+LK+ S  K+++ K 
Sbjct: 10   VADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFKI 69

Query: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143
             +  L K  +  + ER      L  E+ ++  I    +  KR    +IE ++E++  +Q+
Sbjct: 70   HISQLAKALEDGKDER------LHFEEEKRRLIEGNSQVTKR----IIELEQEIEVERQQ 119

Query: 144  ----------TLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNS 193
                        + L+E+++EL   ++  N +    K LR  +++ ET+ Q     +L S
Sbjct: 120  KELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRS 179

Query: 194  RAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVE 253
            ++E+ R  QE+ +L+  NDWL  +L +K  Q   +R+ T   + + + +++++ S+ ++ 
Sbjct: 180  KSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIA 239

Query: 254  KTKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAV 313
            +T N  L Q                    D  +  KQE + E++LKQR++D LE  + ++
Sbjct: 240  RTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESL 299

Query: 314  KEELDSTRGLETSNDSKKHMSEKE--DLVKELQLTKEELAQCKSECIRLXXX-------- 363
            K+E+D+T+     N    + +EKE  +L++EL   K  L   +S CI+L           
Sbjct: 300  KKEMDATKN----NMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNI 355

Query: 364  ---------XXXXXXXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKV 414
                                         +LKKQL+ EKR K+ L+ Q+E+F++ELEHK+
Sbjct: 356  KLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKI 415

Query: 415  PIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRL 474
            P++NSFKER++               T  +++ K  +L      +K  E  I +L KQR+
Sbjct: 416  PVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQRV 475

Query: 475  DLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRS 534
            DL  Q+QYLL+  S+  +  GPL  EE+ F++N L N  +    +D+Q I+T+RLVEFRS
Sbjct: 476  DLAHQIQYLLVNESIKSEDGGPLSAEELQFVKN-LTNSQEITKTSDTQGIITDRLVEFRS 534

Query: 535  IIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXX 594
            ++ELQ+KN+ELL  +RNLAD LE  E E+K  +Q +E ET+ EAKE ILTL         
Sbjct: 535  VVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLEN 594

Query: 595  XXXXXXXXXXXXXALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENM 654
                         AL  N   S   +T + +     + + +++DL++ ++ + +E+  N 
Sbjct: 595  QLVILSKERDAYKALSVN--ASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENNA 652

Query: 655  SLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQ 714
               + E  +L     +IS+    EK+SR LAE+R  LL +TL+L+K + ++L+KR   LQ
Sbjct: 653  KEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDLQ 712

Query: 715  STILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKT 774
              + KQD +TQET++  I  KS L+  ++EL  LK E++     ++ LK E ++ S E  
Sbjct: 713  DILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSKESV 772

Query: 775  GLRIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNN 834
              ++++ QLQTLQ+ERE LL ET+ SY+ K+ +LE    EL G      +R++++E+ N 
Sbjct: 773  EYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEI---ELSGSL----ERLEEIEK-NT 824

Query: 835  SSIE--------WYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRL 886
            + I         W+Q KI+ L  +      ++ +K+A+++K+Q  +     ++ E + R 
Sbjct: 825  TGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARA 884

Query: 887  HTY----NVIDGTINDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEE 942
             +Y    NV D     ++LR+ELEK  + L+D+YSQI+ +K L E + +S+ ++   FEE
Sbjct: 885  QSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEE 944

Query: 943  SSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQN 1002
            + K+    I  L NE++ L+  +++L +Q+ +LNNE+  Q    + E+    ++IS LQ 
Sbjct: 945  AQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQM 1004

Query: 1003 NNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHT 1062
              + V+  K++YE K++ IQKDL+ QT YAN +Q +YE ELQKHADVSKTI+ LR +  +
Sbjct: 1005 VKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQS 1064

Query: 1063 YRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIEL 1122
            Y+  + TL          LK +E+ W  Q+    ++L     R+++L++QNKLLYDQIEL
Sbjct: 1065 YKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIEL 1124

Query: 1123 YTTADKGVTDTNDKPALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEAR 1182
                +    D ++    + +L+SLRRERD+L+TK+ VA  +  +L+Q++ +   E+++  
Sbjct: 1125 LNKTE----DRDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLN 1180

Query: 1183 TKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDK 1242
            T+L   +    +   +++Q E+IM++L+QL+LLRESN+TLR            L+S+L +
Sbjct: 1181 TQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQE 1240

Query: 1243 LKQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEH 1302
                +AP++S +++L+  ++ KEQEL  +KEE  RWK RSQDIL K+ ++   ++ KL+ 
Sbjct: 1241 CNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKE 1300

Query: 1303 EIDSLKVKLD--EKTRQGAEAEE-----RFNRLRRQAQERXXXXXXXXXXXXEQVNDLKN 1355
            EI+ +K +L   + T Q   AE+     +F R+R QA++R             ++N +  
Sbjct: 1301 EINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINE 1360

Query: 1356 AKIKLEKSLDDANTKIEELE----------NAKAEQDNNQLDAIKR----LQQDAENSSK 1401
            AK ++E  L    T  +ELE            K +  N+QL  ++     +Q   EN+SK
Sbjct: 1361 AKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASK 1420

Query: 1402 --EFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXXXXXXXSEPANEQNDLSKIVES 1459
              +     +EK      T++ LN +I                  +   NE  D   IV++
Sbjct: 1421 TEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINE--DTKSIVDN 1478

Query: 1460 MKKTFEEDKINFIREKTKEVNEKILEAQERL----------------------------- 1490
            +K  FE +K   I++K KE+  K    +E                               
Sbjct: 1479 LKTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSREEELRKQFEEREKRIREECEKTTVQ 1538

Query: 1491 --NQPS-NINIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDL 1547
              +QP+ +I+ID LK +W+ E+E++ + +I+ AEEALKKRIRLPT++KI KI+E ++  L
Sbjct: 1539 SPSQPTLDIDIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVL 1598

Query: 1548 EKEFDEKVEERI-KLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISI 1606
            E+ F+EKV E+  KL  + G   +T +K                                
Sbjct: 1599 EESFEEKVNEKAQKLAGEIGNDAITLEKH------------------------------- 1627

Query: 1607 DERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKK 1666
              R +L A ++  MRK+ + +L  IK+KSFEEGKQQ  +K   LE K+  +E Q S  K 
Sbjct: 1628 --RAELNA-LKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKSTIKP 1684

Query: 1667 ITESPSKHVNHTQNQLLGLPRKIEENSSSSFNPXXXXXXXXXXXXXXXXXXXFNPFTSP- 1725
            +    S      Q  + G        S S+F                      +PF++  
Sbjct: 1685 VENDTSNMSAAFQAPVFG--------SHSTFT---------------------SPFSTSE 1715

Query: 1726 -SPNKSSQKVDD 1736
             SPNK  + +DD
Sbjct: 1716 ISPNK--RPIDD 1725

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/1346 (36%), Positives = 791/1346 (58%), Gaps = 60/1346 (4%)

Query: 27   FFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKKEME 86
            F G    ++ +++  ++ ++  K  +F +L++ENL+ +V+ DEL+++S +K+   K ++ 
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 87   NLIKQNDGIRKERDDTCDKLESE-KNEKTKISNELESIKRRADDLIEEKKELQCNQQRTL 145
             L+++ + +R E     +K++ E  +EK +  N+ E+++ R + L ++K+ L+ ++    
Sbjct: 82   LLLQELESLRGE-SAQFEKMKLELTSEKQRALNDSETLRVRKEALEQQKQALESSKNDVA 140

Query: 146  KILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELERKAQELN 205
            ++L+E++ EL   + + +    E +RLR   +DLE++ +   + DL  +AEL R +QEL+
Sbjct: 141  RLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELS 200

Query: 206  ILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQKND 265
            + +S ++WLE +L  KN ++ +YR  T   +  +  +L  L  + Q     N  L + N 
Sbjct: 201  LCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRTNKSLREHNA 260

Query: 266  XXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKE--ELDSTRGL 323
                             D L+SEKQEF+ E++LK+RLVDLLE Q+ ++K   EL ST G 
Sbjct: 261  RITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAG- 319

Query: 324  ETSNDS---------------KKHMSEKEDLVKELQLTKEELAQCKSECIRLXXXXXXXX 368
            E  + S                + + E E  V++L+ T ++L     E  RL        
Sbjct: 320  EGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKES-RLKSSAHEYP 378

Query: 369  XXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTXX 428
                           LLK+Q+I EKR KEHLQNQ+E+F++ELE KVP+++SFK+R D   
Sbjct: 379  ASVTDLYGD----ISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLE 434

Query: 429  XXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNS 488
                         S +K +   +L     ++   E  I  L +QR DL RQVQYLLI  S
Sbjct: 435  EQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQAS 494

Query: 489  VSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKI 548
            V  DSKGPL  EEI F++ IL+   D + E D+QK+++ERLVEFR I+ELQ KN++LL+ 
Sbjct: 495  VRSDSKGPLTTEEIAFVRRILEQ-GDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRT 553

Query: 549  VRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXXA 608
            +RNLAD+LES E +SK   + +E++ I EAKEAI+TL+                     A
Sbjct: 554  IRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKA 613

Query: 609  LLSNEETSHLNS-TIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDLYDS 667
            +  +  T++ N  T   L  +K  +  ++ DL+ ++     E+ +NM +LN EIQ+L   
Sbjct: 614  IQPS--TNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQ 671

Query: 668  KSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQET 727
            K+ ++I++ KE++S+ LAEER K+   +L LTK EN++L KR+  +Q  +LKQD+KTQET
Sbjct: 672  KTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQET 731

Query: 728  LNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQE----MQKLSSEKTGLRIMVTQL 783
            L+  I C+SKL   E+EL +       KI+S  + +++    +++L++E+  L I+VTQL
Sbjct: 732  LSCLIECQSKLATLESELKS----SVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQL 787

Query: 784  QTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNK 843
            QTLQ ER+ LL ET KSY+ K+D LE   ++L+ + S KD+      + N+S  +WYQ K
Sbjct: 788  QTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEK 847

Query: 844  IEVLKKDNES--IICSMNDKQAEIEK-LQHKVKSLEKEIDENKIRLHTYNVIDGT----I 896
            I+ L   NE+  ++ S  + QA+  + L+ + K LE  + E + +  +Y+V++ T     
Sbjct: 848  IDSL---NETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLA 904

Query: 897  NDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFE----ESSKDFSNRIK 952
              ++LR ELEKSKI L DAYSQI+E++  Y++  ++L  + + FE    E SKDF N   
Sbjct: 905  QTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGN--- 961

Query: 953  NLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKS 1012
             +  ++  L  ++  LK QI NLNNEL  Q K    EK E   ++  LQ+  + + ++K 
Sbjct: 962  -MKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKE 1020

Query: 1013 EYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTL 1072
             YE +L K+ +DL+QQ  +AN AQ NYEQELQ+HADVSKTIS+LRE+   Y+ Q + L  
Sbjct: 1021 HYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVLQS 1080

Query: 1073 SRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYT---TADKG 1129
            S  QLE TL E++  W +Q++    QL S N RIEDLT QN LL DQ++L      ++ G
Sbjct: 1081 SIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELG 1140

Query: 1130 VTDTNDKPALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSR 1189
             ++  +K  +  ++ SLRRERDIL TK+ V++R   +  +K+  ++ EL  A+ +L + +
Sbjct: 1141 QSEPQEK--VRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQ 1198

Query: 1190 LEEEKRPTIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAP 1249
                +   +  +H  ++E+LNQLNLLRESNITLR          + L+ ++D L+Q + P
Sbjct: 1199 ALSSQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQP 1258

Query: 1250 IESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKV 1309
            +ESELA+LK S++ K+ ++ L  EE +RWK+RSQDIL K  ++   +++KL  E+   K 
Sbjct: 1259 LESELASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKA 1318

Query: 1310 KLDEKTRQGAEAEERFNRLRRQAQER 1335
            +L  K  Q +E E+RF RL++QA+ER
Sbjct: 1319 ELAAKADQNSELEDRFQRLKKQARER 1344

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1722 (30%), Positives = 919/1722 (53%), Gaps = 118/1722 (6%)

Query: 1    MPDHDISIKSVQNSDNTDERLKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSEN 60
            M DH I  K+   ++  D     +A+  G    QV+ +   L++ L  +   F +L++EN
Sbjct: 1    MSDH-IESKAESKAEEVD--YSRLAARLGLEQGQVQQLGEQLVRTLWGREQAFRQLEAEN 57

Query: 61   LQITVSFDELKTNSSKKIDNLKKEMENLIKQNDGI-RKERDDTCDKLESEKNEKTKISNE 119
             ++ VS    ++     ++ L++  + L  +     R + +          +   ++  +
Sbjct: 58   TRLKVSIGAAESACEHGVEALRERQQQLAAEAGAQQRGQGEAGSAGRAGGPSVPERVQQQ 117

Query: 120  LESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDL 179
            LE  +RR       +++L        ++L+E++ +L+ ++ +  R     K LR   ++L
Sbjct: 118  LEETERRVAAGDSARRDL-------ARLLEEKISDLDASQQELERVLGVNKELRRHEMEL 170

Query: 180  ETKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEI 239
            E   Q   +  L  +AE++R  QEL +++S  +W   +L  KN+Q  SYR+KT+  I   
Sbjct: 171  EFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQST 230

Query: 240  RNELNHLRSDFQVEKTKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLK 299
            + ELN ++++ +VE      L  KN                  D L SEKQEF+ E+ LK
Sbjct: 231  QVELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALK 290

Query: 300  QRLVDLLESQLNAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIR 359
            QRL++LL  Q+  +K++L+  +  + + +     SE+E L+ +L  TK++L   ++   R
Sbjct: 291  QRLIELLNGQVATMKQDLE--KAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSR 348

Query: 360  LX--------------------XXXXXXXXXXXXXXXXXXXXFILLKKQLIKEKRAKEHL 399
            L                                            L+KQL++E+R KE L
Sbjct: 349  LEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEEL 408

Query: 400  QNQIESFILELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKL 459
            Q Q+ESF++ELEHK+P++NSFK+R +               T+ E++ K+ ++     K+
Sbjct: 409  QLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKV 468

Query: 460  KQCENDIQTLIKQRLDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATET 519
               E  +  L++QR DL RQVQ LLI  SV  DS GPL  EE+ F++  LQ+  D+AT +
Sbjct: 469  GDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKK-LQSCRDSATGS 527

Query: 520  DSQKIVTERLVEFRSIIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAK 579
            D+Q I++ RLVEF+S++ELQ+KN ELL  +R LA +LE  E++++  ++ +E  T+NEAK
Sbjct: 528  DTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAK 587

Query: 580  EAILTLKAXXXXXXXXXXXXXXXXXXXXALLSNEETSHLNSTIQQLNETKRNLECQIQDL 639
            EAIL+L+                      L+S  + + L + +       + +   I  L
Sbjct: 588  EAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHL 647

Query: 640  QSNISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLT 699
            ++ +  +  ES ++  +LN+EI+ LY S S ++I+L +E+SSR LA+E+  L+  +L+L 
Sbjct: 648  EARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELV 707

Query: 700  KAENDQLRKRFDCLQSTILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSE 759
            K EN  L+ R   LQ+ +L+QD++ Q T+ E++S KS+L    ++L  L+ E+      E
Sbjct: 708  KGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVE 767

Query: 760  QNLKQEMQKLSSEKTGLRIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEA 819
             +LK+E + L+ +    ++++ QL+T QKER++L++ETRK Y+ +I+EL+   +  K + 
Sbjct: 768  ADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQL 827

Query: 820  SHKDQRIKQLEEDNNSSIEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEI 879
              K +   +L   +++  +W+Q+K++ LK++  S   ++  K +E++ L+ ++ S   ++
Sbjct: 828  ERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKL 887

Query: 880  DENKIRLHTYNVI---DGTINDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQM 936
            +   +     +++   D      SL K+L+++   L+ AYS+I+ YK    +NA     +
Sbjct: 888  EPASMDHQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYK--AASNATERPSL 945

Query: 937  HSKFEESSKDFSNRIK-NLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRK 995
                 + +KD S +   +L  E + L   I++  ++I  L +EL+ +      E++E ++
Sbjct: 946  SYNAVQDNKDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQE 1005

Query: 996  KISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISE 1055
            KI+ L  + + +E  K++Y+ K++++Q DL++Q    N A+  Y+  LQK A++S+ I  
Sbjct: 1006 KINALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIES 1065

Query: 1056 LREQLHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKL 1115
            LR+   +Y+ ++     +  +    L+ NE++W  Q+  +   L+ ++ RIE+L++QN+L
Sbjct: 1066 LRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRL 1125

