Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_11.3565.698ON60260230200.0
YKR093W (PTR2)5.698ON60160129210.0
Suva_11.3295.698ON60160128360.0
NCAS0A032205.698ON61160421170.0
CAGL0G02453g5.698ON59760221020.0
NDAI0E050205.698ON61960020920.0
KNAG0C065705.698ON59056220780.0
Kpol_529.285.698ON61060320490.0
Skud_11.3315.698ON39939720260.0
ZYRO0G06688g5.698ON61350519860.0
TPHA0N01960singletonON59151219730.0
SAKL0E14828g5.698ON59251119620.0
TBLA0A091205.698ON63353319650.0
TPHA0O02000singletonON62053419440.0
KAFR0H002405.698ON59156619390.0
TDEL0B022305.698ON57450219110.0
KLLA0E12915g5.698ON65450819140.0
KAFR0H00230singletonON59659818920.0
TBLA0E01140singletonON61158818650.0
TBLA0B04710singletonON61553417690.0
Kwal_47.16930na 1ON6115475684e-64
KLTH0D16544gna 1ON6265725669e-64
AGL365Cna 2ON5995605465e-61
Ecym_2823na 2ON6135645072e-55
AFR228WsingletonON5765334683e-50
KNAG0K016203.227ON407228770.83
KLLA0F07513g7.80ON104825715.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_11.356
         (602 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...  1167   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...  1129   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...  1097   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   820   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   814   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   810   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   805   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   793   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   785   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   769   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   764   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   760   0.0  
TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...   761   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   753   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   751   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   740   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   741   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      733   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   723   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            686   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   223   4e-64
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   222   9e-64
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   214   5e-61
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   199   2e-55
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   184   3e-50
KNAG0K01620 Chr11 (336059..337282) [1224 bp, 407 aa] {ON}              34   0.83 
KLLA0F07513g Chr6 (707516..710662) [3147 bp, 1048 aa] {ON} simil...    32   5.1  

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score = 1167 bits (3020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/602 (94%), Positives = 569/602 (94%)

Query: 1   MLNHPSRSSDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSXXXXXX 60
           MLNHPSRSSDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHS      
Sbjct: 1   MLNHPSRSSDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSPEDEDF 60

Query: 61  XXXXXXXXKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLG 120
                   KTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLG
Sbjct: 61  EAPTEEETKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLG 120

Query: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
Sbjct: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180

Query: 181 GNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITL 240
           GNRDS                   KANISVLIADQLPKRKPFIKVLKSGERVIVDSNITL
Sbjct: 181 GNRDSAIGGFIAAIILIGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITL 240

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300
           QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI
Sbjct: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300

Query: 301 GDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPI 360
           GDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPI
Sbjct: 301 GDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPI 360

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKP 420
           YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKP
Sbjct: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKP 420

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSE 480
           ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSE
Sbjct: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSE 480

Query: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
Sbjct: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540

Query: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAK 600
           CFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAK
Sbjct: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAK 600

Query: 601 YS 602
           YS
Sbjct: 601 YS 602

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score = 1129 bits (2921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/601 (91%), Positives = 559/601 (93%)

Query: 1   MLNHPSRSSDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSXXXXXX 60
           MLNHPS+ SD+ QDEKQGDFPVIEEEKT AVTLKDSYVSDDVANSTE+YNLS S      
Sbjct: 1   MLNHPSQGSDDAQDEKQGDFPVIEEEKTQAVTLKDSYVSDDVANSTERYNLSPSPEDEDF 60

Query: 61  XXXXXXXXKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLG 120
                   +TLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVL 
Sbjct: 61  EGPTEEEMQTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLS 120

Query: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
Sbjct: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180

Query: 181 GNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITL 240
           GNRDS                   KAN+SVLIADQLPKRKP IKVLKSGERVIVDSNITL
Sbjct: 181 GNRDSAIGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITL 240

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300
           QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI
Sbjct: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300

Query: 301 GDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPI 360
           GDKV+AKSF+VCWILTKNKFDFNAAKPSVHPE+NYPWNDKFVDEIKRALAACKVF+FYPI
Sbjct: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPI 360

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKP 420
           YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALI+FIPIFEKFVYPFIRRYTPLKP
Sbjct: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKP 420

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSE 480
           ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNH+HVCWQIPAYVLISFSE
Sbjct: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHVHVCWQIPAYVLISFSE 480

Query: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
Sbjct: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540

Query: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAK 600
           CFISGCLFWLCFRKYNDTEEEMNAMDYEE+DEFDLN ISAPKANDIEILEP ESLRST K
Sbjct: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTTK 600

Query: 601 Y 601
           Y
Sbjct: 601 Y 601

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score = 1097 bits (2836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/601 (87%), Positives = 550/601 (91%)

Query: 1   MLNHPSRSSDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSXXXXXX 60
           MLNH S+ SD++QDEKQG+FPV+EEEK   VTLKDSYVSDD ANSTE++NLS S      
Sbjct: 1   MLNHLSQGSDDIQDEKQGEFPVVEEEKNQTVTLKDSYVSDDAANSTERFNLSPSPEDNEF 60

Query: 61  XXXXXXXXKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLG 120
                   ++LRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPND+PKG+L 
Sbjct: 61  EAPTDEELRSLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLS 120

Query: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNS GATGLSYFFQFWCYVTPVFGGY+ADTFWGKYNTICCGTAIYIAGIFILFITSIPSV
Sbjct: 121 LNSSGATGLSYFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180

Query: 181 GNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITL 240
           GNRDS                   KAN+SVLIADQLPKRKPFIKVLKSGERVI D NITL
Sbjct: 181 GNRDSALGGFIASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITL 240

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300
           QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFW+AVVTL+FGKKQYIQRPI
Sbjct: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPI 300

Query: 301 GDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPI 360
           GDKV+AKSF+VCWILTKNKFDFNAAKPSVHPE++YPWNDKFVDEIKRALAACKVFVFYPI
Sbjct: 301 GDKVIAKSFKVCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPI 360

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKP 420
           YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALI+FIPIFEKF YPFIRRYTP KP
Sbjct: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKP 420

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSE 480
           ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWY+EPLGHNTPNH+HVCWQIPAYVLISFSE
Sbjct: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYSEPLGHNTPNHVHVCWQIPAYVLISFSE 480