Query: 1116 LYDQIELYTTADKGVTDTNDKPALNS--ILLSLRRERDILDTKVTVAERDAKMLRQKISL 1173
            LYDQIEL + +     + + K + ++  ++++LRRERDIL+TK+ V++R+ KMLRQ++ L
Sbjct: 1126 LYDQIELLSRSPSSSLEPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLEL 1185

Query: 1174 MDIELQEARTKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXK 1233
               EL   R +L  S+    +     Q  E++ EKLNQLNLLRE N++LR          
Sbjct: 1186 TKSELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHN 1245

Query: 1234 RVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMS 1293
              LQ+E+  L++ + P+E ++ +L  ++ EKEQ+L L KEE  RWK+RSQDIL K+ ++ 
Sbjct: 1246 EFLQNEILSLQEKVQPMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERID 1305

Query: 1294 SSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDL 1353
              +Y KL  EI+ LK +L+ K+ +  +++ERF +LR+QA ER             ++   
Sbjct: 1306 PEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELA 1365

Query: 1354 KNAKIKLEKSLDDANTKIEELEN-----AKAEQDN---NQLDAIKRLQQDAENSSKEFKT 1405
             + K +LE  L +A  KI  LE        +E DN   ++L+  K   QDAEN+    K+
Sbjct: 1366 LSGKSQLEAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKS 1425

Query: 1406 KLEEKATFYDSTIKKLNEEIITXXXXXXXXXXXXXXXXSEPANEQNDLSKIVESMKKTFE 1465
            +       +   + +LN+++ T                S+P++     + ++E  KK  E
Sbjct: 1426 EWSISEESFKKQLDELNKQLET-----IQKNSAPSSGHSDPSSYHEQPTAVLEDFKKQVE 1480

Query: 1466 EDKINFIREKTKEVNEKILEA-------------QERLNQPSNI-------NIDELKIKW 1505
            E++   I    +E+  + LEA             +E  +  +N+       N++ LK KW
Sbjct: 1481 EERRTLIESHQQELTAR-LEASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKW 1539

Query: 1506 KAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKV-EERIKLLSQ 1564
            + E+E++ + RIREAEEALKKRIRLP+EE+I+++IERK++ LE+EF  KV    + LL +
Sbjct: 1540 EEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKE 1599

Query: 1565 ------SGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIET 1618
                  S + D+    Q EI +Q K K+L DK+                           
Sbjct: 1600 NPDSIASDKADLIKDHQKEI-VQLK-KDLADKF--------------------------- 1630

Query: 1619 KMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQ 1660
                  + +L  +KKK+FEEG+QQ +MK  LLE K++K+ESQ
Sbjct: 1631 ------EGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQ 1666

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1717 (32%), Positives = 923/1717 (53%), Gaps = 115/1717 (6%)

Query: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83
            +ASF   S + V++++  ++K LN++  +FN +++E ++I+   +  K  ++  I  LK 
Sbjct: 24   VASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVTKKTNNTTIKKLKN 83

Query: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143
            E+  LI   + + KE++D   K+  E+ +K    +ELES   +   L E   ELQ  +Q 
Sbjct: 84   ELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNRDELESKLIQIHSLEENVSELQSKKQE 143

Query: 144  TLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELERKAQE 203
             +K LD+R+ EL   R +    +NE  + R+ I+ LE + QDL  +DL+ R +LER +QE
Sbjct: 144  LIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERLSQE 203

Query: 204  LNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQK 263
            L  +     WLE+ L  K EQ+ SYR+K+     +++ +LN ++++    K+ N VL ++
Sbjct: 204  LETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVLQER 263

Query: 264  NDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELDSTRGL 323
             D                    +++K     E+ LKQ+L+ +L+SQLN ++ E  +   L
Sbjct: 264  TDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNELSL 323

Query: 324  ETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLXXXXXXXXXXXXXXXXXXXXXFI 383
             T +D+     +  D  +E+   K +L   +   + L                       
Sbjct: 324  -TVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVSNSTSSDDLR 382

Query: 384  -----------LLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTXXXXXX 432
                       +LKK+L  E+  +E+ +  +E F+ +LE ++P + +++ R         
Sbjct: 383  NSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLEAYRHRAAAREEELK 442

Query: 433  XXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSKD 492
                     + EK+    EL+    +++  E +I+ + KQR DL  Q+Q+ L+ NSV+ D
Sbjct: 443  EATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLANQLQFFLVHNSVAND 502

Query: 493  SKGPLRKEEIMFIQNILQNDSDTA-TETDSQKIVTERLVEFRSIIELQEKNTELLKIVRN 551
            S GPL  EE+ FI+NI+Q D +    ETD+QK+++ERL +F+ IIELQ+KN ELLK  R 
Sbjct: 503  SAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIELQQKNMELLKTTRE 562

Query: 552  LADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXXALLS 611
            LA +LE  +   +    +IE ETI EAKEAILTL+                      +LS
Sbjct: 563  LATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQ-NYNSSLTAKIAALTKELETYKVLS 621

Query: 612  NEETSHLNSTIQQLNETKRNLECQ-IQDLQSNISQITRESTENMSLLNKEIQDLYDSKSD 670
            N E S   +   +  E +     Q +++L++ I+ I +ES EN ++LN +I  L +  + 
Sbjct: 622  NTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANILNDKIFALDEKNNH 681

Query: 671  ISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETLNE 730
            ISI+L +EKS++ LAEER KLL  ++D+T  EN++L+KR + L++ +++QD +T ET+N 
Sbjct: 682  ISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVVVEQDKRTHETINS 741

Query: 731  YISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQKER 790
             I  +S+L   E +    + E KL   SE+ LK E+ +L+ EK  ++++VT+LQTLQ ER
Sbjct: 742  LIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMKLLVTRLQTLQSER 801

Query: 791  ENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLKKD 850
            E+LL  T+  +  ++++LE   N+L+ +    ++    L E+     + ++ K + LK++
Sbjct: 802  EHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLMEETTELKDDFRQKKKSLKEE 861

Query: 851  NESIICSMNDKQAEIEKLQHKVK----SLEKEIDENKIRLHTYNVI---DGTIND-DSLR 902
                + ++  + +EI + + + K     L K++ E    +  Y      +G + +  SL+
Sbjct: 862  ----MSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQ 917

Query: 903  KELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLE 962
            KEL+  K  LT++YSQ + Y++  E   +S+  ++ +       F  RI  +   K+++ 
Sbjct: 918  KELQVLKNELTESYSQTESYRKDIELLNQSIADINKQVLNKEAAFKERITEVELAKNNIA 977

Query: 963  EKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQ 1022
            +  ++LK QI +LNNEL++Q K  ++EK  F +  + L+   K +E  K +YE KL  + 
Sbjct: 978  DSNTVLKTQIDDLNNELEVQKKLYEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLM 1037

Query: 1023 KDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLK 1082
            KDL++Q  YAN AQNNYEQELQ HA+VSKTIS+LREQ   YR ++  LT+S    +  L 
Sbjct: 1038 KDLEEQVKYANKAQNNYEQELQNHANVSKTISQLREQTQHYRTEIAELTISATDAKRLLN 1097

Query: 1083 ENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSI 1142
            EN+ SW  QR    +Q+E    RIE+ + QNK+L++Q +L T A+    D  +   +NSI
Sbjct: 1098 ENQISWQKQRDEYEKQIEFFKKRIEEESEQNKMLFEQSKLTTQAND--EDNAESSGVNSI 1155

Query: 1143 ------LLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRP 1196
                  +LSLR ERD+L  ++ V E + K+LR++++ ++ + +    +L   + E    P
Sbjct: 1156 EGDNKLVLSLRSERDLLQERLNVTEAEEKLLRERLTSIEKDFRATDLELQKIKEETHNYP 1215

Query: 1197 TIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAA 1256
             +++QH+ +M +L QL+LLRESNITLR          + LQ+E++ L   + P+E+EL  
Sbjct: 1216 DLLEQHKTVMSQLTQLDLLRESNITLRNETIELQSKNQHLQTEVENLHDKLLPLETELQT 1275

Query: 1257 LKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTR 1316
            L   ++EK+++L +  EE  RWK+RSQDIL K++++   ++E L  E + L+ +L+EK++
Sbjct: 1276 LTNLIEEKDKQLSICHEESERWKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSK 1335

Query: 1317 QGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDL--------------KNAKIKLEK 1362
            +  E   RF +L++QA E+             Q+NDL              K  K+ LEK
Sbjct: 1336 ENEELGNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEK 1395

Query: 1363 SLD----------DANTKIEELENAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKAT 1412
             L+             +++EE      + +   +++++  +Q  EN + E K KL+E+++
Sbjct: 1396 RLEVTMKNSHDIVSIQSQLEEALMKSKDFETKFINSVESSKQIEENLNSEIK-KLQEESS 1454

Query: 1413 FYDSTIKKLNEEIITXXXXXXXXXXXXXXXXSEPANEQNDLSKIVESMKKTFEEDKINFI 1472
                   KL EE+                  +      ND   IVESMK++FEE+KI FI
Sbjct: 1455 -------KLQEELAHEKLTTSTTEIGNVDQDTVDGGVSND---IVESMKQSFEEEKIKFI 1504

Query: 1473 REKTKEVNEKI------LEAQERLNQPSNINIDELKIKWKAE--HEEEVVNRIREAEEAL 1524
             E+T E  +K+      L+A+    Q   ++IDE  I+ + E  +E+    RI+EAEE L
Sbjct: 1505 EEQTTEFKKKLQAEINKLKAEYETKQIEPVSIDENAIRKQIEEEYEQATSQRIKEAEENL 1564

Query: 1525 KKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQ 1584
            K+RIRLPTEEKI+K+I+++R  LE EF  KVE R K L    + +  F            
Sbjct: 1565 KRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFF------------ 1612

Query: 1585 KELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAM 1644
                                     D+++ EI+ ++ ++ + ELQ +KKK+F+EG+QQ +
Sbjct: 1613 -------------------------DRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVL 1647

Query: 1645 MKTTLLERKLAKMESQLSETKKITESPSKHVNHTQNQ 1681
            MKT+ LE+K+ K+ES L   K  T +    +  T N+
Sbjct: 1648 MKTSFLEKKITKLESDLQNAKSNTGATDNTIVSTDNE 1684

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  462 bits (1188), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 372/1112 (33%), Positives = 599/1112 (53%), Gaps = 26/1112 (2%)

Query: 283  DCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEEL----------DSTRGLETSNDSKKH 332
            D L   K + + EI +K +L+DLL+ QL++ +EEL               LE+ N++ K 
Sbjct: 256  DNLLVTKDDMNKEIAMKSKLIDLLQGQLSSTQEELRQNVELNSKFTKFPDLESQNETLK- 314

Query: 333  MSEKEDLVKELQLTKEELAQCKSECIRLXXXXXXXXXXXXXXX--XXXXXXFILLKKQLI 390
             S+ +DL  +++  + E     S   ++                         LLKKQ+ 
Sbjct: 315  -SDIQDLTLKIEELQNENFNLNSMINQMSNEQNNSNNSSSIDSNLPTLYSKINLLKKQVT 373

Query: 391  KEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIR 450
            +EK  K+HLQ QIESFI+ELE+K+PII+SF+E+                 TSNEKN    
Sbjct: 374  QEKLEKKHLQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQN 433

Query: 451  ELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQ 510
            +L+    KL   +++I+ LI+QRLDL  QV++LL+  +V  DS GPL +EEI FI  I  
Sbjct: 434  KLNNYDSKLLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISN 493

Query: 511  NDSD-TATETDSQKIVTERLVEFRSIIELQEKNTELLKIVRNLADRLESNENESKQSLQK 569
            N  D   +E  SQ +++ERLV F +I ELQ KN ELL  +R+L++ LE+ EN +  S ++
Sbjct: 494  NSEDLNGSELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENAN--SHKE 551

Query: 570  IESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXXALLSNE---ETSHLNSTIQQLN 626
             +++TI +AKEAILTL+                      LL+N    ++S  N  +    
Sbjct: 552  FQNKTIADAKEAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSST 611

Query: 627  ETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAE 686
              + N E  I+ LQ+ I ++  E  +N   L  +I      KS+++I L KEKSS  L  
Sbjct: 612  SPETN-EKSIEKLQTLIEELKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMA 670

Query: 687  ERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETLNEYISCKSKLNICETELY 746
            E+  L  +  D+ K EN +L KRF+ LQ+ I+KQ+SK  + +N+YI+ +++++  +T+L 
Sbjct: 671  EKISLTESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLS 730

Query: 747  NLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQKERENLLDETRKSYQNKID 806
              K E+   + S+ +L  E+ K S EK  LRIM++QLQ+LQ ER  LLD+T+K + +KI 
Sbjct: 731  IAKSEKDFLVKSQDSLNSELIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIH 790

Query: 807  ELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLKKDNESIICSMNDKQAEIE 866
            ELE+ + +L      K   I++L   N S   WYQN I+ LKK N +I   +  K + I 
Sbjct: 791  ELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLIS 850

Query: 867  KLQHKVKSLEKEIDENKIRLHTYNVIDGTINDDS-LRKELEKSKISLTDAYSQIQEYKEL 925
             L  K++ LE +       + T      + ND S + K+L+ +K+ L++AY+Q++EYK+L
Sbjct: 851  DLNTKIELLESQ----SYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQL 906

Query: 926  YETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKG 985
            Y +  +SLK + S FE       ++I  L +E  +L+       ++I  L+ +L  +   
Sbjct: 907  YTSTEESLKTLESNFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNK 966

Query: 986  MKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQK 1045
              EE A+   +I+ L    K+     SEYE K+SK+Q  L+ +  +A+ AQ  YE  L K
Sbjct: 967  YSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTK 1026

Query: 1046 HADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIEQLESSNSR 1105
                 ++I E +EQ+     ++  +     +  S L ENE  W  ++ A I  LE S  +
Sbjct: 1027 DNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKK 1086

Query: 1106 IEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSILLSLRRERDILDTKVTVAERDAK 1165
            I++LT+QNKL  DQ+EL       +  +        +   LR +RD+L+TK+++AERD+K
Sbjct: 1087 IDNLTNQNKLYVDQLELLNKDFSSMDSSQLSSETKHMFNRLRADRDVLETKLSIAERDSK 1146

Query: 1166 MLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNITLRXX 1225
                K+  +  EL   + KL +S  +  +   +I+ HE I+ +LNQ+ L +ESN TLR  
Sbjct: 1147 NNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQ 1206

Query: 1226 XXXXXXXKRVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDI 1285
                    + LQ++L++    ++ +  EL ++K S+ +KE ++ L KEE ++W+ R++++
Sbjct: 1207 VSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEEL 1266

Query: 1286 LEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERXXXXXXXXXX 1345
              +  ++      KL  E+D+LK   + K +Q AE EERFN L++QA ER          
Sbjct: 1267 SVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSS 1326

Query: 1346 XXEQVNDLKNAKIKLEKSLDDANTKIEELENA 1377
              +Q+N+LK +   +E +L     K  +L+N 
Sbjct: 1327 LNKQINELKASNTNIELALSSEQKKSMDLQNT 1358

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  403 bits (1035), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 426/1562 (27%), Positives = 789/1562 (50%), Gaps = 106/1562 (6%)

Query: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83
            I+ F    FE ++ +   +++ L  K+ +F   + E  ++ V  DE+K+    +I  LK+
Sbjct: 5    ISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRISKLKQ 64

Query: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143
             ++   +Q +  ++E +   D+L           NE  S  RR  D +  KK+L  + + 
Sbjct: 65   LLDESSEQKNTAKEELNGLKDQL-----------NEERSRYRREIDAL--KKQLHVSHEA 111

Query: 144  TLKILDE-RLKE-LEIARSDNNRSDN-------ECKRLRSTIIDLETKQQDLITSDLNSR 194
              ++ DE R+KE  +I +S +  +D+       E K LR  ++++E   Q   ++ ++ +
Sbjct: 112  MREVNDEKRVKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQ 171

Query: 195  AELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEK 254
             + +   QE  ++  +   +E++L S +++ L+        +  +  +L  ++S+++   
Sbjct: 172  LKYDTSVQEKELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVF 231

Query: 255  TKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVK 314
            T N  L  +N                  D  S EK EFS E+ L++ + DLL SQL +++
Sbjct: 232  TYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLE 291

Query: 315  EELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLX---------XXXX 365
            ++  S R +E ++D+     E  D++ EL  TK  L + K+EC RL              
Sbjct: 292  KDC-SLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEAT 350

Query: 366  XXXXXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTD 425
                              +LK+QLIKE+  K  LQNQ+E FILELEHK P + SFKERT 
Sbjct: 351  MTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTK 410

Query: 426  TXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLI 485
            +               S  K  + RE+++  +K+  CE +I +L+KQRLDL RQV+ LL+
Sbjct: 411  SLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLL 470

Query: 486  TNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTEL 545
              S  +++  PL ++E++ ++ IL++ S+   E DSQ I+TERLVEF ++ ELQEKN EL
Sbjct: 471  NTSAIQETASPLSQDELISLRKILES-SNIVNENDSQAIITERLVEFSNVNELQEKNVEL 529

Query: 546  LKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXX 605
            L  +R LAD+LE+ E +  ++LQK+E++TI EAK+AI+ L+                   
Sbjct: 530  LNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDS 589

Query: 606  XXALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDLY 665
               L S EE     +++  +   +   E +I++L++ +S    E++  +  L KE+    
Sbjct: 590  YKLLASTEENKANTNSVTSMEAAR---EKKIRELEAELSSTKVENSAIIQNLRKELLIYK 646

Query: 666  DSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQ 725
             S+      L   ++ + LA+E+ ++L   +D  KAE   L K+   + S I  +  +  
Sbjct: 647  KSQCKKKTTLEDFENFKGLAKEKERMLEEAIDHLKAE---LEKQKSWVPSYIHVEKERAS 703

Query: 726  ETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQT 785
              L++    + K+   E E+  LK+E    I ++++L ++ ++   EK  L++ + + + 
Sbjct: 704  TELSQ---SRIKIKSLEYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEI 760

Query: 786  LQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIE 845
               E +         Y+ KI ELE+    L+ +   K Q I+ +    +S ++W QN I+
Sbjct: 761  SHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTID 820

Query: 846  VLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVID----GTINDDSL 901
              +   +S++  +++K+  IEKL  ++++L+KE+ + K +   Y  +D     +  + +L
Sbjct: 821  DTEMKMKSLLTELSNKETTIEKLSSEIENLDKELRKTKFQ---YKFLDQNSDASTLEPTL 877

Query: 902  RKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSL 961
            RKELE+ ++ L DA SQIQ Y+E+  +N  +L ++ ++  ++ +++  +I+    EK + 
Sbjct: 878  RKELEQIQVQLKDANSQIQAYEEIISSNENALIELKNELAKTKENYDAKIELEKKEKWAR 937

Query: 962  EEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKI 1021
            EE +S L+ ++     E+      +KE    F ++   L+N   EVE ++   E    KI
Sbjct: 938  EEDLSRLRGEL----GEIRALQPKLKEGALHFVQQSEKLRN---EVERIQKMIE----KI 986

Query: 1022 QKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTL 1081
            +K      +      + Y+  ++++ D+S+ +  L +     + ++     S    +  L
Sbjct: 987  EKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLYSAQDLL 1046

Query: 1082 KENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNS 1141
             ++ER W  ++     +L S+  + E L  +N +L ++++  T A+ G     D   L S
Sbjct: 1047 DKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKVD-DTAANNG---DKDHLKLVS 1102

Query: 1142 ILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQ 1201
            +  +LR ER+ L+TK+T  +R+   ++QK   ++  + + +     S  E +    II +
Sbjct: 1103 LFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTLSEKEYQCSAVIIDE 1162

Query: 1202 HEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALKYSM 1261
             +DI +++ Q+N+L+E+N  L+          R +  +L+  +++I+ ++ +L   K  +
Sbjct: 1163 FKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQV 1222

Query: 1262 QEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEA 1321
                 ++ + + E+ + K+R QD+ ++ +     D EKL +EI  LK KL       A+ 
Sbjct: 1223 SINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKLTNEISDLKGKLSSAENANADL 1282

Query: 1322 EERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQ 1381
            E +FNRL++QA E+             ++N+LK  K KLE+ L   N K+ +L+      
Sbjct: 1283 ENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKLEQDLHFENAKVIDLDTKLKAH 1342

Query: 1382 DNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXXXXX 1441
            +    D  +  ++D       ++T +EE        I+ L +E+                
Sbjct: 1343 ELQSEDVSRDHEKDT------YRTLMEE--------IESLKKEL---------------- 1372

Query: 1442 XXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNI----- 1496
               + AN  +D     E +K   E++K   I E+TKE  +K+   QE LN+ ++      
Sbjct: 1373 QIFKTANSSSD---AFEKLKVNMEKEKDRIIDERTKEFEKKL---QETLNKSTSSEAEYS 1426

Query: 1497 -NIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKV 1555
             +I+ LK +W  E+E+E + RI+EAEE LKKRIRLP+EE+I KII +++E+LE+EF +K+
Sbjct: 1427 KDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKL 1486

Query: 1556 EE 1557
            +E
Sbjct: 1487 KE 1488

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  400 bits (1028), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 438/1560 (28%), Positives = 790/1560 (50%), Gaps = 104/1560 (6%)

Query: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83
            I+ +     + ++ +N  +++ L  ++ +F   + E  ++ V  DE+K+    +I  L +
Sbjct: 5    ISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRISKLNE 64

Query: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143
             +    ++ +  +KE     + L   KNE++K +       R+ D L    K+L  ++  
Sbjct: 65   LLGESSEEKNVSKKELSRLHNLL---KNERSKCA-------RKIDAL---NKQLNASKNT 111

Query: 144  TLKILDERL--KELEIARSDNNRSD-------NECKRLRSTIIDLETKQQDLITSDLNSR 194
              K+ DER   +E E+ ++++  +D       +E K LR  ++++E   Q   ++ L+ +
Sbjct: 112  ITKLNDERGVKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLK 171

Query: 195  AELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEK 254
             + +   QE  ++     W+E++L  ++E+ L         +  +  +LN  ++D++   
Sbjct: 172  LKYDTVVQEKELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVS 231

Query: 255  TKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVK 314
            T N  L  +N                  D ++ EK +FS E+ L++ + DLL SQL + +
Sbjct: 232  TNNQFLLAQNKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFE 291

Query: 315  EELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLX----------XXX 364
            +   S    E  ND     S+  ++V +L  TK +L + K EC RL              
Sbjct: 292  KNY-SLSAREKDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAA 350

Query: 365  XXXXXXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERT 424
                                LK+QLIKE+  K  LQNQ+ESFI ELE K P + SFKERT
Sbjct: 351  FDNTHNVDPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERT 410

Query: 425  DTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLL 484
            ++               S  K    +EL++  +K+  CE +I +L+KQRLDL RQV+ LL
Sbjct: 411  ESLEQELKNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLL 470

Query: 485  ITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTE 544
            +  S  +    PL  +E++ ++ +L++  D   E DSQ I+TERLVEF +  ELQEKN E
Sbjct: 471  LNISAVQKKASPLSNDELISLKKLLES-GDVPNEKDSQIIITERLVEFNNTNELQEKNME 529

Query: 545  LLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXX 604
            LL  VR LAD+LE++E +  +SL K+E++TI EAK+AI+ L+                  
Sbjct: 530  LLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERD 589

Query: 605  XXXALLS-NEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQD 663
                L S N    + ++     N+T+     +I++L+S +S    E++  +  LNKE+  
Sbjct: 590  SYKLLASANGNKIYADAA----NKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLT 645

Query: 664  LYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSK 723
               S+S+  I L +  + ++LA E+  LL   +D  K    +L K+     S+I      
Sbjct: 646  CKKSQSNGQIALQEFSNFKVLAIEKENLLQTRIDDLKT---KLEKQRSSAPSSIHGSIGS 702

Query: 724  TQETLNEYISCKSKLNICETELYNL-KEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQ 782
             +  L++Y + K+K  +C  E+ NL K+   L+   E +L +++++   EK  L++ +T+
Sbjct: 703  EETELSQYKN-KTKSLMC--EISNLSKKNTDLRCMKE-SLTRDLERCCKEKMQLQMKLTE 758

Query: 783  LQTLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQN 842
             +T   E++   D  +  Y  KI  LE    EL      K Q I+ L+   NS ++W QN
Sbjct: 759  SETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQN 818

Query: 843  KIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTY-NVIDGTINDDSL 901
             I+  +K+ +S+   +++K+  I KL  ++K LE E+ + K++     N  D    + +L
Sbjct: 819  TIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETAL 878

Query: 902  RKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSL 961
            +KELE+S+I L DA+SQI+ Y+E+  T+  +LK+++ +  ++ ++   + ++L  E ++ 
Sbjct: 879  KKELERSQIDLKDAHSQIEAYEEIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAK 938

Query: 962  EEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKI 1021
            EE+IS L+ ++  +     LQ K +KE      ++   L N  + ++A+  + +   + +
Sbjct: 939  EEEISFLRRELDEIRG---LQPK-LKEGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIV 994

Query: 1022 QKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTL 1081
            +       ++     + Y+ +L+ + D+S  +  L  ++  Y+ ++     S +  +  L
Sbjct: 995  E-------LHQEVETSQYQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELL 1047

Query: 1082 KENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALN- 1140
             ++ER W  ++     +L S+  + E L  +N  L ++I+  T  + G     DK  L  
Sbjct: 1048 DKHERKWMEEKADYERELISNIEQTESLRVENSALVEKIDDGTGENNG-----DKEYLKL 1102

Query: 1141 -SILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTII 1199
             S+  SLR ER+ L+TK+T  +RD  + +QK + ++  + + +     SR + +    II
Sbjct: 1103 VSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDII 1162

Query: 1200 QQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALKY 1259
             + EDIM+++ Q+N+L+E+N  L+            +  E   L+ +I+ ++ +LA  K 
Sbjct: 1163 DEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKE 1222

Query: 1260 SMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGA 1319
             +     ++ + + E+ +WK+R  ++ ++ ++    + EKL +EI  LK KL       A
Sbjct: 1223 QVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISDLKAKLLNAQNANA 1282

Query: 1320 EAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAKA 1379
            +  ++FNRL++QA E+             +V++LK+ K +LE+SL    +K+ ELE AK 
Sbjct: 1283 DLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMKNELEESLHSEESKVLELE-AKL 1341

Query: 1380 EQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXXX 1439
            ++   Q + + + Q+  E++SK     +EE        I+ L  E+              
Sbjct: 1342 KKHLVQAEGVSKDQE--EDTSKPL---MEE--------IELLKREL-------------- 1374

Query: 1440 XXXXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNI--- 1496
                 +   E +D S  +E MK+  E +K   I EKT E   K+ EA  + N  + I   
Sbjct: 1375 -----QVFKETSDSSDTIEKMKEIMEAEKNKIIEEKTTEFERKLEEATGK-NTGATIENG 1428

Query: 1497 -NIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKV 1555
             N++ELK +W  ++EEE + RI+EAEE LKKRIRLP+EE+I KII +++E+LE+EF  K+
Sbjct: 1429 ENMEELKKQWLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKL 1488

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  395 bits (1014), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 424/1567 (27%), Positives = 770/1567 (49%), Gaps = 97/1567 (6%)

Query: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83
            I+ F    FE ++ IN  +++ L  K+  F   + E  ++ V  DE+K+    +I  L K
Sbjct: 5    ISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRISKLSK 64

Query: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143
             +    +Q +   KE     D+L  ++          E  +R+ D L    K+L  ++  
Sbjct: 65   LLNESSEQKNIASKELSHLQDQLMQDR----------ERCRRKIDAL---NKQLDSSRDA 111

Query: 144  TLKILDER-LKELEIAR--------SDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSR 194
              ++ DE+  KE  + R        S  N  D E K LR  ++++E   Q   ++ ++ +
Sbjct: 112  IKRLNDEKDAKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQ 171

Query: 195  AELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEK 254
             + +   QE  ++     W E++L S N + L+        I  +  +L   ++D +   
Sbjct: 172  LKYDTIVQEKELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESAL 231

Query: 255  TKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVK 314
            + + +L  +N                  D    EK EFS E+ L++ + DLL SQL +  
Sbjct: 232  SYSQLLLDQNKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASF- 290

Query: 315  EELDSTRG-LETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLXX---------XX 364
             E D + G +   +D+     +  ++  EL  TK +  + + EC RL             
Sbjct: 291  -ERDHSSGEIGKDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKA 349

Query: 365  XXXXXXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERT 424
                               +L+KQLIKE+  K  LQNQ+E FILELEHK P + SFKERT
Sbjct: 350  TVDTNGASHTVGKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERT 409

Query: 425  DTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLL 484
             +               S  K    REL++  +K+  CE +I  L+KQRLDL RQV+ LL
Sbjct: 410  KSLEHELKRSTELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLL 469

Query: 485  ITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTE 544
            +  S  + +  PL K++++ ++ IL++ SD   E D+Q I++ERLVEF +I ELQEKN E
Sbjct: 470  LNTSAIQKTTLPLSKDDLISLRKILESGSD-VNENDAQAIISERLVEFNNINELQEKNVE 528

Query: 545  LLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXX 604
            LL  +R LAD+LE +E +   +L ++E +TI EAK+AI+ L+                  
Sbjct: 529  LLYCIRTLADKLEFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERD 588

Query: 605  XXXALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDL 664
                L S++E    N  +   N T+ + E +I++L++ +S    ES+  +  L KE+   
Sbjct: 589  SYKLLASSKEN---NVNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTY 645

Query: 665  YDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKT 724
                 D  I     ++ ++LA+E+  +L   ++  K +   L K+   + S +  QD+K 
Sbjct: 646  KKLLCDKKIASQDFENFKMLAKEKESILETRVNNLKTD---LEKQKLSVPSFV--QDNKV 700

Query: 725  QETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQ 784
            +++  E +  ++K  I   E+ +LK+E    +  +++L +++++   EK  L++ + + +
Sbjct: 701  RDS-TELLQSRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESE 759

Query: 785  TLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKI 844
                E++   D     Y  +I +LE +   L+ E   K Q IK L+   +S ++W QN I
Sbjct: 760  ISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELKSKAQEIKSLQSSKDSQLKWAQNTI 819

Query: 845  EVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTY-NVIDGTINDDSLRK 903
            +  ++  +S++  ++ K+  +  L  K+++L+ E+ ENK++     N  D +    +LRK
Sbjct: 820  DDTEEKLKSVLTELSRKEKTVVTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPALRK 879

Query: 904  ELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEE 963
            ELE++++ L DA+SQ++ Y+E+  TN K+LK+++S+     +D+  RI+    EK + EE
Sbjct: 880  ELEQTQLELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDYDARIELECKEKLANEE 939

Query: 964  KISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQK 1023
            ++SLL+ ++  + +   LQ K +KE      K+   L+N  ++++ +K++ +     +Q 
Sbjct: 940  ELSLLRRELDEIRS---LQPK-LKEGTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQ- 994

Query: 1024 DLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKE 1083
                  +Y     + ++  ++ + ++S+ ++ L ++    ++++  L  S ++ +  L  
Sbjct: 995  ------VYKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDT 1048

Query: 1084 NERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSIL 1143
            +E+ W  ++     +L S+  + E L  +N +L ++I   T    G     D   L S  
Sbjct: 1049 HEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTEGSDG---NEDYLKLVSFF 1105

Query: 1144 LSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHE 1203
             +LR ER+ L+TK+T  +RD  +++QK + ++  + + +     S+ E +    II +  
Sbjct: 1106 SNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTELQCSAVIIDEFN 1165

Query: 1204 DIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALKYSMQE 1263
            DI +++ Q+NLL+E+N  L+          R +  EL   +++++ ++S+L   K  +  
Sbjct: 1166 DITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEVSQLKSDLIKTKEQVSV 1225

Query: 1264 KEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEE 1323
               ++ + + E+ + K+R  D+  + R++     EKL  EI   K KL +      E E 
Sbjct: 1226 NANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDFKAKLLDAENTKTELEN 1285

Query: 1324 RFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDN 1383
            +FNRL++QA E+             ++ +LK  + KLE+ L+  N K  +L+    E   
Sbjct: 1286 KFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSKNFKTVDLDTEPKEHTV 1345

Query: 1384 NQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXXXXXXX 1443
               D ++  ++ A          +EE        I+ L  E+                  
Sbjct: 1346 QSGDLLRDQEKVAS------LPLIEE--------IESLKREL------------------ 1373

Query: 1444 SEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNI-----NI 1498
             +     N+ S   E ++   EE+K   I E+TKE  +K+ E   +      +     NI
Sbjct: 1374 -QVFKNANNSSDAFEKLRDNMEEEKNKIINERTKEFEKKLEEIVSKSKSTGKVADNSENI 1432

Query: 1499 DELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEER 1558
            + LK +W  E+EEE + RIREAEE LKKRIRLP+EE+I KII +++E+LE+EF  K++E 
Sbjct: 1433 ETLKKEWLKEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKEN 1492

Query: 1559 IKLLSQS 1565
               L+ S
Sbjct: 1493 ASSLTFS 1499

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  392 bits (1007), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 432/1573 (27%), Positives = 782/1573 (49%), Gaps = 107/1573 (6%)

Query: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83
            I+ F     E +  I    +K L  K+ +F   + E  ++ V  DE+K+    +I  L K
Sbjct: 5    ISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLTK 64