Query: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           IFASITGLEYAYSKAPA+MKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA
Sbjct: 481 IFASITGLEYAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540

Query: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAK 600
           CFISGCLFWLCFRKYNDTEEEMNAMDYEE+DEFDLN IS PKANDIEILEP  SL+ST K
Sbjct: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEEDEFDLNPISQPKANDIEILEPMGSLKSTTK 600

Query: 601 Y 601
           Y
Sbjct: 601 Y 601

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/604 (65%), Positives = 468/604 (77%), Gaps = 7/604 (1%)

Query: 3   NHPSRSSDEVQDEKQGDFPVIEEEKTHAVTLKDSY-VSDDVANSTEQYNLSHSXXXXXXX 61
            H    +D V +++  D     +EKT  +TLK++   S++V +  E Y++ H        
Sbjct: 6   EHEKDGADVVTEKETVDISEKAQEKTQEITLKETTGSSEEVHDELETYHIHHDEECEPGY 65

Query: 62  XX-XXXXXKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLG 120
                   +TLRHV GKIP+RCWLIA+VEL+ERFSYYGLSAPFQNYME GPND+P GVL 
Sbjct: 66  EIPTEEDMETLRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLE 125

Query: 121 LNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSV 180
           LNS GATGLSYFFQFWCYVTPVFGG++ADT+WGKYNTIC GT IY+AGIFILFITSIPS+
Sbjct: 126 LNSSGATGLSYFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSI 185

Query: 181 GNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITL 240
            ++D+                   KAN+SVLIADQLPKRKP +K LKSGERV+ D NITL
Sbjct: 186 ASKDTSLGGFIAAIILIGIATGMIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITL 245

Query: 241 QNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPI 300
           QNVFM+FY M+NVGSLS++ATTELE HK FWAA+LLPFCFFWIAVV L+ G+ QY++   
Sbjct: 246 QNVFMWFYLMVNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGK 305

Query: 301 GDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPI 360
            +K + KSF++ WI++KNKFD  +AKPS HPE+NYPW DKFVDE  RAL+ACKVF+FYPI
Sbjct: 306 REKSIQKSFKILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPI 365

Query: 361 YWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKP 420
           YW  YGTMIS+F+TQ SMMELHG+PND  QA DS ALI+FIPI E+F+YPFIRR+TP KP
Sbjct: 366 YWVIYGTMISTFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKP 425

Query: 421 ITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSE 480
           ITKIFFGFMF + AM W+ VLQSF+YKAGP+Y+ PL    PN IHV WQ+PAYVLI+FSE
Sbjct: 426 ITKIFFGFMFATGAMVWSCVLQSFIYKAGPYYDHPLNGGGPNRIHVGWQVPAYVLIAFSE 485

Query: 481 IFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVA 540
           I ASITGLEYAYSKAP SMKSFIMS+FL +NA GS +G ALSPV+VDPKFTWLF GL VA
Sbjct: 486 ILASITGLEYAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVA 545

Query: 541 CFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESL--RST 598
           CFI GC+FW+ FRKYNDTEEEMNAMDYE  DE DL  + +  AND+E L  T+SL  R T
Sbjct: 546 CFIGGCIFWIIFRKYNDTEEEMNAMDYE--DEEDLREMESAGANDLE-LNSTQSLTQRRT 602

Query: 599 AKYS 602
            + S
Sbjct: 603 GESS 606

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/602 (66%), Positives = 465/602 (77%), Gaps = 13/602 (2%)

Query: 1   MLNHPSRSSDEVQD-EKQGDFPVIEEEKTHAV-TLKDS---YVSDDVANSTEQYNLSHSX 55
           MLN  S+ +DE    E Q D   I++  +  V  ++D    ++  D +N+   + L    
Sbjct: 1   MLNRFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLDRDKSNAESNFALGEDD 60

Query: 56  XXXXXXXXXXXXXKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSP 115
                        KTLRHV G IP+RCWLIAIVELSERFSYYGLSAPFQNYM+ GPND+P
Sbjct: 61  DFEAPTEEEL---KTLRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNP 117

Query: 116 KGVLGLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFIT 175
           KG+LGL SQGATGLSYFFQFWCYVTPVFGG+V+DT+WGKYNTIC GT IY+ GIFILFIT
Sbjct: 118 KGLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFIT 177

Query: 176 SIPSVGNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVD 235
           SIP V N D                    K+N+SVLIADQLP +KP + + K GERVI D
Sbjct: 178 SIPGVTNSDGALGGFIAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIED 237

Query: 236 SNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQY 295
            N+TLQNVFMFFYF INVGSLS+MATTELEYHKGFWAAYLLPFCFFW+AV  L+FG+ QY
Sbjct: 238 PNLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQY 297

Query: 296 IQRPIGDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVF 355
           I+ P+GDKV++KSF+V +IL+KNKF+  AAKPS +P++N+PW+DKFVDEIKRAL ACKVF
Sbjct: 298 IKPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVF 357

Query: 356 VFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRY 415
           VFYP+YW  YGTM+++F+TQ   MELH +PNDFLQAFDSIALI+FIPIFE+FVYPFIRRY
Sbjct: 358 VFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRY 417

Query: 416 TPLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVL 475
           TPL+PITKIFFGFM GS AM WAAVLQ F+Y  GPWY+ PL H+TPNHIHV WQIPAYVL
Sbjct: 418 TPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTKGPWYDHPLDHDTPNHIHVAWQIPAYVL 477

Query: 476 ISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFT 535
           I+ SEIFASITGLEYAYSKAP SMKSFIMSIFLLTNAFGSAIGCALSPV+VDPKF W +T
Sbjct: 478 IAISEIFASITGLEYAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYT 537

Query: 536 GLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESL 595
           GLA ACFI+G +FW  +   ND EE MNA+DYE  DEF    +    ++D E  E   S+
Sbjct: 538 GLACACFIAGWVFWFIYSGLNDEEEAMNALDYEH-DEF----MYKHHSDDEEAAEHVRSI 592

Query: 596 RS 597
           +S
Sbjct: 593 KS 594

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  810 bits (2092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/600 (66%), Positives = 462/600 (77%), Gaps = 18/600 (3%)

Query: 2   LNHPSRSSDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSXXXXXXX 61
           +N P      ++DEK  +    ++E T+A T      +++  +  E YNLS+S       
Sbjct: 8   INTPEIRDIVLKDEKIEEITTTKKE-TNATTSS----TEEKLHDVETYNLSNSANDSTND 62

Query: 62  XXXXXXXK-----------TLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYG 110
                  +           TL+ VGGKIP+RCWLI +VEL+ERFSYYGLSAPFQNYM+ G
Sbjct: 63  FDDDEMEEGYEEPTDEELNTLKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNG 122

Query: 111 PNDSPKGVLGLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIF 170
           PNDSPKGVL LNS GATGLSYFFQFWCYVTPVFGG+VADT+WGKYN+I  GT  YI GIF
Sbjct: 123 PNDSPKGVLMLNSSGATGLSYFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIF 182

Query: 171 ILFITSIPSVGNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGE 230
           ILFIT+IPS+ ++++                   KAN+SVLIADQLPKRKP +K+LKSGE
Sbjct: 183 ILFITAIPSIASQNASLGGFIVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGE 242

Query: 231 RVIVDSNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIF 290
           RVI D NITLQNVFM FY MIN+GS+S+MATTELE HKGFWAAYLLPFCFFWIAVV L+F
Sbjct: 243 RVIEDPNITLQNVFMVFYLMINIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVF 302

Query: 291 GKKQYIQRPIGDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALA 350
           G+K Y++  +GD VV KSF+VCWI+ KNK D+NAAKPS HPE NYPWND+FVDE+KR +A
Sbjct: 303 GRKYYVKEKMGDNVVQKSFKVCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIA 362

Query: 351 ACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYP 410
           ACKVFVFYPIYW QYG+MIS+F+TQ S MELHGIPNDFLQ FDSIALI+FIPIFE FVYP
Sbjct: 363 ACKVFVFYPIYWVQYGSMISTFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYP 422

Query: 411 FIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQI 470
           FIRR+TP++PITKI  GF  G  AMTWAAVLQ F+Y  GP Y+ PL  +TPN IHV WQI
Sbjct: 423 FIRRFTPIRPITKITIGFFVGGCAMTWAAVLQHFIYNTGPCYDHPLSCDTPNKIHVAWQI 482

Query: 471 PAYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKF 530
           PAYVLI+FSEIFASITGLEYAYSKAP SMKSF+MSIFLLTNAFGS +G ALS VTVDPKF
Sbjct: 483 PAYVLIAFSEIFASITGLEYAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKF 542

Query: 531 TWLFTGLAVACFISGCLFWLCFRKYNDTEEEMNAMDYE-EDDEFDLNSISAPKANDIEIL 589
            WLF GLAV+C ++G LFWLCFR  N TEEEMNAMDY+ E DE     +S+  A+D+EIL
Sbjct: 543 VWLFGGLAVSCGVTGILFWLCFRGLNATEEEMNAMDYDAEIDEQSKRHLSS-GADDLEIL 601

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/562 (67%), Positives = 451/562 (80%), Gaps = 8/562 (1%)

Query: 9   SDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSXXXXXXXXXXXXXX 68
           S++   +K+ D  V+ +E +H +  +DS + DD+A+  E                     
Sbjct: 10  SEDDSLDKKNDL-VLTKENSHTIE-EDSRIVDDLASQYED------DIPEGYEVPTEEEL 61

Query: 69  KTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATG 128
           +TL+HVGG IPMRCWLIA+VELSERFSYYGLSAPFQNYM  GP+D P G+L LNS GATG
Sbjct: 62  RTLKHVGGHIPMRCWLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATG 121

Query: 129 LSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXX 188
           LSYFFQFWCYVTP+FGGY+ADT WGKYNTI  GT IYI GIFILF+TSIPS+  +++   
Sbjct: 122 LSYFFQFWCYVTPIFGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLG 181

Query: 189 XXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFY 248
                           K+N+SVLIADQLPKRKP +K  K+GERVI D+N+TLQNVFMFFY
Sbjct: 182 GFIVAIILIGIATGMIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFY 241

Query: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKS 308
            MIN+GSLS++AT+ELE H+GFWAAYLLPFCFFWIAVV L+ GK QY++ PIGDKV++K 
Sbjct: 242 LMINIGSLSVIATSELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKC 301

Query: 309 FRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTM 368
           F+V WILTKN+F+F+A KPS++P +NYPW+DKFVDEI+RAL ACKVF+FYPIYWT YG M
Sbjct: 302 FKVLWILTKNRFNFDAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQM 361

Query: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGF 428
           +S F+TQ SMMELHG+PNDF Q  DSIA+IVFIP+ E  +YPFIR+YTP +PITKI+FGF
Sbjct: 362 MSGFVTQGSMMELHGLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGF 421

Query: 429 MFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSEIFASITGL 488
           MF S  M WAAVLQS++YKAGP Y  PL H+ PN IHV  Q+PAYVL++FSEIFASITGL
Sbjct: 422 MFASGCMIWAAVLQSYIYKAGPHYKWPLEHDGPNRIHVALQVPAYVLLAFSEIFASITGL 481

Query: 489 EYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLF 548
           EYAYSKAPASMKSFIMSIFL+TNAFGSAIGCALSPV+ DP +TWL+TGLAVACFISGCLF
Sbjct: 482 EYAYSKAPASMKSFIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLF 541

Query: 549 WLCFRKYNDTEEEMNAMDYEED 570
           W+CFRKYND EEEMNAMDYE D
Sbjct: 542 WVCFRKYNDIEEEMNAMDYEVD 563

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/603 (63%), Positives = 465/603 (77%), Gaps = 16/603 (2%)

Query: 7   RSSDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSXXXXXX------ 60
           R+S E++D+       I+ ++ H V +   + S  + NS +Q  ++              
Sbjct: 8   RTSGELEDDSFASH--IDSKQDHEVKIVSKFDSTSLQNS-DQLEITKVGDDDIEYDDNQD 64

Query: 61  -XXXXXXXXKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVL 119
                    KTL+HV GKIPMRCWLIA+VELSERFSYYGL+APFQNYM  GPND+PKGVL
Sbjct: 65  FVEPTEEEMKTLKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVL 124

Query: 120 GLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPS 179
            L++QGA+ LSYFFQFWCY+TP+FGGY+ADT+WGKYNTIC GT IY+ GIF+LFITS+PS
Sbjct: 125 MLDTQGASALSYFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPS 184