Query: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143
             +    ++     K  +   D+L+ E++  T          R+ D L    K+L  + + 
Sbjct: 65   LLNESSEEKVINSKVMNRLQDQLKEERSRHT----------RKIDAL---NKQLNASHET 111

Query: 144  TLKILDE-RLKELEIARSDNNRSDN--------ECKRLRSTIIDLETKQQDLITSDLNSR 194
              K+ DE   KE   +  D  R+D+        E K L+  ++++E   Q   ++ ++ +
Sbjct: 112  IKKLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQ 171

Query: 195  AELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEK 254
             + +  +QE  +      W E+ L S N++ L         +  +  +LN  +++ +   
Sbjct: 172  FKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVS 231

Query: 255  TKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVK 314
            T N  L  +N                  D  ++EK EFS E+ L++++ DLL SQL +  
Sbjct: 232  TYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSF- 290

Query: 315  EELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLXXXXXXXXXXXXXX 374
            E   S R  E  +D      E  D+ +EL   K +L + K EC  L              
Sbjct: 291  ERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENGTT 350

Query: 375  XXXXXXXFIL---------LKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTD 425
                     +         LK+QL+KE+  K  +QNQ++ F+LELEHK P + SFKERT+
Sbjct: 351  VNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTE 410

Query: 426  TXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLI 485
                            S  K    ++L++  +K+   E +I +L++QRLDL RQV+ LL 
Sbjct: 411  LLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLS 470

Query: 486  TNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTEL 545
              S  + +  PL  +E+M ++ +L+++ +T  E DSQ I+TE+LVEF++I ELQEKN EL
Sbjct: 471  NISAIQTTTSPLSNDELMSLRKLLESE-NTVNERDSQIIITEKLVEFKNIDELQEKNMEL 529

Query: 546  LKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXX 605
            L  +R LAD+LE+NE E+ +++ KIE++TI EAKEAI+ +++                  
Sbjct: 530  LDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLALRVNILTRERDS 589

Query: 606  XXALLS-NEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDL 664
               L S N+  +H ++       T+   E +I++LQS +S    ES+  +  LN ++   
Sbjct: 590  YKLLASANDNKTHADTE----GITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTY 645

Query: 665  YDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKT 724
              S++D  I L + ++ ++L  E+  +L   ++  K + ++ R     L +    QD K 
Sbjct: 646  KKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKTQLEKQR-----LSAAPPVQDYKY 700

Query: 725  QETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQ 784
               L +    ++K+   + E+ NLK+E    I  +++L +++++   EK  L + +++ +
Sbjct: 701  S-NLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESE 759

Query: 785  TLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKI 844
            T   E+  +       Y  +I  LE    EL      K+Q IK L+   NS ++W QN I
Sbjct: 760  TSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTI 819

Query: 845  EVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRL-HTYNVIDGTINDDSLRK 903
            +  +K+ +S+   +++K+  I +L  ++++L  E+   K++     N  D    + +LRK
Sbjct: 820  DDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRK 879

Query: 904  ELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEE 963
            EL++++I L DA+SQI+ Y+E+  TN   LK+++ + +++ +D   +I+    EK + EE
Sbjct: 880  ELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEE 939

Query: 964  KISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVK-SEYESKLSKIQ 1022
            ++S L++++    +E+      ++E  +       +LQ+     +A +  E ++K+ K+ 
Sbjct: 940  ELSHLRKEL----DEIRCLQPKLREGASYL-----VLQSEKVGDQAQRIQEMKNKIDKMA 990

Query: 1023 KDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLK 1082
              ++    Y     + Y+ EL+ + D+S+ +  L ++   Y+ ++     S    +  L 
Sbjct: 991  AIIE---AYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQELLD 1047

Query: 1083 ENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPA-LNS 1141
             +E+ W  ++     +L S+  + E L  +N +L ++I+  T      +++N+K   L S
Sbjct: 1048 RHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIDGATEG----SNSNEKYLELVS 1103

Query: 1142 ILLSLRRERDILDTKVTVAERDAKMLRQKISLMD---IELQEARTKLDNSRLEEEKRPTI 1198
            +  +LR ER  L+TK+T  +RD  +LRQK + ++    +LQ A T     R + +    I
Sbjct: 1104 LFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTV---PRNKVQCPAVI 1160

Query: 1199 IQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALK 1258
            I ++E I++++ Q+N+LRE+N  L             +  EL  ++++I+ ++  L   K
Sbjct: 1161 IDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTK 1220

Query: 1259 YSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQG 1318
              +     ++   + E+ + K+R QD+ ++ +    ++ EKL + I  L+VKL       
Sbjct: 1221 EQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNAN 1280

Query: 1319 AEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAK 1378
            A+ E +FNRL++QA E+             ++N+LK  K KLE++L +  +K+ +LE  K
Sbjct: 1281 ADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLE-LK 1339

Query: 1379 AEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXX 1438
             ++   Q+  + +     ++ S  FK  +EE        I+ L +E+             
Sbjct: 1340 LKEHGLQVGEVSK-----DHDSIAFKPFVEE--------IESLKKEL------------- 1373

Query: 1439 XXXXXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEA--QERLNQPSNI 1496
                  +     ND S   E +K   EE+K   I EKTK+  +K+ +A  + + N+    
Sbjct: 1374 ------QVFRNANDASDAFEKIKNNMEEEKNKIIDEKTKDFEKKLQDAVNKSKSNESEVE 1427

Query: 1497 N---IDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDE 1553
            N   I+ LK +W  E+EEE V RI+EAEE LKKRIRLP+EE+I KII +++ +LE+EF+ 
Sbjct: 1428 NSEHIEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFER 1487

Query: 1554 KVEERIKLLSQSG 1566
            K++E  K L  SG
Sbjct: 1488 KLKENNKSLVFSG 1500

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  352 bits (902), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 404/1593 (25%), Positives = 766/1593 (48%), Gaps = 141/1593 (8%)

Query: 191  LNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDF 250
            L S++E ER  ++  +++  N WLE+ L    E+ ++ ++   K+  E   E+++LR + 
Sbjct: 118  LISQSEAERSLKQSELVREHNQWLEEHLVKTTEELMTQKQSILKM-EEKDQEIDNLRHEV 176

Query: 251  QVEKTKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQL 310
             + K  ND+L  KN                  D  S+++QEF  EI LK R+   LE+QL
Sbjct: 177  SILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEFLHEIGLKDRINSSLETQL 236

Query: 311  NAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLXXXXXXXXXX 370
              +++E    + ++  +++ +  S+K  ++++L  T+++L   ++EC RL          
Sbjct: 237  KEIQQE----KSIQNEDNTSRAESQK--IMEQLIDTRKQLKDSRNECTRLKSYVNEFIND 290

Query: 371  XXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTXXXX 430
                           KK+L+K K  K++L+ Q+E+FI ELE KVP+I+S +++       
Sbjct: 291  VNGEYSSSSSLL---KKELLKVKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKE 347

Query: 431  XXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVS 490
                       S E+ +  +E  +   K +  +  IQTL  QR DL  Q+Q+LL+     
Sbjct: 348  LSDVTSLVDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQ 407

Query: 491  KDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKIVR 550
              +   L K+E  FI+ + +ND+  A   DSQ I++ERL++F  I ELQ++N ++L  VR
Sbjct: 408  ATTNALLSKDETDFIRRLTENDT-YARNNDSQSIISERLLKFADITELQKQNMDILATVR 466

Query: 551  NLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXXALL 610
            +LA +LE  E   +     IE +T+ EAK+A+L L+                      LL
Sbjct: 467  HLAGQLEEQEKLRQADHHTIERKTLEEAKKALLDLQ-EYTNSLERKLETFRKERDVYKLL 525

Query: 611  SNEETSHLNSTIQQLNETKRNLECQIQD-LQSNISQITRESTENMSLLNKEIQDLYDSKS 669
            S  ++   N    + N+  ++   ++Q+ LQ     +T+E  E ++  NK   D+ + K 
Sbjct: 526  SKGKSPSSNKP-SECNDIDKHTTGKLQNELQQTREYLTKE-IEKLTRTNK---DILNKKK 580

Query: 670  DISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETLN 729
            ++   + K +S++  AE + +L+ N L + +     + ++ D LQ  + ++++K  E   
Sbjct: 581  ELEYSMKKMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQ 640

Query: 730  EYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQKE 789
            +     S+ N+ +    + + +        Q  ++E+ ++  EK  L++ + +L+  + E
Sbjct: 641  DLHELTSQYNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNE 700

Query: 790  RENLLDETRKSYQNKIDELE-HAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLK 848
             + +          ++ E + H  + LK     +DQ I+ +E      + WYQ       
Sbjct: 701  CKGIQATVELKLNERLTEYQLHEQDLLKIIEKQEDQ-IRDMEVKRAEELNWYQKNFPTQT 759

Query: 849  KDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVID-GTINDDSLRKELEK 907
            +    +   M  K+ E  + Q    +LE +      +  +    D GT  D S+RK    
Sbjct: 760  ETEIGLPVDMK-KEGETGR-QSNRDTLESQ------KSGSPGFTDLGT--DSSVRKSTSL 809

Query: 908  SKISLTDAYSQIQEYKELYE-TNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEKIS 966
              + +     + +E K+    T++  +  +     +  KD   +I+ L ++K  L+  + 
Sbjct: 810  PVMQVGRTEEESKEAKKCDALTDSSQVVGLPENVTKKEKDLIAQIEQLASDKKELKTSLQ 869

Query: 967  LLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLD 1026
             ++ +  +L+++L L+      EKA    ++  +  NN   E  K   E  L  ++  L 
Sbjct: 870  AIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKL- 928

Query: 1027 QQTIYANTAQNNYEQELQKHADVSKTISE-------LREQLHTYRVQVNTLTLSRNQLES 1079
                         E+E QKH + + T+SE       + E++  YR +++     +  ++ 
Sbjct: 929  -------------EEERQKHEETNATLSEKELLCEKMIEEISGYREELSKSAEMQVDIQH 975

Query: 1080 TLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPAL 1139
            T            + L + L+ +N RI+DL +QN LL++Q  L  T D  + DT +K  +
Sbjct: 976  T------------RELEDLLDLANKRIDDLCTQNNLLHEQ--LNATLD--LEDTQNKDDI 1019

Query: 1140 NSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTII 1199
              I++ ++RERD L  K+ + ER+ ++LR++ + +  EL +A +K    +        ++
Sbjct: 1020 KDIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSEL-DAVSK--GQQWHNLPLSNLL 1076

Query: 1200 QQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALKY 1259
              HE I+++L +++LLRE+N++L            +L  EL ++++   P++ +    + 
Sbjct: 1077 TGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTER 1136

Query: 1260 SMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEK-LEHEIDSLKVKLDEKTRQG 1318
              +EK+QE+ L K+E+ RWKKR Q ++  HRQ  +   E   ++EIDSLK  ++E+T++ 
Sbjct: 1137 YFKEKDQEISLYKDEIERWKKRWQQMV--HRQDDTLGLEANFKNEIDSLKGLIEERTKEK 1194

Query: 1319 AEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAK 1378
             +  E+F  L++QA E+              ++++K + ++LE+ + + + KI E+E   
Sbjct: 1195 EKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIE-LT 1253

Query: 1379 AEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXX 1438
             +++  + D  ++L   +E + KE + KL +  T      + LN+E+++           
Sbjct: 1254 LKENLEKFDKDEKLV--SEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRK- 1310

Query: 1439 XXXXXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERL-------- 1490
                      + ++ ++++ +MK  FE +K   I EK +E+NEK    +  +        
Sbjct: 1311 ----------KDDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENV 1360

Query: 1491 -NQPSNINIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEK 1549
             N  +  N+D+LK + + + EE+ + RI EA+E LK+ IRLP+EEKI +IIE++R +LE 
Sbjct: 1361 TNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELES 1420

Query: 1550 EFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDER 1609
            +FD++VEE+  L++ + + D                                  +S DE 
Sbjct: 1421 DFDKRVEEKANLIALADKAD----------------------------------MSPDEL 1446

Query: 1610 DQ-LRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKIT 1668
             Q +R E+E  + ++L  +L+ I+ K+FEEGK+QA MKTTLLERKL+K+ESQ+++  +  
Sbjct: 1447 KQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQVAKDNESG 1506

Query: 1669 ESPSKHVNHTQNQLLGLPRKIEENSSSSFNPXXXXXXXXXXXXXXXXXXXFNPFTSPSPN 1728
                K ++      +  P+  ++N+ +                        NPFTSP+  
Sbjct: 1507 SKVRKSISGLTKIDVNSPQLYKDNTGTRTEAVLKLRPTAKVDSGKDVSNDSNPFTSPTQE 1566

Query: 1729 KSSQKVDDQRELTTNKADPPTHLTPSFNIPAGR 1761
             S           +  A P  H+ P+F+   G+
Sbjct: 1567 LSKS--------NSPAALPIVHMAPTFSFTPGK 1591

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  323 bits (827), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 403/1577 (25%), Positives = 775/1577 (49%), Gaps = 126/1577 (7%)

Query: 21   LKAIASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDN 80
            L  +A+    +   +E+I   +++ +N KLL   + K    ++  + D  K+  S + D 
Sbjct: 4    LNNLATSLEVTATDLETIEPTVLEKINAKLLSSEQEKD---RLNATIDNFKSKMSSQFDT 60

Query: 81   LKKEMENLIKQNDGI---RKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKEL 137
            +K ++E L K+ + +   +K+ +  C + E +  +   IS         +DD+I+E +  
Sbjct: 61   VKNDLELLQKEKELLIQDKKQLESKCIQWEQQYAQHQDIS----KTDLASDDVIKENETF 116

Query: 138  QCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAEL 197
            + + Q     L    K+L    +   +       L++  ID+ T+  +  +     +++ 
Sbjct: 117  KRDHQLLTSDLMNLSKKLSSCDAALEKKSTAYLELQNDNIDIRTQLNNFKSETKGLKSKY 176

Query: 198  ERKAQEL----NILQSTNDWLE---KELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDF 250
            ERK ++     N   S   + E   KEL   + ++ + +  +   +   ++ L+ L   +
Sbjct: 177  ERKVKDFEELKNAYSSMKTYEETSRKELSEMSNKFYTLKTSSSNELRNAKDALHSLEKQY 236

Query: 251  QVEKTKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQL 310
            ++   +N    ++N+                 + L+  K+ F+ E+ L Q   DLL+  +
Sbjct: 237  ELLLEENKAFKERNNELTTTVSDELFKKKSLENDLNELKESFTREMTLTQHENDLLKEHI 296

Query: 311  NAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLXXXXXXXXXX 370
              +K     T G  ++ +  + + E  D+ K L+         KSE   +          
Sbjct: 297  EYLKNTTKETTGGTSTLEKDRLLHELVDIKKSLE---------KSELENVHLNDFIEQYL 347

Query: 371  XXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTXXXX 430
                        +LLK+QLIKEKR K++LQ Q+E F++ELE+++P +NS K+R  T    
Sbjct: 348  TENEESTSDNELVLLKEQLIKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQE 407

Query: 431  XXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVS 490
                      T  E + +I+EL+ ++ +LK+   +I  L+ QR+DL  QVQ+LL+   + 
Sbjct: 408  LMQITGLLEETERESDIRIKELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLK 467

Query: 491  KDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKIVR 550
            K  +  L  +EI F++ I+++  ++  ++DSQKI++ERLV+F  I  LQ++N ELL   R
Sbjct: 468  KHQQHLLTPDEITFLRKIIKS-RNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTR 526

Query: 551  NLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXXALL 610
            NLA++LES++    +S+QKI   T NE+KE I  L+                      LL
Sbjct: 527  NLAEQLESSDT---KSVQKI---TRNESKEKIAKLQ-ESINGLTSKLEKLQKEKDAYKLL 579

Query: 611  SNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITREST-------ENMSLLNKEIQD 663
            S + T     T          L  Q+Q  +  ++++ R S+       E   +LN+ I  
Sbjct: 580  SLQNTGEQTPT--------EELRSQLQKKEEQLTKLERMSSLDSHLAEEKAKVLNQSIIK 631

Query: 664  LYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSK 723
            L   K D++  + KE S R +AE++ K+L ++L+L   + D   K+++  ++ +   +++
Sbjct: 632  LKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELLHKKYDLAVKKYEHYETLLNDHNAE 691

Query: 724  TQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQL 783
              +   E  + ++K++I + E+ + K  Q L   S+ N +  + KL++       + ++L
Sbjct: 692  NIKHSRENETTQAKISILQKEIESYK--QNLLQYSKDN-ENTLSKLAAATQEKETLGSRL 748

Query: 784  QTLQKERE---NLLDETRKSYQNKIDEL-EHAHNELKGEASHKDQRIKQLEEDNNSSIEW 839
             T++ E E   NL+ E R++Y  + D + E    + K +   K + +K  E   NS I W
Sbjct: 749  STVKNELEQKINLMQE-RETYYKEHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINW 807

Query: 840  YQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDD 899
            YQ +++ L   N+ +   +N +  +I   + K+  LEK + +N          +G+ +  
Sbjct: 808  YQKRLDSLTTTNDKLQVELNKELTKINIQRLKISDLEKTLSQN---------TNGSSSLP 858

Query: 900  SLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKS 959
             + ++ EK K  L +   +I +Y++L     ++  ++        KD  N+ + + ++  
Sbjct: 859  RVDQDFEKLKNELKEKQLEINQYRDLLNLAEETKNRLQ-------KDL-NKQRQIVDDAM 910

Query: 960  SLEEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVK---SEYES 1016
              +E+   L +Q+  L  E    N  ++++KA+      I+Q+   E E +K   S  E+
Sbjct: 911  EGKEQ---LDQQLAELTQECSSMNSLLQKQKAKCEDDQKIIQDKATETENLKNSLSSLEN 967

Query: 1017 KLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQ 1076
            K++ ++ ++ ++T      +N Y+++L K ++ S  I ++  +   Y+        S + 
Sbjct: 968  KITTLENEMVEKTKSFEEKENTYKEQLHKLSESSTLIEKMEAENKAYKT-------SLDG 1020

Query: 1077 LESTLKENERSWTSQRKALIE-------QLESSNSRIEDLTSQ-----NKLLYDQIELYT 1124
            L++ +   E + ++ R+ L++       Q++     I++L  Q      K  +   E  T
Sbjct: 1021 LKANIAAYEDAISAYRQKLLDEKFNHELQVDEFKETIDNLNFQIHIQKGKRSFITSEGST 1080

Query: 1125 TADKG----VTDTNDKPALNSILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQE 1180
            T++      V DT+DK   N ++L+LRRERD LD K+ +++R+   LR+++  +   L E
Sbjct: 1081 TSNDTDETVVNDTSDK---NELILALRRERDGLDIKLDISQREVYSLREQVENLKNSLDE 1137

Query: 1181 ARTKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSEL 1240
             R        E     T  +QH++ +++LN+LN L+E+N  L+           ++ ++L
Sbjct: 1138 TRQSFKGLESEVSGEMTTTEQHKEAVKQLNELNTLKETNEQLQQKLRENDKENNIIHTKL 1197

Query: 1241 DKLKQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKL 1300
            + LK ++ P++ ++  LK S+ EK+Q+L L  EE  RWK RS++IL K +Q+   ++ KL
Sbjct: 1198 ELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSEENERWKLRSREILMKRQQVDLEEHNKL 1257

Query: 1301 EHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKL 1360
              E+ +LK +LD KT+   +  +RFNRL++QA E+             ++ DL +AK KL
Sbjct: 1258 MEELSTLKTQLDTKTKDNEDLNDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAKSKL 1317

Query: 1361 EKSLDDANTKIEELENAKAEQDNNQLDAIKRLQQDAENS---SKEFKTKLEEKATFYDST 1417
            E  LD+   +I+E+E+   ++ +N  D I  L+++  +S   SK+ +  L+E        
Sbjct: 1318 EIDLDEERKRIQEVESQLKQKPDNP-DVITALEKELSDSVENSKKIEENLQETVNSSLEL 1376

Query: 1418 IKKLNEEIITXXXXXXXXXXXXXXXXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTK 1477
             KKL EE+ +                    +  N  S+ +  +K++FE +K   I    +
Sbjct: 1377 NKKLTEEVNSLKSQLETLKNQNGVISVADGSAIN--SETIAHLKESFEVEKTELITTLKE 1434

Query: 1478 EVNEKILEAQERL----------NQPSN----INIDELKIKWKAEHEEEVVNRIREAEEA 1523
            E  +++ E +++L          ++P+     I+I+++K +W+ + EE ++ RI +AEE 
Sbjct: 1435 EFKKQLEEEKKKLLEEKEKEYYDSKPTGGSEPIDIEKMKSEWEEKQEEIIMQRIADAEEN 1494

Query: 1524 LKKRIRLPTEEKISKII 1540
            LKKRIRLP+EEKI+++I
Sbjct: 1495 LKKRIRLPSEEKINRVI 1511

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  309 bits (791), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 361/1403 (25%), Positives = 664/1403 (47%), Gaps = 152/1403 (10%)

Query: 384  LLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSN 443
            +L  +L +E  +K+ L+ Q+  F+ ELE   PII SFK++++              H + 
Sbjct: 294  ILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTK 353

Query: 444  EKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSKDSKGPLRKEEIM 503
            +K    +E+    ++L+Q     + L ++R DL RQ+QYLL+ N   KDS  PL   E  
Sbjct: 354  DKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL-NGFVKDSDDPLTSSEFS 412

Query: 504  FIQNILQNDSDTA--TETDSQKIVTERLVEFRSIIELQEKNTELLKIVRNLADRLESNEN 561
            +I+ IL  D +    + TDSQ I+++R+++F+SI+ELQ++N  LL  VR L+DR E+ E 
Sbjct: 413  YIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLER 472

Query: 562  --ESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXXALLSNEETSHLN 619
              ES  S+     E INEAK+ +L L+                        S  +    N
Sbjct: 473  KLESGDSI-----EAINEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEFGN 527

Query: 620  STIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEK 679
            S +   N         IQ L++    +  ES+E +  L  +I +L  SKSD++ +     
Sbjct: 528  SDLSDGN--------NIQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLI 579

Query: 680  SSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETLNEYISCKSKLN 739
            +S+ L E+R K+  + LDL+K EN  LR R       + +++ +T +T+ +Y+ C +KL+
Sbjct: 580  NSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKYLDCVAKLD 639

Query: 740  ICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQKERENLLDETRK 799
            + + +L N   E+ +  +++ +++ ++ +   E+   + ++ QL+ LQK ++  L + + 
Sbjct: 640  VIQRQLENTLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQV 699

Query: 800  SYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLKKDNESIICSMN 859
            S QNKID+LE  + EL+ +   K+        +  + +EWYQ K + L   N+++   M 
Sbjct: 700  SLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMI 759

Query: 860  DKQAEIEKLQHKVKSLEKEIDE----NKIRLHTYNVIDGTINDDSLRKELEKSKISLTDA 915
            +  + IE L  K ++L+  + E    NK+      V D      +L  EL  S+  LTD 
Sbjct: 760  ECASTIETLTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDT 819

Query: 916  YSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNL 975
              ++       E ++ +++Q  S+     K  + R   L NE   L ++I++L++++ + 
Sbjct: 820  SREL-------EISSNTIRQYQSEI----KVLNERQSELENENKHLRDEIAILRDELTHN 868

Query: 976  NNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTA 1035
              E +        EK    KK+S L+    E+  ++ +Y +++ K++ DLD+Q +     
Sbjct: 869  GGEFE-------REKEALMKKLSNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEI 921

Query: 1036 QNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKAL 1095
            +  +++E++   +V    +E      TYR   N L L   +      E E+   S+ K L
Sbjct: 922  KLAHDEEVR---EVQNRNTE------TYR---NELELVEIRQTKVFVEKEKELESRIKIL 969

Query: 1096 IEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDK---PALNSILLSLRRERDI 1152
             EQ+E    R++  + +  LL +Q++L   AD+  +D  D    P    ++  L  E+  
Sbjct: 970  NEQIELDKERMKQFSDEESLLREQVKLL--ADEKASDLVDAGVSPEYTDLVRKLSDEKKN 1027

Query: 1153 LDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHEDIMEKLNQL 1212
            L++K+  ++ +   LR++++  + E+  A   ++  + ++E    +  +     E + QL
Sbjct: 1028 LESKLFASQSEKNRLREQLTKTESEI--AVLNMNYEQAKKEVAAEVNNESGRAEEHIAQL 1085

Query: 1213 NLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTK 1272
              L+ESN++L             + +EL++LK     +ES+L   +  +  K+ +L   +
Sbjct: 1086 ESLKESNMSLTNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQ 1145

Query: 1273 EEVHRWKKRSQDILEKHRQMSSSD-YEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQ 1331
             E  R K  S D+ +   + SSS+    L+  + +L  ++D       E E+RF RL+RQ
Sbjct: 1146 TECSRLKATSHDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQ 1205

Query: 1332 AQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNNQLDAIKR 1391
            A+ER            + V  L   K  L+  ++ +  ++ EL  AK ++       +K 
Sbjct: 1206 ARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNEL-RAKIQEHIETSAVMKE 1264

Query: 1392 LQQD---AENSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXXXXXXXSEP-A 1447
            L+ +     + +K+ + +L E +   +     LNEEI                  +EP  
Sbjct: 1265 LKTELAAVMSKNKDIEAELNETSKSSNQLTTALNEEI---ESLKHEVQYLKEASSAEPQG 1321

Query: 1448 NEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNINIDELKIKWKA 1507
            NE+  +S +VESM+K FE++KI F++  +++   ++ E + +L +       E++   K 
Sbjct: 1322 NEE--MSGVVESMRKAFEDEKIAFMKATSEDSEARLAEERGKLKR-------EMEALEK- 1371

Query: 1508 EHEEEVVNRIREAEE---ALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQ 1564
            E +  V+ + R  EE    +K R  +P             E L+K+++   +ER+ LL +
Sbjct: 1372 EKDSLVMEKTRLGEENTALMKARSDVP-----------DIETLQKQWEASNKERLVLLYK 1420

Query: 1565 S-------GQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIE 1617
                     +MD   ++QF+ R++ K+KEL                      + L+ EIE
Sbjct: 1421 EKSDQMMRAKMD-ELEEQFQNRVRNKEKEL----------------------NALKDEIE 1457

Query: 1618 TKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETK-----KITESPS 1672
             K +   ++ L  +KK++FEEGKQQA MK ++LERK+AK+E++   TK      ++E   
Sbjct: 1458 EKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAESKATKSGSDMSVSEDAP 1517

Query: 1673 KHVNHTQNQLLGLPRKIEENSSSSFNPXXXXXXXXXXXXXXXXXXXFNPFTSPSPNKSSQ 1732
            + V    N++    +     + S F+                     NPFT+P    ++ 
Sbjct: 1518 RFVTPNNNKVQQANQPFLATAGSGFSVQSSES---------------NPFTTPVSRGAAH 1562

Query: 1733 KVDDQRELTTNKADPPTHLTPSF 1755
                     TN A   +   P+F
Sbjct: 1563 ---------TN-ASSQSKFAPTF 1575

 Score = 33.1 bits (74), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 96/191 (50%), Gaps = 37/191 (19%)

Query: 77  KIDNLKKEMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNEL-ESIKRRAD--DLIEE 133
           K+D +++++EN + + D +              +N ++ I N+L +++K R +   LI +
Sbjct: 637 KLDVIQRQLENTLVEKDIL--------------QNAQSSIENKLNQALKERNNFQGLIPQ 682

Query: 134 KKELQCNQQRTLKILDERLKELEIARSDNNRSDN---ECKRLRSTIIDLETKQQDLITSD 190
            + LQ NQ       DE+LK++++  S  N+ D+   E   LR+ I   ET     +T  
Sbjct: 683 LRALQKNQ-------DEQLKDIQV--SLQNKIDDLELENTELRNKIDTKETSPSSALT-- 731

Query: 191 LNSRAELERKAQELNILQSTNDWLEKEL--CSKNEQYLSYRKKTDKIILEIRNELNHLRS 248
            N +AELE    + + L  +ND L +++  C+   + L+ + +T  I+L+  N  N L  
Sbjct: 732 -NPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKL-- 788

Query: 249 DFQVEKTKNDV 259
             +  +T +DV
Sbjct: 789 -LEARETVDDV 798

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  261 bits (667), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 401/1588 (25%), Positives = 721/1588 (45%), Gaps = 216/1588 (13%)

Query: 117  SNELESIKRRADD---LIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLR 173
             NEL    R+A+D   L+ E+ EL        + L+E+   L+  +S  + ++ E +  R
Sbjct: 40   GNELREKLRQAEDSNRLLRERNELLS------RSLEEKTGILDTVQSSVSTANAELRSAR 93

Query: 174  STIIDLETKQQDLITSDLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTD 233
              +++L  +  +  T    S  + +R +++L   +   +     L    ++ L +++  D
Sbjct: 94   EQVVELRQRLGESETQRFQSELQRDRLSEQLKQGERYINATNGRLLESTKKLLDFQRD-D 152

Query: 234  KIILEIRNELNHLRSDFQVEKTKNDVLTQKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFS 293
            + +  IR +L+   S+ +  +  N  L    +                 D LSS++ +F 
Sbjct: 153  RQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFE 212

Query: 294  TEINLKQRLVDLLESQLNAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQC 353
             E+  + +L  +L+ Q+N++  EL +  G ET      H    +   K+    +EE++  
Sbjct: 213  RELATRDKLNAVLKKQVNSLHSELGN--GGETP----AHAEPNDQFAKQSSQHEEEISNY 266

Query: 354  KSECIRLXXXXXXXXXXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHK 413
            K +   L                        L+K L+KE++    L+ Q+ESF++ELEH+
Sbjct: 267  KEQVEELLGILGQGAPS-----------IAHLRKLLLKERKENVSLKKQMESFVIELEHR 315

Query: 414  VPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQR 473
            +P +   +++                  S  K    RELS+  +K+         L  QR
Sbjct: 316  LPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLRVQR 375

Query: 474  LDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFR 533
             DL  Q+Q+LL  NS    S   L   E+ FI+ I++N++  A + DSQ+IV++RL+ F 
Sbjct: 376  SDLAHQIQFLLTVNS----SDTVLPPSELSFIKTIIENENWDAYK-DSQRIVSDRLLRFD 430

Query: 534  SIIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXX 593
            +I ELQE+N +L+  VR+L D++ES E ++   L      T+  AK  I  L+       
Sbjct: 431  NIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLE------- 477

Query: 594  XXXXXXXXXXXXXXALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTEN 653
                          AL+  E     +S   ++N T    + +I++L+S ++ +     + 
Sbjct: 478  QSNAQLESEVKNWEALM--ETLKDGDSLDSKINVTMVEQQKKIEELESKLTDVGESHVQK 535

Query: 654  MSLLNKEIQ------DLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLR 707
            +++LNK I       ++ + +   ++K      S ++A +R + LS T  ++  +N+   
Sbjct: 536  INVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSELIACKR-ENLSLTQQISTKQNE--- 591

Query: 708  KRFDCLQSTILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQ 767
               D L S   +++   Q  + E     +K    E   + L EE   K   EQ  +    
Sbjct: 592  --LDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEE---KTQMEQKQRSLFD 646

Query: 768  KLSSEKTGLRIMVTQLQTLQKERENLLD-------ETRKSYQNKIDELEHAHNELKGEAS 820
            K+  E   L     QL+T  KE E  +         + ++  +KI  L   +  L  + +
Sbjct: 647  KIQQESKKL----LQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLA 702

Query: 821  HKDQRIKQLEEDNNSSIEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEID 880
             K++ +KQ  E +   I+WYQ  I+ L + N+       +K  +I +L  K++ L ++  
Sbjct: 703  FKEEEVKQFIEKSEKQIKWYQQNIDELSEQNK-------NKSNKIIELNDKLRLLSEKSL 755

Query: 881  ENKIRLHTYNVIDGTINDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKF 940
             NK     Y V  GT     L+ EL   K +L  + SQ   YK+  E N        + +
Sbjct: 756  SNK----PYPV--GT-ELKELQNELNGMKAALEVSESQATLYKDTLERN-------QNFY 801

Query: 941  EESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMK-----------EE 989
              S+  F N I  L ++  +L ++   L+ QI    N    Q+KG++            E
Sbjct: 802  NNSTLSFQNTISELQSKNEALSKQHETLQNQITETEN----QSKGIQLEHQTIIDRLTSE 857

Query: 990  KAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADV 1049
            K    +K++ L ++ +++  +K EY++++ KI+ +L  Q+      + N+E  L      
Sbjct: 858  KTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQS----DTRLNFESAL-----T 908

Query: 1050 SKTISELREQLHTYRVQVNTLTLSRNQLESTLK------ENERSWTSQRKALIEQLESSN 1103
            SK      ++L +Y VQ+  L     +L S +       E  ++   +R +L ++L+ +N
Sbjct: 909  SK-----EKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTLIKERDSLGQELKLAN 963

Query: 1104 SRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSILLSLRRERDILDTKVTVAERD 1163
             RIE L +QN +LYD        D       D   L +++++LR ERD+  ++ T A+RD
Sbjct: 964  QRIESLAAQNSILYDTFSGMRHVDADAEPNED---LRNLVINLRIERDMHQSQETTAQRD 1020