Query: 180 VGNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNIT 239
           +  R++                   KANISVLIA+Q+P+ KP +   K G+RVI D NIT
Sbjct: 185 IDTRETALGGYVTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNIT 244

Query: 240 LQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRP 299
            QNVFMFFY MINVGSLSLMATTELE HKGFWAAYLLPFCFFWIAVV L+ G+ QYI  P
Sbjct: 245 TQNVFMFFYMMINVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVP 304

Query: 300 IGDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYP 359
           +GDK+++KSF+V WIL KNK +F+AAKPS++PE+NYPWNDKFV+EI+RAL ACKVFVFYP
Sbjct: 305 VGDKMISKSFKVMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYP 364

Query: 360 IYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLK 419
           IYW  YG MI++F+TQA  MELH +PNDFLQAFDSIA+IVFIPIFE+F+YPF+RR+TP +
Sbjct: 365 IYWCVYGQMINNFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFR 424

Query: 420 PITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHIHVCWQIPAYV 474
           PITKIF+GFMFGS AM WAAVLQSF+YKAGP YN P+       NTPN +HV WQ+PAYV
Sbjct: 425 PITKIFWGFMFGSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYV 484

Query: 475 LISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLF 534
           LI+ SEI AS+TGLEYAYS APASMKSFIMSIFL+TNAFGSAIG A+SP   DPK+TW F
Sbjct: 485 LIAISEILASVTGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTF 544

Query: 535 TGLAVACFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTES 594
           TGLAVACFI+GCLFW+CFR YN+TE+ MN +D+ +DD+  +   +  K + IE++EP  S
Sbjct: 545 TGLAVACFIAGCLFWICFRSYNNTEDAMNDIDFMDDDDDKIMPTAGEKTS-IEVMEPITS 603

Query: 595 LRS 597
            RS
Sbjct: 604 FRS 606

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/397 (93%), Positives = 386/397 (97%)

Query: 205 KANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATTEL 264
           KAN+SVLIADQLPKRKP IKVLKSGERV++D NITLQNVFMFFYFMINVGSLSLMATTEL
Sbjct: 3   KANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATTEL 62

Query: 265 EYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFRVCWILTKNKFDFNA 324
           EYHKGFWAAYLLPFCFFWIAVVTLI GKKQYIQRPIGDKV+AKSFRVCWIL KNKFDFNA
Sbjct: 63  EYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDFNA 122

Query: 325 AKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGI 384
           AKPS+HPE +YPWNDKFVDEIKRALAACKVF+FYPIYWTQYGTMISSFITQASMMELHGI
Sbjct: 123 AKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELHGI 182

Query: 385 PNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQSF 444
           PNDFLQAFDSIALI+FIPIFEKF+YPFIRRYTP KPITKIFFGFMFGSFAMTWAAVLQSF
Sbjct: 183 PNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQSF 242

Query: 445 VYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIM 504
           +YKAGPWY+EPLGHNTPN +HVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIM
Sbjct: 243 IYKAGPWYDEPLGHNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIM 302

Query: 505 SIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEMNA 564
           SIFLLT AFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFW CFRKYNDTEEEMNA
Sbjct: 303 SIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEEMNA 362

Query: 565 MDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAKY 601
           MDYEE+DEFDLN ISAPKANDIEILEP ESLRSTAKY
Sbjct: 363 MDYEEEDEFDLNPISAPKANDIEILEPMESLRSTAKY 399

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/505 (72%), Positives = 416/505 (82%), Gaps = 1/505 (0%)

Query: 69  KTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATG 128
           ++LRHVGG IP RCWLIAIVELSERFSYYGLSAPFQNYM+ G +D+P GVL L SQGATG
Sbjct: 53  RSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATG 112

Query: 129 LSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXX 188
           L+YFFQFWCYVTPVFGG++ADT+WGKY TIC GT +Y+ GIFILFITS+PSV ++++   
Sbjct: 113 LAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALG 172

Query: 189 XXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFY 248
                           KAN+SVLIADQ PKRKP IK  K GERVI D NIT+QNVFMFFY
Sbjct: 173 GFITAIVLIGIATGMIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFY 232

Query: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKS 308
            MIN+GSLS++ATTELE HKGFWAAYLLPFCFFWIAV+ L  G+K Y++ P+GDKV+AKS
Sbjct: 233 LMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKS 292

Query: 309 FRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTM 368
           FRV   L K++FD+ A KPSVHPE +YPWND FV+EIKRAL ACKVF+FYPIYW  YG M
Sbjct: 293 FRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQM 352

Query: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGF 428
            S+F++    M+LHG+PNDF QA DSIALIVFIPI E ++YPFIRRYTP KPITKIFFGF
Sbjct: 353 TSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGF 412

Query: 429 MFGSFAMTWAAVLQSFVYKAGPWYNEPLG-HNTPNHIHVCWQIPAYVLISFSEIFASITG 487
           M+ S +M WAAVLQ F+YK GP Y+ P+   N PN+IH+ WQ+PAYVLI+FSEIFASITG
Sbjct: 413 MWCSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITG 472

Query: 488 LEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCL 547
           LEYAYSKAP SMKSFIMSIFLLTNAFGSAIGCALSPV  DPK+ W+FTGLAVA FISGCL
Sbjct: 473 LEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCL 532

Query: 548 FWLCFRKYNDTEEEMNAMDYEEDDE 572
           FWL F   NDTEEEMNAMDYEE+ E
Sbjct: 533 FWLTFHHLNDTEEEMNAMDYEENQE 557

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/512 (68%), Positives = 423/512 (82%), Gaps = 5/512 (0%)

Query: 69  KTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATG 128
           KTLRHV G IP+RCWLIAIVEL+ERFSYYGLSAPFQNYM  GPND+PKG+L LNS GAT 
Sbjct: 63  KTLRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQLNSSGATA 122

Query: 129 LSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXX 188
           +SYFFQFWCYVTP+FGGY+ADT WGKYNTIC GT IY++GIFILF+TSI S+  +++   
Sbjct: 123 ISYFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESITTQNAARG 182

Query: 189 XXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFY 248
                           K+NISVLIA+Q+PKRK  +     GERVI D  +T+QN+FMFFY
Sbjct: 183 GYIAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQNIFMFFY 242

Query: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKS 308
            MIN+GSLS++ATTELE HKGFWAAYLLPFCFFWIAVV LI GKKQY+++P+GDKV++K 
Sbjct: 243 LMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVGDKVISKC 302

Query: 309 FRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTM 368
           F + WI  KNK DF++AKPS HPE NYPW DKFV+E++RA+ ACKVF+FYPIYW  YG M
Sbjct: 303 FTITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIYWCVYGQM 362

Query: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGF 428
           +++F+TQA  MELHG+PNDFLQA DSIA+IVFIPI EKF+YPFIR++TP + ITKIF+GF
Sbjct: 363 LNNFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSITKIFWGF 422

Query: 429 MFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHIHVCWQIPAYVLISFSEIFA 483
           MFGS AM WAAVLQSF+YKAGP +++PL       +TPN +H+ WQ+PAYVLI+FSEIFA
Sbjct: 423 MFGSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLIAFSEIFA 482

Query: 484 SITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFI 543
           SITGLEYAYS AP SMKSFIMSIFLLT AFGSA+G A+SP +VDPKFTW FTGLAV+CFI
Sbjct: 483 SITGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTGLAVSCFI 542

Query: 544 SGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDL 575
           +GCLFW+CFRKYN+TE+ M+ +D+ ++   D+
Sbjct: 543 AGCLFWICFRKYNNTEDSMDEIDFIDEKVTDM 574

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/511 (69%), Positives = 427/511 (83%), Gaps = 5/511 (0%)

Query: 69  KTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATG 128
           KTLRHV  +IP+RCWL+A+VEL+ERFSYYGLSAPFQNYM+ GPND+PKG+L L +QGAT 
Sbjct: 60  KTLRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATA 119

Query: 129 LSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXX 188
           LSYFFQFWCYV+P+ GG+VADT+WGKY TIC GT IY+ GIFILFITS+PS+    +   
Sbjct: 120 LSYFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLG 179

Query: 189 XXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFY 248
                           KANISVLIADQ+PK +P +KVLKSGERVI D NIT+QN+FMFFY
Sbjct: 180 GFITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFY 239

Query: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKS 308
            MIN+GSLS++ATTE+E H GFWAAYLLPFCFF++AV  LI G+ QY++ P+GDKV++KS
Sbjct: 240 LMINIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKS 299

Query: 309 FRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTM 368
           F+VCWI+ +NKF F+AA+PS++PE  YPW+DKF+DEIKRA+AACKVFVFYPIYW  YG M
Sbjct: 300 FKVCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQM 359

Query: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGF 428
           +S+F++QA MMELHG+PNDFLQA DSIALIVFIPI E+F+YPFIRR+TP +PITKIF+GF
Sbjct: 360 LSNFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGF 419

Query: 429 MFGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHIHVCWQIPAYVLISFSEIFA 483
           +FG+ AM WAAVLQ F+YKAGP Y  P+       NTPN IH+ WQ+PAYVLI+FSEIFA
Sbjct: 420 IFGALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFA 479

Query: 484 SITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFI 543
           SITGLEYAYSKAP SM+SFIMSIFLLT AFGSA+G ALS V+V+PKF W F+GLAV+CFI
Sbjct: 480 SITGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFI 539

Query: 544 SGCLFWLCFRKYNDTEEEMNAMDYEEDDEFD 574
           +GCLFW  F KYNDTEE MNA+DYEEDD  +
Sbjct: 540 AGCLFWAFFHKYNDTEEAMNAIDYEEDDVLN 570

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/533 (65%), Positives = 431/533 (80%), Gaps = 5/533 (0%)

Query: 69  KTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATG 128
           +TL+HVGGKIP+RCWL+A++EL+ERFSYYGLSAPFQNYM+ GPNDSP G L L+S GATG
Sbjct: 89  RTLKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATG 148

Query: 129 LSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXX 188
           LSYFFQFWCY+TPVF GY+ADT+WGK+ TIC GT IYI GIFILFITS+PS+ + ++   
Sbjct: 149 LSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMG 208

Query: 189 XXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFY 248
                           KAN+SV+IA+Q+PKRK  +   K+G RVI D +IT+QNVFM FY
Sbjct: 209 GFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFY 268

Query: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKS 308
           FMIN+GSLS++ATTELE HKGFWAAYLLPFCFFW+AV+ LI G K YI+ P+GDKV++K 
Sbjct: 269 FMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKC 328

Query: 309 FRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTM 368
           F+V  IL +N+F+ ++AKP+ +P++NYPW+DKFVDEI RAL ACKVFVFYPIYW  YG M
Sbjct: 329 FKVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQM 388

Query: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGF 428
           +++F++Q   MELHG+PNDF QA DSIALIVFIPI E+FVYPFIR+YTP KPITKIF+GF
Sbjct: 389 LNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGF 448

Query: 429 MFGSFAMTWAAVLQSFVYKAGPWYNEPLG-HNTPNHIHVCWQIPAYVLISFSEIFASITG 487
            FG+ +MTWA VLQ F+YKA P Y+ P    N PNHIHV  Q+PAY L++ SEIFASITG
Sbjct: 449 TFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITG 508

Query: 488 LEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCL 547
           LEYAYSKAPASMK+FIMSIFL+TNAFG+AIGCALSPV+ DPK+ WL+ GLAVACF+ GCL
Sbjct: 509 LEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCL 568

Query: 548 FWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAK 600
           FW+ F+KYND EEE+N +D+EE D+     +    A DIE+++P  S RS+ K
Sbjct: 569 FWIIFKKYNDMEEELNNLDFEEGDDM----LETKHAGDIEMIQPISSRRSSLK 617

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/534 (65%), Positives = 427/534 (79%), Gaps = 6/534 (1%)

Query: 70  TLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGL 129
           TL+HV G IP RCWLIA+VELSERFSYYGLSAPFQNYM  GPND+PKG+L LN+ GATGL
Sbjct: 83  TLKHVAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATGL 142

Query: 130 SYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXXX 189
           SYFFQFWCY+TP+FGGY+ADT+W KYNTI  GT IYI GIFILFIT+IPS+  +++    
Sbjct: 143 SYFFQFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATGG 202