Query: 1164 AKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNITLR 1223
             K+L++ +  +  +L     ++D     E+   ++   HE IM +L  L   +E N+ L 
Sbjct: 1021 VKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLD 1080

Query: 1224 XXXXXXXXXKRVLQSELDKLKQDIAPIESELAALK----YSMQEKEQELRLTKEEVHRWK 1279
                     KR LQ E+ +L+      ESE  A K     S QE +Q++   ++E  +WK
Sbjct: 1081 ESIKSLNEDKRTLQEEVSRLR------ESEELAKKNSSAISEQEWQQKIETYQQESEKWK 1134

Query: 1280 KRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERXXXX 1339
               Q + E     ++++ + L+ ++++ K  +  KT++  +  +RF RL++QA E+    
Sbjct: 1135 LMCQQMSEN----TATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNAS 1190

Query: 1340 XXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNNQLD----AIKRLQQD 1395
                     ++++LK     L++ L++              Q+ N +D    A   LQ  
Sbjct: 1191 KATSDSLAIELSELKTVNDALQEKLNN--------------QETNSVDSESNAALILQLK 1236

Query: 1396 AEN-SSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXXXXXXXSEPANEQNDLS 1454
             EN  +K  + +L       +  I  + +E+ T                        D +
Sbjct: 1237 EENKQAKSLELELRHSVDSSEKLIADMTKELTTLKENPIQGSVNVE-----------DYT 1285

Query: 1455 KIVESMKKTFEEDKINFIREKTKEVNEKI-LEAQERLNQPSNINIDELKIKWKAEHEEEV 1513
              +E +K  FE++K   I + T E+ E+   E +E +N  +N N++EL+   + E E + 
Sbjct: 1286 HRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKELMN--NNANLEELRKPLEEEWERKT 1343

Query: 1514 VNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQ 1573
            + RI EA+E LKK IRLPTEEKI ++I +++  LE++F  KV E+  LL           
Sbjct: 1344 LQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLL----------- 1392

Query: 1574 KQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKK 1633
                                KL ELS+  +      D+L  E+  +++  L+ + + +KK
Sbjct: 1393 --------------------KLSELSNKTA------DELEKEVREEIKTRLEEDFELLKK 1426

Query: 1634 KSFEEGKQQAMMKTTLLERKLAKMESQL 1661
            K+FEEG+QQA MKTTLLERK+AK+E++L
Sbjct: 1427 KAFEEGRQQASMKTTLLERKIAKLEARL 1454

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  215 bits (548), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 266/1068 (24%), Positives = 514/1068 (48%), Gaps = 95/1068 (8%)

Query: 145  LKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELERKAQEL 204
            LK+L+ER+ +++  ++D N+   E K L      L  + +      L  R +L++    L
Sbjct: 78   LKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRTQLDKVTFTL 137

Query: 205  NILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRS---DFQVEKTKNDVLT 261
            ++        E E  SK + + SY+   D+  LE +N + +L +   + ++   KN  L 
Sbjct: 138  SLTMKQKQHTESEYLSKEKHFESYK---DRKELEYQNVMENLTAIDNELRMTNGKNAELF 194

Query: 262  QKNDXXXXXXXXXXXXXXXXXDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELDSTR 321
            ++N+                 + L +   +F +E  L+ +L++ L++Q+  ++E+L+S  
Sbjct: 195  KRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQEQLESLS 254

Query: 322  GLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLXXXXXX--------------X 367
              E  +D      +K +L+++++   E+L   + E + L                     
Sbjct: 255  D-EKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEFQNIPEEESSSVSSH 313

Query: 368  XXXXXXXXXXXXXXFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTX 427
                            +L+K  +KE++ K  L+ Q+   + ELE  +P ++S+KER+   
Sbjct: 314  ASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPSLSSYKERSTFL 373

Query: 428  XXXXXXXXXXXXHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITN 487
                        H   E   K  EL  K  +     + I +L  QR  L RQV+YLL+  
Sbjct: 374  EKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVLARQVKYLLLII 433

Query: 488  SVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLK 547
              ++     L ++++  +   L  ++  A  +DS+KI+ ERL +F+++ ELQ +N +LL+
Sbjct: 434  QNNETLGSSLGRKDLELLGQYLAANTAEAM-SDSEKILLERLAQFKNVKELQNRNMQLLQ 492

Query: 548  IVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXX 607
            + R LA + E  E  + + +   E ETIN+AKEAIL L+                     
Sbjct: 493  VSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQ----EYSQKLESQIKELSDEL 548

Query: 608  ALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDLYDS 667
            A+   E+T     +I  +++ + +      DL   +S   + S + +  LN EI++L+ +
Sbjct: 549  AVQKKEKTE--KESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQA 606

Query: 668  KSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQET 727
             +D++I L KEKS+R LAE+R+ LL   + L K+E ++L++  + LQ  IL ++ +   +
Sbjct: 607  NTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNILDKEKQFSYS 666

Query: 728  LNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQ 787
              +YISCKSKL+  E E+ +L+ E +L I+++  L+ + + L +E+  LR+ VTQ+ +L 
Sbjct: 667  SRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLN 726

Query: 788  KERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVL 847
             E + LL ET+  Y +K+        +   +     QR+ +L+  N+S I+WY+  I+ L
Sbjct: 727  NELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDSEIKWYKATIDDL 786

Query: 848  KKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDDSLRKELEK 907
            K +    +  +N+   E+++ + K++   K ++  +  L   N  D +    +L KEL +
Sbjct: 787  KAN----VFELNE---ELKQKEEKIEEFSKTLENVQNELTLANSKDVSEEKRALEKELSE 839

Query: 908  SKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEKISL 967
             K  L  +  +++EY+ +  T+ +S +    ++E+  K  ++++ +   E+++L+E +S 
Sbjct: 840  VKSQLEKSNLEVKEYENVISTSKRSFENKSIQYEDRIKALASKLDSELRERTTLQENLST 899

Query: 968  LKEQIFNLNNELD-----------------LQNKGMKEEKAEFRKKISILQNNNKEVEAV 1010
            L+ ++    +EL                  L+ K  K+++AE R  I++   N       
Sbjct: 900  LQARMVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGN------- 952

Query: 1011 KSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTL 1070
               Y+S LSK                 +YE+ +Q+++++SK +  LRE++   R      
Sbjct: 953  ---YDS-LSK-----------------SYERIMQENSELSKVVELLREEVKN-RTSNGEK 990

Query: 1071 TLSRNQLESTLKENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGV 1130
                   ES +K+ +  W  ++K    Q+ + N R+ +L  +N+ L  ++E   + DKG 
Sbjct: 991  EGDLEDTESIIKKGQDVWDEEKKVFEVQITNLNERLSELLEENESLLARLE---SQDKG- 1046

Query: 1131 TDTNDKPALNS-------ILLSLRRERDILDTKVTVAERDAKMLRQKI 1171
               N+ P+  +        L +LR ER  L  K+T A+++ + +R K+
Sbjct: 1047 ---NNSPSAETNAAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKL 1091

 Score = 86.7 bits (213), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 110/205 (53%), Gaps = 50/205 (24%)

Query: 1456 IVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNINIDELKIKWKAEHEEEVVN 1515
            +V+ MK  FE++K + + ++ +E+ EK+ + + +L +                +EEE+  
Sbjct: 1187 LVQEMKDNFEKEKSSLLSQQEQEI-EKLTDNERKLREF---------------YEEEIQK 1230

Query: 1516 RIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQ 1575
            ++ +AEE LKKRIRLPTEEKI+ IIE+++ +LE  F++K++E  K L      D      
Sbjct: 1231 KVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDD------ 1284

Query: 1576 FEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKS 1635
               +I++  KE+E+   E L++                         E D +L  ++KK+
Sbjct: 1285 ---KIKKIYKEIEESGRETLQQ-------------------------EFDEQLNIVRKKA 1316

Query: 1636 FEEGKQQAMMKTTLLERKLAKMESQ 1660
            FEEGKQ  +MK+  LERK++ +E Q
Sbjct: 1317 FEEGKQHVLMKSAFLERKISMLEGQ 1341

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  182 bits (462), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 148/458 (32%), Positives = 240/458 (52%), Gaps = 31/458 (6%)

Query: 399 LQNQIESFILELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKSEK 458
           L++ I++++ ELE ++P+I +FK   +                 N+K   ++ + +  + 
Sbjct: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273

Query: 459 LKQCENDIQTLIKQRLDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATE 518
           + +  + I+ L  QR DL  Q+QYLLI +S+  D+ GPL K EI+F+QN++  D    + 
Sbjct: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLS- 332

Query: 519 TDSQKIVTERLVEFRSIIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEA 578
           +D Q ++++RL++F+ I+ LQEKN EL K +RNLA  LES E+E K S +  +++TINEA
Sbjct: 333 SDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEA 392

Query: 579 KEAILTLKAXXXXXXXXXXXXXXXXXXXXALLSNEETS---HLNSTIQQLNETKRNLECQ 635
           KE IL+L+                     + + N + S   H N           NL   
Sbjct: 393 KETILSLQEYNNVLKLEIGTLQSKISELQSSIPNSKESEKQHFN--------YHSNL--- 441

Query: 636 IQDLQSNISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNT 695
           ++DL+S +S+++  S   +  LNK+IQ+LY+ ++DI I L KEKSS ILA E+  LL N+
Sbjct: 442 VKDLESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNS 501

Query: 696 LDLTKAENDQLRKRFDCLQSTILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLK 755
            DL   EN++L  +   L+  + +++      LN+YI CK+ L +  T    L    KL 
Sbjct: 502 YDLLTLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNL-LDFTNRLTLLNNNKLG 560

Query: 756 IDSEQN-LKQEMQKLSSEKTGLRIMVTQLQTLQKERENLLDETRKSYQNKIDELE---HA 811
           ++ E N LKQE++    +       +  L +  K  E  L+     Y +K+ ELE     
Sbjct: 561 LEEENNSLKQEIKSNYEQ-------IKDLDSKSKHLEQSLENEISKYTDKVKELELNISK 613

Query: 812 HNE----LKGEASHKDQRIKQLEEDNNSSIEWYQNKIE 845
            NE    L+ +  +K+  I  L   N   I WYQ K++
Sbjct: 614 LNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLD 651

 Score =  155 bits (392), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 229/866 (26%), Positives = 389/866 (44%), Gaps = 187/866 (21%)

Query: 946  DFSNRIKNLTNEKSSLEEKISLLK-------EQIFNLNN--------------------- 977
            DF+NR+  L N K  LEE+ + LK       EQI +L++                     
Sbjct: 546  DFTNRLTLLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVK 605

Query: 978  ELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQN 1037
            EL+L    + E+K    +K   LQN N E++ + S    ++S  QK LDQ   Y  T + 
Sbjct: 606  ELELNISKLNEQKLILERK---LQNKNIEIDDLNSSNYDQISWYQKKLDQ---YEKTIKT 659

Query: 1038 NYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKALIE 1097
              E  L      SK + E  + L   R   + ++ S +  E T++    S  +++   IE
Sbjct: 660  -LESRLPADTQNSKALVE-DKALEDSR-DASPVSSSASCNEITIRIFGDSNKTKKIYPIE 716

Query: 1098 Q----------LESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSILLSLR 1147
            +          LE +  R+++L +QN+LL +++E   +A+  V D         I +SLR
Sbjct: 717  EEKNLELITKELEDTKVRVQNLATQNRLLLEKLE--RSANLEVDD---------IFVSLR 765

Query: 1148 RERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQH----- 1202
             ERD L  +V   E+D +++   +  +  EL  A +++    L  E +  ++Q H     
Sbjct: 766  YERDTLSDQVVNYEKDMQVILADLESVQSELNAANSQI----LNFENQRAMVQDHKKGNV 821

Query: 1203 --EDIMEKLNQLNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALKYS 1260
              E ++EKL +L+ L+E N+ L             L+ +L++  + + P+E++++ L   
Sbjct: 822  NEETLIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNIL 881

Query: 1261 MQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAE 1320
            +++K+  + ++ E+   WK R  ++    +   + D   L+ +++       EK+++  E
Sbjct: 882  IEDKDNIINVSNEKAENWKTRFNELTLSAKNNDNEDLINLQKQVE-------EKSKENEE 934

Query: 1321 AEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAKAE 1380
              +RFNRL++QA ER            EQ N+LK     LE++L +   + +ELEN+ + 
Sbjct: 935  LSDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISL 994

Query: 1381 QDNNQLDAIKRLQQDAENS---SKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXX 1437
            +D  +L +I  L++   N+   SK+F+ +L +  +  +S +  L  EI +          
Sbjct: 995  KDQ-ELGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKSKES 1053

Query: 1438 XXXXXXSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQP-SNI 1496
                  SE           +E+ KK                    I E +E+LN+  S +
Sbjct: 1054 SVGLQESE-----------IENAKKIL------------------IAELEEKLNKTKSEL 1084

Query: 1497 NI---DELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDE 1553
            ++   +ELK+  K E+E ++  R+ EAEEALK++IRLP+EEKI+ IIE K  DLE+++ +
Sbjct: 1085 DLKHKEELKV-LKTEYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKK 1143

Query: 1554 KVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLR 1613
            K+E                                              ++S +  D   
Sbjct: 1144 KLE----------------------------------------------TVSAESTD--- 1154

Query: 1614 AEIETKMRKELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESPSK 1673
              IE K+++E ++ L + KKK+FEEGKQQA MKT  LE K+AK+ESQL   +        
Sbjct: 1155 --IE-KIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQNNESDVTDKEA 1211

Query: 1674 HVNHTQNQLLGLPR--KIEENSSSSFNPXXXXXXXXXXXXXXXXXXXFNPFTSPSPNKSS 1731
             V  T N+    P   K E   S +F+P                    NPFT+     S 
Sbjct: 1212 EVKTTDNEKSN-PELDKQEAKPSFTFSPPPNS----------------NPFTTTQDTDSP 1254

Query: 1732 QKVDDQRELTTNKADP--PTHLTPSF 1755
              V   +   +  A+P   + + PSF
Sbjct: 1255 VSVFGIKPTFSLGANPFKISPVAPSF 1280

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score =  167 bits (422), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 177/558 (31%), Positives = 280/558 (50%), Gaps = 99/558 (17%)

Query: 1165 KMLRQKISLMDIELQEARTKLDNSRLEEEKRPTII---------QQHEDIMEKLNQLNLL 1215
            KML   ++  +  L+ AR +  N R   EK P+ +         +  E++ME   +L  L
Sbjct: 1016 KMLALNLNSANYSLRRARYRNKNPR---EKFPSFVKIDQQSKKEEDKEEVMENTTKLLAL 1072

Query: 1216 RESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEV 1275
             ESN  L             L S+L  ++  + P+E E+  LK  + EKEQ L + +EE+
Sbjct: 1073 EESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEEL 1132

Query: 1276 HRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQER 1335
             RWK RSQ IL++ + +    + K   +I +L+ +L+    + A+  +RF+RL++QA E+
Sbjct: 1133 ERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHEK 1192

Query: 1336 XXXXXXXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNNQLDAIKRLQQD 1395
                         Q+N+L   K+ LEKSL     K  +  N  A++     + I RL+ +
Sbjct: 1193 LDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADES----EEIIRLRAE 1248

Query: 1396 AE---NSSKEFKTKLEEKATFYDSTIKKLNEEIITXXXXXXXXXXXXXXXXSEPANEQND 1452
             E   N S E + K+E+   F +  I+ L  E+                  S  A E + 
Sbjct: 1249 LEKSNNFSNELEKKVEDAKKFKNE-IESLKSEL-----------------QSVKAYENST 1290

Query: 1453 L-SKIVESMKKTFEEDKINFIREKTKEVNEKI------LEAQERLNQPSN----INIDEL 1501
            + SKI++ +K++F+ +K   I +  KE   K+      + AQ + N  +N     NI+EL
Sbjct: 1291 VNSKIIKDLKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIEEL 1350

Query: 1502 KIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKL 1561
            K KW+ E E  ++ RI EAEE LKKR+RLP+EEKI+ +IE++R+ LE+EF+ K+ E    
Sbjct: 1351 KKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE---- 1406

Query: 1562 LSQSGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMR 1621
                                             L   +  N +  D     RA+IE ++R
Sbjct: 1407 ---------------------------------LGLNADGNGVVTD----TRAQIEKELR 1429

Query: 1622 KELDNELQHIKKKSFEEGKQQAMMKTTLLERKLAKMESQLSETKKITESPSKHVNHTQNQ 1681
            ++ + EL  IKKK+FEEGKQQ+MMK+TLLERKL+K+ESQ       T SP+K+ +  + Q
Sbjct: 1430 EKFNLELAEIKKKAFEEGKQQSMMKSTLLERKLSKLESQ-------TLSPTKNNDSNETQ 1482