Query: 190 XXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYF 249
                          KAN+SVL+A+Q+PKRK  +   K GERVI D +IT+QNVFMFFY 
Sbjct: 203 FVTAIILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYL 262

Query: 250 MINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSF 309
           MIN+G+LS++ATTELE HKGFWAAYLLPFCFFWIAVV L+ G+  YI +P+GDKV++K F
Sbjct: 263 MINIGALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCF 322

Query: 310 RVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMI 369
           +V +I+ KNKF+F++AKPS++PE  YPW+DKFVDEI R++ ACKVF+FYPIYW  YG MI
Sbjct: 323 KVTFIVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMI 382

Query: 370 SSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFM 429
           ++FITQA  MELH IPNDFLQ FDSI +IVFIPIFE+FVYP IRR+TPLKPITKIF GFM
Sbjct: 383 NNFITQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFM 442

Query: 430 FGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHIHVCWQIPAYVLISFSEIFAS 484
            GS AM WAAVLQSF+YKAGP Y+ P+       N PN +HV WQIPAYV+I++SEIFAS
Sbjct: 443 CGSCAMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFAS 502

Query: 485 ITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFIS 544
           +TGLE+AYS AP SMK+FIMSIFL TNA G+A+G A+SP +VDPK+TW+FTGLAV+CF++
Sbjct: 503 VTGLEFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVA 562

Query: 545 GCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLN-SISAPKANDIEILEPTESLRS 597
           GCLFW+CF  YND + +M A+D+ EDD  + +  +    ++    +EP  S+RS
Sbjct: 563 GCLFWICFHHYNDIDADMKAIDFVEDDMINASGDVEKTASSGFSTVEPIISMRS 616

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/566 (62%), Positives = 434/566 (76%), Gaps = 16/566 (2%)

Query: 24  EEEKTHAVTLKDSYVSDDVANSTEQ-YNLSHSXXXXXXXXXXXXXXKTLRHVGGKIPMRC 82
           E + T A TL+D  +  D  +  E+ Y +                 KTLR VGG+IP RC
Sbjct: 36  EHKDTEAYTLQDGSIEPDHEDYQEEGYEIPTQDEM-----------KTLRRVGGRIPFRC 84

Query: 83  WLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGLSYFFQFWCYVTPV 142
           +L+A+VEL+ERFSYYGLSAPFQNYM+ GP DSP GVL LNS GATGLSYFFQFWCY+TP+
Sbjct: 85  FLVALVELAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITPI 144

Query: 143 FGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXXXXXXXXXXXXXXXX 202
           FGGY+ADT WG+YNTI  GT IYI GIFILFITS  +V  RD                  
Sbjct: 145 FGGYLADTKWGRYNTIGVGTVIYIIGIFILFITSFKTVAGRDGALAGFILALILIGFATG 204

Query: 203 XXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFMINVGSLSLMATT 262
             K+N+SVLIADQ+P ++P +K LKSGERVI D ++T+QNVFMFFY MIN+GSLS++ATT
Sbjct: 205 LIKSNLSVLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATT 264

Query: 263 ELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFRVCWILTKNKFDF 322
           ELE + GFWAAYLLPFCFFWIAV+ ++ GK+QYI +P GD+V+AKSF+VCWIL KNKFD 
Sbjct: 265 ELELNVGFWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFDI 324

Query: 323 NAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELH 382
            +AKPS HPE  +PW DKFVDEI+RALAACKVF+FYPIYWT YG M+++FIT  SMM+LH
Sbjct: 325 TSAKPSYHPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLH 384

Query: 383 GIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMFGSFAMTWAAVLQ 442
           G+PND  QA +SI+LI+FIPI EKF+YPFIRR+TPL+P+T+IF GF+F + AM W+ VLQ
Sbjct: 385 GLPNDIFQAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQ 444

Query: 443 SFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSF 502
            F+Y  GP YN PL     N IHV WQ+PAYV I+FSEIFASITGLEYAYSKAPA+MKSF
Sbjct: 445 HFIYSTGPNYNRPLELGA-NDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSF 503

Query: 503 IMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEM 562
           IM++FL  NAFGSAIGCALSPV+ DP +TWL+  LAVACF+SG +FWLCFRKYN  E+EM
Sbjct: 504 IMALFLFMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIEDEM 563

Query: 563 NAMDYEEDDEFDLNSISAPKANDIEI 588
           NA+D+ + +E   + I   +A D ++
Sbjct: 564 NALDFTDSEE---DEILIRRAEDEDV 586

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/502 (67%), Positives = 406/502 (80%)

Query: 69  KTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATG 128
           KTL+HV G IP RCWLIA+VELSERF+YYGLS PFQNYM+ GP+D+P G+L L SQGATG
Sbjct: 53  KTLKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATG 112

Query: 129 LSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXX 188
           LSYFFQFWCYVTP+FGG+++DT+ GKYNTIC GT +Y+ GI ILF+TSIPS+  +++   
Sbjct: 113 LSYFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATG 172

Query: 189 XXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFY 248
                           K+NISVLIADQ PK++  +   K G RVI D NITLQNVFM FY
Sbjct: 173 GFIAAIILIGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFY 232

Query: 249 FMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKS 308
            MIN+GSLS++ATTELE H GFWAAYLLPFCFFWIAV+ L  GK  Y++ P+GDKV++K 
Sbjct: 233 LMINIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKC 292

Query: 309 FRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTM 368
           F+V  I  KNKF+F AAKPSV P+  +PW DKFVDEI R+L+ACKVF+FYP+YW  YG M
Sbjct: 293 FKVVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQM 352

Query: 369 ISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGF 428
           +++F++    MELHG+PNDF QA DSIALIVFIPI E F+YP+IR++TP +PITKIF+GF
Sbjct: 353 LNTFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGF 412

Query: 429 MFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFSEIFASITGL 488
           MFG+ AM WAAVLQ F+YK+GPWY  P+  NTPNHIH+ WQ+PAYVLI+FSEIFASITGL
Sbjct: 413 MFGAAAMVWAAVLQHFIYKSGPWYKYPMAENTPNHIHIAWQVPAYVLIAFSEIFASITGL 472

Query: 489 EYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLF 548
           EYAYSKAP +MKSFIM+IFLLTNAFGSAIGCALSPVT DP + WL+ GL VACF +G LF
Sbjct: 473 EYAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLF 532

Query: 549 WLCFRKYNDTEEEMNAMDYEED 570
           W CF+ YNDTEE MNA+DY+ED
Sbjct: 533 WFCFKHYNDTEEAMNALDYDED 554

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/508 (66%), Positives = 410/508 (80%), Gaps = 5/508 (0%)

Query: 70  TLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGL 129
           TLRHV  +IP  CWLIAIVEL+ERFSYYGLSAPFQNYM+ GPND+PKGVL L SQGAT L
Sbjct: 104 TLRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATAL 163

Query: 130 SYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXXX 189
           SYFFQFWCYVTP+ GGY+ADTFWGKYNTIC G + Y+ GI ILF+T+IPS+ +++S    
Sbjct: 164 SYFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGG 223

Query: 190 XXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYF 249
                          KAN+SVLIADQ+PK +P IKVLK+GE+VI D N+T+QNVFMFFY 
Sbjct: 224 FIVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYL 283

Query: 250 MINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSF 309
           MIN+GSLS+MATT LE   GFWAAYLL FCFFW+ +V L+FG+K+Y++RPIGD V+A+ F
Sbjct: 284 MINIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCF 343

Query: 310 RVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMI 369
           ++CWI   N F+ N A PS++PE+ YPWND F+DEI+RA  ACKVF FYPIYW  YG M+
Sbjct: 344 KICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQML 403

Query: 370 SSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFM 429
           ++F+TQA  MELHG+PNDFLQA +SIALIVFIPI E+F+YPFIRR+TP +P+TKIF GF 
Sbjct: 404 NNFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFC 463

Query: 430 FGSFAMTWAAVLQSFVYKAGPWYNEPLG-----HNTPNHIHVCWQIPAYVLISFSEIFAS 484
           FGS AM +AAVLQ F+YKAGP Y+ P+       NTPN +H+ WQ+PAYVLIS SEIFAS
Sbjct: 464 FGSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFAS 523

Query: 485 ITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFIS 544
           ITGLEYAYSKAPA+MK+FIMSIFL+TNA GSA+G ALSP   +PK+ W F+GLAVACFI+
Sbjct: 524 ITGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIA 583

Query: 545 GCLFWLCFRKYNDTEEEMNAMDYEEDDE 572
           GCLFWLCF  YN  EE +NA+DY+ +++
Sbjct: 584 GCLFWLCFHHYNKDEEALNALDYKTEEQ 611

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/598 (59%), Positives = 431/598 (72%), Gaps = 16/598 (2%)

Query: 9   SDEVQDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQYNLSHSX---------XXXX 59
           S     E+     VI +EK +    K +  S+D    TE Y L +               
Sbjct: 2   SSHTNSEEAEKLSVITDEKNNIDLKKTTVSSEDQILDTESYKLQNDNEFDPEHPDYQEEG 61

Query: 60  XXXXXXXXXKTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVL 119
                    +TLRHV G+IP RC+LIA+VELSERFSYYGLSAPFQNYM   P+DSP GVL
Sbjct: 62  YEMPTEEELRTLRHVSGRIPFRCFLIAVVELSERFSYYGLSAPFQNYMANTPSDSPPGVL 121

Query: 120 GLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPS 179
            LNS GATGLSYFFQFWCY+TPV GGY+ADT WG+YNTI  GT IYI GIF+LFITS  S
Sbjct: 122 QLNSDGATGLSYFFQFWCYITPVLGGYLADTNWGRYNTIAVGTGIYIVGIFVLFITSFKS 181

Query: 180 VGNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNIT 239
           +  ++                    KAN+SVLIADQ+P ++P +K LKSGERVI D +IT
Sbjct: 182 IAGKNGALGGFIVALILIGIGTGFIKANLSVLIADQIPAKRPRVKTLKSGERVIEDHDIT 241

Query: 240 LQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRP 299
           +QNVFMFFY MIN+GSLS++ATTELE H GFWAAYLLPFCFFWIAV+ L+ G++ Y  +P
Sbjct: 242 IQNVFMFFYLMINIGSLSVIATTELEQHVGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKP 301

Query: 300 IGDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYP 359
             D+V+ KSF+ CW LTKNKF+++A  P+ +PE  + W+DKFV+EI+ ALAACKVF+FYP
Sbjct: 302 TSDRVIEKSFKFCWALTKNKFNWSAVTPAENPEVTFSWDDKFVEEIRVALAACKVFLFYP 361

Query: 360 IYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLK 419
           IYWT YG M ++F+T  SM++LHG+PND  QA DSIALIVFIPI EKF YPFIRR+TP +
Sbjct: 362 IYWTCYGQMTNNFVTMGSMLQLHGLPNDIFQAIDSIALIVFIPICEKFFYPFIRRFTPFR 421

Query: 420 PITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPNHIHVCWQIPAYVLISFS 479
           PITKI +GF   S +M WA VLQ F+YK GP Y  PL  + PN++HV WQ+PAYVLI+FS
Sbjct: 422 PITKITYGFWLASASMVWACVLQYFIYKTGPNYKHPLA-DGPNNVHVAWQVPAYVLIAFS 480

Query: 480 EIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAV 539
           EIFASITGLEYAYSKAPASMKSFIM++FL  NAFGSAIGCALSPV+ DP +TWL+ GLAV
Sbjct: 481 EIFASITGLEYAYSKAPASMKSFIMALFLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAV 540

Query: 540 ACFISGCLFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRS 597
             FI+GC FW CFR YND E+EMNA++YE++D    N+       DIE++ P  +  S
Sbjct: 541 TAFITGCAFWFCFRHYNDIEDEMNALNYEDEDIITENN------QDIEMVHPLSAYTS 592

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/588 (60%), Positives = 432/588 (73%), Gaps = 16/588 (2%)

Query: 13  QDEKQGDFPVIEEEKTHAVTLKDSYVSDDVANSTEQ-YNLSHSXXXXXXXXX-XXXXXKT 70
           +D+K  +F   +E  + A T+ +        NS E+ YN S                 +T
Sbjct: 26  KDDKNYNFITEDEPNSIASTIIE-------GNSNEENYNRSTDDDDDEDFIEPTEEEMRT 78

Query: 71  LRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGLS 130
           L+ VGG IP RCWL+A++ELSERFSYYGLSAPFQNYM+ GP D+P G L LN+QGATGLS
Sbjct: 79  LKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSLNTQGATGLS 138