Query: 1682 LLGLPRKIEENSSSSFNP 1699
               +P KI  ++ +S +P
Sbjct: 1483 ---VPSKINLSNINSSSP 1497

 Score =  141 bits (355), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 166/292 (56%), Gaps = 20/292 (6%)

Query: 283 DCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELD--STRGLETSNDSKKHMSEKEDLV 340
           D L+S KQEF+ EI LKQR+ +LL +++ + K++++  +++ LET          ++ ++
Sbjct: 271 DNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETP---------EKKII 321

Query: 341 KELQLTKEELAQCKSECIRLXXXXXXX----XXXXXXXXXXXXXXFILLKKQLIKEKRAK 396
           +EL   KE+L   + EC  L                           +L++QL+KEKR K
Sbjct: 322 QELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHK 381

Query: 397 EHLQNQIESFILELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSNEKNAKIRELSAKS 456
           + LQ Q+ESF++ELE K+P+I+SFKER  +              T+ E++ K REL+   
Sbjct: 382 DTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQ 441

Query: 457 EKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTA 516
           +K+   E     L++QR DL  QVQYLL+      D+K P  ++E   ++ I+ N+ +T 
Sbjct: 442 KKISNNEQFNDELLRQRSDLAHQVQYLLL----CIDNKSPFTEKEATLVKKIVSNE-NTE 496

Query: 517 TETDSQKIVTERLVEFRSIIELQEKNTELLKIVRNLADRLESNENESKQSLQ 568
            +TDS KI+++RL+ F+++ ELQ+KN ELL+  R L   LE  E E +++L+
Sbjct: 497 NDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQTLERQEQEQQKTLR 548

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  125 bits (314), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 120/480 (25%), Positives = 245/480 (51%), Gaps = 28/480 (5%)

Query: 382 FILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTXXXXXXXXXXXXXHT 441
           FI+LKK++ K +  ++ LQ ++E  I ELE+  P +N+  ++ +              +T
Sbjct: 298 FIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKIN----ELELLLSKEKNT 353

Query: 442 SNEKNAKIRELSAKSE----KLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSKDSKGPL 497
           S      I+E+  + +    +LK  ++ I+TL ++  DL  Q+Q++LI+NS+  D  G L
Sbjct: 354 SEHFKTTIKEIENEKKNIISRLKLSDDKIETLREENNDLTNQIQFMLISNSIQNDKYGEL 413

Query: 498 RKEEIMFIQNILQNDSDTATE--TDSQKIVTERLVEFRSIIELQEKNTELLKIVRNLADR 555
            + EI FI+ + +  ++T+     +SQ I+++RL+ F S+I LQ+KN EL+K +R +  +
Sbjct: 414 TENEIKFIKALREKGTETSFNELYNSQDIISDRLIRFESVISLQQKNMELIKTLRLITKK 473

Query: 556 LESNENESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXXALLSNEET 615
           L++ E+E +   +    + +NEAKE IL + +                     L +N   
Sbjct: 474 LDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQ------LNANRPV 527

Query: 616 SH-LNSTIQQLNETKRNLECQ---IQDLQSNISQITRESTENMSLLNKEIQDLYDSKSDI 671
           SH  N     L E K   E     + +L++NI + T++++  +S+   ++  LY+   ++
Sbjct: 528 SHEKNGHESVLAENKLYTEGDRLILDELKNNIPEFTKQASNIISMNFDQLTSLYNKNLEL 587

Query: 672 SIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETLNEY 731
           +    K   SR + +++  LL +  D     N++L++  + ++ TI ++D     T+  +
Sbjct: 588 TADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVIKDTIRRKDETLNSTIANH 647

Query: 732 ISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSS----EKTGLRIMVTQLQTLQ 787
           + CK+ L     ++ +L      K D  + LK +  ++++    E+  L++ +  ++T+Q
Sbjct: 648 VDCKASLLSVTNDMNSL----MTKYDELKYLKDQQSRITNELKMEREQLKMELLNIKTVQ 703

Query: 788 KERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVL 847
            + +    E + S  +KI++LE  ++ L  +   K+Q ++      N  ++WYQ K ++ 
Sbjct: 704 IQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQELQDFISTKNRELDWYQKKFDIF 763

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 154/627 (24%), Positives = 301/627 (48%), Gaps = 71/627 (11%)

Query: 385 LKKQLIKEKRAKEHLQNQIESFILELEHKVPII--NSFKERTDTXXXXXXXXXXXXXHTS 442
           +K +LIKEK  K  L+ +   F+ ++E K+P +  NS +  T+              H S
Sbjct: 286 IKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETNNGNKIEEQKIIHE-HDS 344

Query: 443 NEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNS-VSKDSKGPLRKEE 501
                K+   S K  KL   E+ ++TL++QR DL  Q+ YLLIT S +++D+   L + E
Sbjct: 345 ----LKLENQSLKI-KLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENE 399

Query: 502 IMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKIVRNLADRLESNEN 561
           + FI+N++   ++T + T++Q I++ERL++F ++ +L  KN +L+ +VR L +++ES E 
Sbjct: 400 LNFIRNLVAQPTNTWS-TETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEK 458

Query: 562 ESKQSLQKIESE--TINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXXALLSNEETSHLN 619
           ++ Q    +E +  +I+EAK+ ++ LK                          EE     
Sbjct: 459 QNSQKFGDLEMDFKSIDEAKQRMIVLK--------------------------EENVKNK 492

Query: 620 STIQQLNETKRNLECQIQDLQSNIS------QITRESTENMSLLNKEIQDLYDSKSDISI 673
             I Q+   K+ LE +I  L S ++      +I RE T     L K  Q L +  + +SI
Sbjct: 493 DIINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNLELQKTNQSLLEKNNQLSI 552

Query: 674 KLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCL-QSTILKQDSKTQETLNEYI 732
           ++    +   + +E+F LL  +      E  +L+       +S+++ +D      ++E +
Sbjct: 553 EISNASNENKILKEKFDLLIKSY----TELKELKSEISTYTKSSVISKDGNETAKISELV 608

Query: 733 SCKSKLNICETELYNLKEE-QKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQKERE 791
             K+K    E    + + + Q+L+I++  N+K E++K+ SE    +     + +  + + 
Sbjct: 609 DLKAKCKNLEKSFKDRESKFQELEIEN-NNVKDELKKVLSEYNTFKSTRGTIDSFNQNKN 667

Query: 792 NLL---DETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLK 848
           ++    +  ++  + +++ ++  +  L+ +   ++  IK L E   S I+WYQ+KI+ + 
Sbjct: 668 SIGINENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMN 727

Query: 849 KDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDDSLRKELEKS 908
              E  I ++         L++K      EIDE K ++ T +            KEL +S
Sbjct: 728 TTMEVKISNLASSAESAAMLKNK-----NEIDELKKQIETKS------------KELTES 770

Query: 909 KISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEKISLL 968
                    Q ++    ++     L++ +   E+S  +   R+  L + + SL+E+I  +
Sbjct: 771 LDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKNELEQRLLLLESSEKSLQEEIVKM 830

Query: 969 KEQIFNLNNELDLQNKGMKEEKAEFRK 995
           K+++   NNELD   +  +E + E+ K
Sbjct: 831 KDELMTSNNELDNNQRSQEELRNEYEK 857

 Score = 41.2 bits (95), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 100/444 (22%), Positives = 192/444 (43%), Gaps = 85/444 (19%)

Query: 1302 HEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQVNDLKNAK---- 1357
            +EID LK +++ K+++  E+ +RF RL++QA+++            E   DL+ +K    
Sbjct: 751  NEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKNELE 810

Query: 1358 ------IKLEKSLDDANTKI-EELENAKAEQDNNQLDAIKRLQQDAENSSKEFKTKLEEK 1410
                     EKSL +   K+ +EL  +  E DNNQ  + + L+ + E  +K +K K EE 
Sbjct: 811  QRLLLLESSEKSLQEEIVKMKDELMTSNNELDNNQ-RSQEELRNEYEKQNKLYKIKEEEL 869

Query: 1411 ATFYDSTIKKLNEEIITXXXXXXXXXXXXXXXXSEPANEQNDLSKIVESMKKTFEEDKIN 1470
             +  +  + K N+                    S P    + + K+ E +KK  E +   
Sbjct: 870  ESALNQLMLKENQ-------------NSALDLESLP---DDVMLKLKEMVKKDIEIENDI 913

Query: 1471 FIREKTKEVNEKILEAQERLN----QPSNINIDELKIKWKAEHEEEVVNRIREAEEALKK 1526
             ++ K KE+ +    + + +N    + S+ NI  +K  W+ E++  +  RI +AE     
Sbjct: 914  ILKAKLKEIEKN---SAKDVNTDSIELSDDNISTMKEAWEKEYQHILKIRIEDAE----- 965

Query: 1527 RIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQEKQKE 1586
                      ++ + R R++LEKE++E                         R+ ++ ++
Sbjct: 966  ----------NQAMARTRKELEKEYEE-------------------------RLSKESEK 990

Query: 1587 LEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMK 1646
            L D+YN KLK+      + ID++  +  E+ETK++ E D       KK F++       K
Sbjct: 991  LSDQYNNKLKDDLSEELLKIDKKYAM--ELETKLKNETDE-----SKKEFQDALGTEQTK 1043

Query: 1647 TTLLERKLAKMESQLSETKKITESPSKHVNHTQNQLLGLPRKIEENSSSSFNPXXXXXXX 1706
              +L +K+  +E+Q+ E K   +  +KH ++       +P     +++ +F         
Sbjct: 1044 NKILSKKIEFLETQIKELK---DEQTKHHSNPMKSDEKIPSTTNLSTNFAFGQNPFVSNA 1100

Query: 1707 XXXXXXXXXXXXFNPFTSPSPNKS 1730
                         +PF+  +P K+
Sbjct: 1101 SQNAYMSNVFLSGSPFSRNAPEKA 1124

>Kwal_55.20347 s55 (364795..367245) [2451 bp, 816 aa] {ON} YIL026C
            (IRR1) - cohesin complex subunit [contig 149] PARTIAL
          Length = 816

 Score = 39.3 bits (90), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 77/165 (46%), Gaps = 26/165 (15%)

Query: 1447 ANEQNDLSKIVESMKKTFEEDKINFIREKTK-EVNEKILEAQERLNQPSNINIDELKIKW 1505
            AN +ND   I E++ KTF+  ++N      K E+  K+LE  +RLN P   NI+E+   W
Sbjct: 408  ANRENDFQVITETIVKTFDRMQLNNDEHNNKREIYAKVLEYHQRLNLP---NINEM---W 461

Query: 1506 KAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERI-KLLSQ 1564
            K +     V+RIR     +  ++ L T+ +           L + F    E  + KL+  
Sbjct: 462  KDQ-----VDRIR-----ISLQVYLDTKAE-----SLDGPGLNEVFTTVFETYVSKLVLL 506

Query: 1565 SGQMDVTFQKQFEIRIQEKQKELEDKYNEKLKELSHSNSISIDER 1609
              +M + F  +F   IQ    ++ D+  E L+ L+     SID R
Sbjct: 507  GKEMPLDFTSEF---IQLFFAKVVDRLPEALQSLNEEALASIDIR 548

>KLLA0D07370g Chr4 complement(630095..631894) [1800 bp, 599 aa] {ON}
           similar to uniprot|P40445 Saccharomyces cerevisiae
           YIL166C Hypothetical ORF
          Length = 599

 Score = 38.9 bits (89), Expect = 0.13,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 134 KKELQCNQQRTLKILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSD 190
           K+E  C   R+ K  ++  K L +A SD  R++ + KR+  +  D+E + QD +TSD
Sbjct: 35  KREF-CYSIRSYKPANQHYKSLAMADSDKRRAEVDVKRVSISSFDVEIRSQDSLTSD 90

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 38.1 bits (87), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 127/527 (24%), Positives = 225/527 (42%), Gaps = 86/527 (16%)

Query: 384 LLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTDTXXXXXXXXXXXXXHTSN 443
           +LKK L+ EK +   LQ ++ S +LEL  K+P + S KE+                    
Sbjct: 211 VLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQ 270

Query: 444 EKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLITNSVSKDSKGPLR--KEE 501
           + ++   ++++ + K+   E  ++ L+ QR +L   + Y+L   +V   +   L   + E
Sbjct: 271 QFHSNTDKIASMNNKIVDYEQSLKQLLSQRTNL---ISYILNLLNVINLNSKYLNLSESE 327

Query: 502 IMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTELLKIVRNLADRLESNEN 561
              IQN+  N               ER+  F     LQEKN  L +I  NL + ++   N
Sbjct: 328 GCLIQNLFNN---------------ERIQRF-----LQEKNLTLTEIFDNL-NTVDITFN 366

Query: 562 ESKQSLQKIESETINEAKEAILTLKAXXXXXXXXXXXXXXXXXXXXALLSNEETSHLN-- 619
              +S  K+   T + +KE I+  K                      L +N  T  L+  
Sbjct: 367 NFNRSDIKVLPPTESASKEEIINYK------NEIILLENNCDAYKMILYNNGITEDLDEK 420

Query: 620 ------STIQQLNETK---RNLECQIQDLQSNISQITRESTENMSLLNKEIQDLYDSKSD 670
                 S + +LNE     + LE +I +L S ++++  +++  M+ +NK       S+S 
Sbjct: 421 LKIESSSRMTELNEKNSRIQMLESKIDELNSIVTKLNEKNSRFMASINKN----NSSEST 476

Query: 671 ISIKLG-KEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQETLN 729
           I  K     +S + L E    L SN  D  KA           L ST+   D+K      
Sbjct: 477 ILEKYNLLNQSYKTLLEAYKSLKSNATDNKKA----------VLTSTL--DDTK------ 518

Query: 730 EYISCKSKLNICETELYNLKEEQKLKIDSEQN--LKQEMQKLSSEKTGLRIMVTQLQTLQ 787
           + +  KS +N   + + +L    KL    E N  L  E QK+  E + L  ++ ++ T  
Sbjct: 519 KIVEFKSTINYLNSTIKSLS--AKLVSIQESNDLLADENQKIKMENSNLSSLLNKINT-- 574

Query: 788 KERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIE-- 845
            ++ ++ +E    +  +I ELE    +L  +    ++++K+  E +N  I+W+QNKI+  
Sbjct: 575 -DKNSISNELSDLHSKEILELETEKTKLLEQLEEGERKLKETNEKHNEQIKWFQNKIDNF 633

Query: 846 -----------VLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDE 881
                       LK D E++  S  +K  E+E+   K   L+++ +E
Sbjct: 634 NEETTKNQFNNALKNDYENLKKSFEEKSKEVEEANDKFSRLKRQANE 680

 Score = 36.6 bits (83), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 77/151 (50%), Gaps = 3/151 (1%)

Query: 1233 KRVLQSELDKL-KQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQ 1291
            K  + +EL  L  ++I  +E+E   L   ++E E++L+ T E+ +   K  Q+ ++   +
Sbjct: 576  KNSISNELSDLHSKEILELETEKTKLLEQLEEGERKLKETNEKHNEQIKWFQNKIDNFNE 635

Query: 1292 MSSSDY--EKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERXXXXXXXXXXXXEQ 1349
             ++ +     L+++ ++LK   +EK+++  EA ++F+RL+RQA ER            + 
Sbjct: 636  ETTKNQFNNALKNDYENLKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQKELSDN 695

Query: 1350 VNDLKNAKIKLEKSLDDANTKIEELENAKAE 1380
            V  L++ +   ++ +      I  L NA  E
Sbjct: 696  VKSLEDERTNFKEHISKLEVDINNLNNALVE 726

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
            YMR284W
          Length = 648

 Score = 35.8 bits (81), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 60/116 (51%), Gaps = 5/116 (4%)

Query: 919  IQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNE 978
            I E+ +L + N K++K++    E+ S D   +++++    +S   K+    E IFN+  E
Sbjct: 97   IYEFFQLSDINVKTMKKVTDLLEDLSHD-RKKLEDIFKFDNSRPTKL----EDIFNVVQE 151

Query: 979  LDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANT 1034
              L    +   K    KK+ +  NN+K +E+  +E   KL ++  DL++  I+ +T
Sbjct: 152  QFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNESEIFFST 207

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL058W
            (USO1)
          Length = 1292

 Score = 35.8 bits (81), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 73/155 (47%), Gaps = 10/155 (6%)

Query: 1281 RSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERXXXXX 1340
            RS DI + + ++S   +E+L+    ++  +L E +    E   +     R+ QE+     
Sbjct: 681  RSPDI-DPNGKISFEAFEELQQRFTTVNKELCELSSSSMEEIHKLELDLRKCQEQYKQLM 739

Query: 1341 XXXXXXXEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNNQLDAIKRL--QQDAEN 1398
                    QV+DL     +L+  LD+AN+K+E+L   K   +  + D +K+L   +   N
Sbjct: 740  KAKQESDTQVSDLDEKLAQLKTQLDEANSKVEDLSTKKTTLEAAKADCLKKLASHEGQVN 799

Query: 1399 SSKEFKTKLE-------EKATFYDSTIKKLNEEII 1426
            S K   T+LE       E+ +  ++ I K+N E+ 
Sbjct: 800  SLKNRTTQLEKQLATVSEQKSTAEAGINKMNRELF 834

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 35.4 bits (80), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 136/283 (48%), Gaps = 54/283 (19%)

Query: 1035 AQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKENERSWTSQRKA 1094
            AQ NY++EL+K++ +SK +  L+++          +TL++ +L  T K  E+  ++QRK 
Sbjct: 429  AQENYDKELEKYSTISKELKNLQDE---------EITLNK-RLNETKKYEEKLLSNQRKN 478

Query: 1095 LIEQLESSNSRIEDLTSQNKLLYDQIE-LYTTADKGVTDTNDKPALNSILLSLRRERDIL 1153
              E L S+   I+++  +     D  E L  T +K +T TN+K      L +L  +++  
Sbjct: 479  NSE-LISTQEMIKNIEKKK----DNAEKLVNTTEKSITQTNNK------LETLNNQQEDY 527

Query: 1154 DTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEK--RPTIIQQHEDIMEKLNQ 1211
              ++       K+ + K+  + I L+    +  N  L+ EK   P  IQ    + EK++Q
Sbjct: 528  TKQIEELNEKLKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQ----LQEKMSQ 583

Query: 1212 LNLLRESNITLRXXXXXXXXXKRVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLT 1271
            + L                     LQSE+  L ++   + +E+ ++K  ++EK+  +   
Sbjct: 584  IQL---------------------LQSEISLLNENKDNLSNEIISIKKLIEEKKLSVVRM 622

Query: 1272 KEEVHRWKKRSQDILEKHRQMSSSD--YEKLEHEIDSLKVKLD 1312
             E++  WK   Q +LE+ +++ S D  + K   +I  ++ KLD
Sbjct: 623  SEKITGWK---QQLLEQRKEVESGDIEFNKFTKKIQEMRDKLD 662

>ZYRO0C17094g Chr3 complement(1327234..1328682) [1449 bp, 482 aa]
           {ON} weakly similar to uniprot|P38272 Saccharomyces
           cerevisiae YBR130C SHE3 Protein that acts as an adaptor
           between Myo4p and the She2p-mRNA complex part of the
           mRNA localization machinery that restricts accumulation
           of certain proteins to the bud also required for
           cortical ER inheritance
          Length = 482

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 56/263 (21%), Positives = 111/263 (42%), Gaps = 46/263 (17%)

Query: 2   PDHDISIKSVQNSDNTDERLKAIASFFGFSFEQVES----------INSDLIKHLNDKLL 51
           P+H I + S+  S    ++     +  G   +  +           +++ +I+ L+D   
Sbjct: 46  PNHGIFMASINKSSPAGKK-SGEGAVLGMGAQSTKDNSTPRQNSSMLSTRVIESLHD--- 101

Query: 52  QFNELKSENLQITVS----FDELKTNS---SKKIDN---LKKEMENLI------------ 89
           Q + L S NLQ+TV      D+L T     SK ++N   LK E ENL+            
Sbjct: 102 QVDTLTSTNLQLTVQSKNLLDKLDTAQQKESKMLENSASLKHENENLVSMLNRKTRRLKD 161

Query: 90  ---------KQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCN 140
                    K +D + +E+     K ES  +E+  +  ++E ++ + D L++  +  + +
Sbjct: 162 VEEELASHKKNHDSLEEEKTALQKKWESSSSEEATLRQQMEMVQAQYDALVDSHQYYKSH 221

Query: 141 QQRTLKILDERLKELEI-ARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELER 199
               +  L E+L+ L++  R+   R  +E     + +++ ++K  +L  ++      LE 
Sbjct: 222 YSSQISTLSEQLENLKLEQRNYTQRVSDEANTFNAKLLEFDSKHANLQQAEETRVKYLES 281

Query: 200 KAQELNILQSTNDWLEKELCSKN 222
           K   L        W++    SKN
Sbjct: 282 KYDSLTQQLDLPSWVQLYRESKN 304

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
            (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 68/144 (47%), Gaps = 16/144 (11%)

Query: 914  DAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEK-SSLEEKISLLKEQI 972
            +A   I E   L + NA+S+K+++   ++ +        N T EK   L+E++S   E +
Sbjct: 75   NATGGIYELLPLLDVNARSMKKLNDLLDDITA------ANTTLEKQFPLDEQLSTPLETV 128

Query: 973  FNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQ----- 1027
            F L  E  L    +  +KA   KKI +  +N+   EA  S+   +L K+  DLD      
Sbjct: 129  FILLQEQFLNQ--VPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLDDCHINF 186

Query: 1028 QTIYANTAQNNYEQELQKHADVSK 1051
             T +  T Q  ++Q    ++D+ K
Sbjct: 187  TTFFIGTEQKPFDQSF--YSDILK 208

>CAGL0C05577g Chr3 (536419..538278) [1860 bp, 619 aa] {ON} weakly
           similar to uniprot|Q07732 Saccharomyces cerevisiae
           YDL239c
          Length = 619

 Score = 34.3 bits (77), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (49%), Gaps = 7/121 (5%)

Query: 56  LKSENLQITVSFDELKTNSSKKIDNLKKEMENLIKQNDGIRKERDDTC---DKLES---- 108
           LK EN  +    + LK    K+I  LKKE + L+  N G+ KE D+      KLE     
Sbjct: 397 LKEENDLLKGRMELLKQKQEKEIQELKKENKRLLTMNVGLTKELDEIKRDKGKLEGNLLK 456

Query: 109 EKNEKTKISNELESIKRRADDLIEEKKELQCNQQRTLKILDERLKELEIARSDNNRSDNE 168
           EKN+ T + NEL SI    +DL    + L+ N + +L     +++ + ++  + N  D E
Sbjct: 457 EKNKNTLLKNELASIANDNNDLKSSLQNLEGNIEESLTEEALKVRFISLSSENYNTLDVE 516

Query: 169 C 169
           C
Sbjct: 517 C 517

>KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some
           similarities with uniprot|Q06704 Saccharomyces
           cerevisiae YLR309C IMH1 Protein involved in vesicular
           transport mediates transport between an endosomal
           compartment and the Golgi contains a Golgi-localization
           (GRIP) domain that interacts with activated Arl1p-GTP to
           localize Imh1p to the Golgi
          Length = 768

 Score = 33.9 bits (76), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 87/193 (45%), Gaps = 31/193 (16%)

Query: 702 ENDQLRKRFDCLQSTI-----LKQDSKTQ-ETLNEYISCKSKLNICETELYNLKEEQKLK 755
           EN +L +R + LQ  +     LK +S  Q ET+ +          CE   + LK+  K  
Sbjct: 456 ENGKLSERLEVLQEKLETLQNLKSNSNDQVETIRKQ---------CEELSFKLKDANKKI 506

Query: 756 IDSEQNLKQE---MQKLSSEKTGLRIMVTQLQTLQKERENLLDETRKSYQNKIDELEHAH 812
           +  E  L +    +Q+ + E T +R M+ +LQT   ++ N + E        ++E     
Sbjct: 507 LSLEDELNENANILQERNRETTTMRKMLNELQT---DKSNRVKELESRLHFAVEEKSKIE 563

Query: 813 NELKGEASHKDQRIKQLEEDNNS----------SIEWYQNKIEVLKKDNESIICSMNDKQ 862
           NEL+ E + K Q +KQL++ N             IE Y  +IE LK   E +  S N  Q
Sbjct: 564 NELQMELTRKSQDLKQLKQKNTQLQSVNHDQLIKIEQYSAEIEELKSTFERMKRSNNVSQ 623

Query: 863 AEIEKLQHKVKSL 875
            +  +L   VKSL
Sbjct: 624 EDTSELDSIVKSL 636

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 33.9 bits (76), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%), Gaps = 5/76 (6%)

Query: 190  DLNSRAELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSD 249
            D+NSR +L  K +  + ++S N  LEKEL   NE+    ++ + K IL + +++  L  +
Sbjct: 1687 DINSRLDL--KIKNFDSIESKNSDLEKELLKVNEELAHLKESSSKTILSLNDKITSLSEE 1744

Query: 250  FQVEKTKNDVLTQKND 265
            F+ E+T+   LT+ +D
Sbjct: 1745 FEKERTQ---LTEGSD 1757

>Kwal_26.9095 s26 (1071970..1073349) [1380 bp, 459 aa] {ON} YMR220W
            (ERG8) - 48 kDa Phosphomevalonate kinase [contig 69] FULL
          Length = 459

 Score = 33.1 bits (74), Expect = 6.8,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 14/95 (14%)

Query: 1451 NDLSKIVESMKKTFEEDKINFIR-----EKTKEVNEKILEAQERLNQPSNINIDELKIKW 1505
            ++ +K+V  +K  +E   IN+ R      K  E N K ++  ERL Q S  +  E K+  
Sbjct: 284  SETTKLVTKVKAWYE---INYPRSLEVYHKINEGNSKFIQGIERLTQFSKNSPSEYKLLL 340

Query: 1506 KAEHEEEVVNR------IREAEEALKKRIRLPTEE 1534
            KA  E   +N+      I+EA E ++   RL T E
Sbjct: 341  KALDEGSSLNKYDIITDIKEAIEQVRSNFRLITTE 375

>TBLA0C02560 Chr3 (604893..612629) [7737 bp, 2578 aa] {ON} Anc_3.443
            YPR117W
          Length = 2578

 Score = 33.5 bits (75), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 9/83 (10%)

Query: 1595 LKELSHSNS-ISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQAMMKT------ 1647
            ++ +SHSN+  S D R  L   I+ ++ K + + LQ      FE+   Q  MK       
Sbjct: 1865 MRRVSHSNAQSSYDNRFMLH-NIQLRINKSIRDHLQDYATAIFEKKSTQFFMKYKSVRIL 1923

Query: 1648 -TLLERKLAKMESQLSETKKITE 1669
             TLL   L  M++ +SE   +TE
Sbjct: 1924 QTLLNTSLFNMKTSISEFGFVTE 1946

>TDEL0E03590 Chr5 complement(670913..676561) [5649 bp, 1882 aa] {ON}
            Anc_5.267 YHR023W
          Length = 1882

 Score = 33.5 bits (75), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 66/127 (51%), Gaps = 20/127 (15%)

Query: 736  SKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQTLQKERENL-- 793
            S++N  E  +  L  E+ L   +E++L ++++  ++E   +RI    L T+ +E+ NL  
Sbjct: 1589 SQVNHYEKLVGTLGNERDLADAAEKDLGKQLESANAEIKSMRIT---LDTVSREKSNLEQ 1645

Query: 794  -LDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEED----------NNSSIEWYQN 842
             L+  R  YQN I +LE + NE K + S+K   +K LEE           N S ++   N
Sbjct: 1646 DLEHLRGEYQNSIRDLEKSLNE-KYDISNK---VKCLEETLALQNDQNLRNESLVKQLHN 1701

Query: 843  KIEVLKK 849
             ++ LKK
Sbjct: 1702 DVDTLKK 1708

>ZYRO0F09570g Chr6 (777197..779704) [2508 bp, 835 aa] {ON} similar to
            uniprot|Q756L3 Ashbya gossypii AER241W AER241Wp and
            weakly similar to uniprot|P32380 Saccharomyces cerevisiae
            YDR356W SPC110 Inner plaque spindle pole body (SPB)
            component
          Length = 835

 Score = 33.5 bits (75), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 50/231 (21%), Positives = 119/231 (51%), Gaps = 22/231 (9%)

Query: 800  SY-QNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLKKDNESIICSM 858
            SY QN++++     N  + E +H + +  +++ED  +  E +Q +I++L+ D  ++  S+
Sbjct: 222  SYVQNQLEKTTLQLNTYRDEVAHLEDKTIRIQEDQRAKEEQHQLEIQMLRSDVNNLNVSL 281

Query: 859  NDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVIDGTINDDSLRKELEKSKISLTDAYSQ 918
             +K++E+E+ + K++ L  +       LH ++   G+ +   L ++LE  + S++    +
Sbjct: 282  VNKESELEEDRAKIQRLMNQ-------LHEFDH-KGSQSLLDLERQLEMKRDSISSLEKE 333

Query: 919  IQEY---KELYETNAKSLKQMHSKFEESSKDFSNRIKN----------LTNEKSSLEEKI 965
            ++     +   ET  K  +  ++K +   +   + +KN          L + K+SL++K+
Sbjct: 334  VRALTHDRVHLETRIKDREIENAKIQSELERLRDNVKNNNSSNFEIGELKHAKASLDDKV 393

Query: 966  SLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYES 1016
              L E+  NLN  +    K   E K+++++  S+  N+ K  ++++ E ++
Sbjct: 394  RNLTEERHNLNQRISALRKECDEWKSKYQRNESLDSNHRKAFDSLRQELQT 444

>YER071C Chr5 complement(301947..302327) [381 bp, 126 aa] {ON}
            TDA2Protein of unknown function; green fluorescent
            protein (GFP)-fusion protein localizes to the cytoplasm
            in a punctate pattern; null mutant is sensitive to
            expression of the top1-T722A allele
          Length = 126

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query: 1174 MDIELQEARTKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRES 1218
            M IE+++ R+  DNS L E K  T+IQ+  D ++  N++NL  ES
Sbjct: 3    MQIEIKDGRS--DNSPLPERKLVTLIQESYDSLKDDNEINLSTES 45

>TDEL0B07090 Chr2 complement(1249326..1251647) [2322 bp, 773 aa] {ON}
            Anc_2.616 YKL072W
          Length = 773

 Score = 33.1 bits (74), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 101/225 (44%), Gaps = 47/225 (20%)

Query: 867  KLQHKVKSLEKEIDENKIRLHTYNVIDGTINDDSLRKELEKSKISLTDAYSQIQEYKELY 926
            K++HK+++ ++ +DE         + +G ++      E  KS+++  D  +++Q    +Y
Sbjct: 579  KMKHKLEA-QQRMDE---------MTEGCVDVSGKNSECHKSRVAFGDLMNELQG---VY 625

Query: 927  ETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGM 986
            +                  D ++R+  L ++K  +E K +LLK ++  LN+   L +K  
Sbjct: 626  Q------------------DCTSRVGELDDKKQEVETKRTLLKGEMRELNS---LSSK-- 662

Query: 987  KEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKH 1046
                  F+  + +++   ++VE   + +E+KL  +QK L +  +    A ++    L   
Sbjct: 663  ------FQYDMRVIEGRMRDVEDSVNHFEAKLEAVQKSLIENGLGIGMAVDS----LSDK 712

Query: 1047 ADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLKENERSWTSQ 1091
            A   + ISEL    +T + +   L +   +    +KE+   W S 
Sbjct: 713  AAFDRCISELVHARNT-KYEGVCLKMFSKRFVRDIKEDVSKWGSW 756

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 33.1 bits (74), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 107/213 (50%), Gaps = 25/213 (11%)

Query: 814  ELKGEASHKDQRIKQLEEDNNSSIEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVK 873
            EL+G  ++  + + QLE DN +  +    K++ L  + +S+  +    + + E L+ K K
Sbjct: 716  ELQGRCANLKKELVQLELDNKALSDDLNAKLDSLSTEYKSVSGNYERLKNDYEFLEGKHK 775

Query: 874  SLEKEIDENKIRLHTYNVIDGTINDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSL 933
             +EK ++    RL                 E+ K K +LT A  +I E    + +N K +
Sbjct: 776  KVEKSLENVSTRLI----------------EITKDKENLTAANKKITET---FASNKKKI 816

Query: 934  KQMHSKFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNL-NNELDLQNKGMKEEKAE 992
            +   SK         ++++++T++K   EE I+ +  ++FNL  N+ D+++   K EK E
Sbjct: 817  EAYESKI----NTLESKLRDITSKKEQAEEGINKMSRELFNLEKNKEDIESAKKKVEK-E 871

Query: 993  FRKKISILQNNNKEVEAVKSEYESKLSKIQKDL 1025
              K++  ++N NK+++   ++ E +L  + ++L
Sbjct: 872  LNKELENMKNENKKLDNTLAKKEKELQSLDEEL 904

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.124    0.318 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 185,017,948
Number of extensions: 8630865
Number of successful extensions: 97776
Number of sequences better than 10.0: 4131
Number of HSP's gapped: 81529
Number of HSP's successfully gapped: 10869
Length of query: 1878
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1754
Effective length of database: 39,262,815
Effective search space: 68866977510
Effective search space used: 68866977510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)