Query: 131 YFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXXXX 190
           YFFQFWCY+TP+FGGY+ADT+WGKYNTI  G   YI GIFILF+TS+P + +  +     
Sbjct: 139 YFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLTSYSAAMGGF 198

Query: 191 XXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFM 250
                         KAN+SV+IA+Q+PKRK  I   K G RVI D +ITLQNVFM FYFM
Sbjct: 199 IVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQNVFMAFYFM 258

Query: 251 INVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFR 310
           INVGSLS+MATTELE  KGFWAAYLLPFCFFW+AVV L+ G K++I+ PIGDK ++KSF+
Sbjct: 259 INVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGDKTISKSFK 318

Query: 311 VCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMIS 370
           V  IL KNKF++ +AKPS+HPE NYPW DKFV+EI+RA+ AC VF FYPIYW  YG M++
Sbjct: 319 VVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYWVCYGQMLN 378

Query: 371 SFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMF 430
           +F+TQ   MELH +PNDFLQ  DSIALIVFIPI E+ +YPF+RR+TPL+PITKI  GF F
Sbjct: 379 NFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPITKITIGFFF 438

Query: 431 GSFAMTWAAVLQSFVYKAGPWYNEPLG-HNTPNHIHVCWQIPAYVLISFSEIFASITGLE 489
           GSF+M WAAVLQ FVY+  P Y  P    N PNHIHVCWQ+PAY LI+ SEIFASITGLE
Sbjct: 439 GSFSMVWAAVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSEIFASITGLE 498

Query: 490 YAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFW 549
           YAYSKAPASMKSFIMSIFL T A GSA+G ALSPV++DPKFTW + GLAV+CFI+G  FW
Sbjct: 499 YAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSCFIAGIAFW 558

Query: 550 LCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRS 597
           LCF +YND E+E+N +    DD+ D+  IS+   ND   LE   S+RS
Sbjct: 559 LCFSRYNDEEDELNNI----DDQPDVIQISSENEND--DLEAKNSIRS 600

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/534 (63%), Positives = 419/534 (78%), Gaps = 8/534 (1%)

Query: 69  KTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATG 128
           KTL    G IP  CWL+AI+EL+ERFSYYGLSAPFQNYM+  P+D+P G L LNS GATG
Sbjct: 73  KTLPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLNSTGATG 132

Query: 129 LSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSXXX 188
           LSYFFQFWCYVTP+F G++ADT+WGK+NT+C GT IYI GIFILFITS+P++ + ++   
Sbjct: 133 LSYFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAITSYNTALG 192

Query: 189 XXXXXXXXXXXXXXXXKANISVLIADQLPKRK-PFIKVLKSGERVIVDSNITLQNVFMFF 247
                           KAN+SV+IADQLPK+K   +   KSG+RVI D  +T+QNVFM F
Sbjct: 193 GFIVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQNVFMAF 252

Query: 248 YFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAK 307
           YFMINVGSLS++ATTELE H GFWAAYLLPFCFFWIAV+ L FG ++++++PIGD+V++K
Sbjct: 253 YFMINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIGDRVISK 312

Query: 308 SFRVCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGT 367
            F +  IL KN F+F  AKP+ +PE+NYPW+DKFVDEI+R+L ACKVF+FYPIYW  YG 
Sbjct: 313 CFTIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIYWVCYGQ 372

Query: 368 MISSFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFG 427
           M+++F+TQ S M+LHG+PNDF QA +SIALIVFIPI EKFVYPFIR++TPLKPITK+  G
Sbjct: 373 MLNNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPITKVTIG 432

Query: 428 FMFGSFAMTWAAVLQSFVYKAGPWYNEPLG-HNTPNHIHVCWQIPAYVLISFSEIFASIT 486
           F+FGS AM WAAVLQ F+Y+AGP Y+ P+   N PNH+HV WQ+PAY LIS SEIFASIT
Sbjct: 433 FVFGSLAMVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSEIFASIT 492

Query: 487 GLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGC 546
           GLE AYSKAP SMKSFIMS+FL+TNAFG+AIGCALS V+ DPK+ WL+TGLAV CF +G 
Sbjct: 493 GLEIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVTCFCAGI 552

Query: 547 LFWLCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAK 600
            FW  F+ YND E+ MN +D+E D+E + N  S      IE LE +++ ++T K
Sbjct: 553 AFWFTFKHYNDEEDAMNNIDFESDNENEKNEYS-----QIENLELSQT-KTTDK 600

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  223 bits (568), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 155/547 (28%), Positives = 254/547 (46%), Gaps = 38/547 (6%)

Query: 71  LRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYME-------------YGPNDSPKG 117
           LR V G      + I ++E SER SYYG      N+++                +++  G
Sbjct: 40  LRRVLGHPKWYVYFICLIEFSERASYYGTGDRLNNFIQKPLPAGGNGAGAPAPGSEATAG 99

Query: 118 VLGLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSI 177
            LG+  Q AT L+    F  Y  P+  GYVAD +WG+   +  G  + I    +  I S+
Sbjct: 100 ALGMGLQVATALNLLLTFLAYCFPLITGYVADRYWGRMRMLWIGVFVGIVSHVVFIIGSL 159

Query: 178 PSV-GNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDS 236
           P V G+  +                   K  +   +  Q P     +K L SGERVI+D 
Sbjct: 160 PVVLGHGSAALAPCIIGIITLAIATAFVKPILLPTLLSQYPHATDVVKTLPSGERVIIDR 219

Query: 237 NITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYI 296
           + +LQ + M FY+ INVGS   +AT+      G+W A+L+P   F I    L+   ++YI
Sbjct: 220 DASLQRMTMTFYWSINVGSFLSVATSYSARDVGYWLAFLIPLALFMIMPAVLLV-LRRYI 278

Query: 297 QR--PIGDKVVA---KSFRVC-----WILTKNKFDFNAAKPS-VHPEENYPWN------- 338
           +   P G  ++A   K  +VC     W   +    ++ AKPS +       W        
Sbjct: 279 KDEPPSGRSLIADCLKVLKVCFERNWWSRYRAGTFWDYAKPSNLRSLGRQGWRKSKPGFY 338

Query: 339 -DKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIAL 397
            +  V + +  ++AC +F++Y IY    G + S   +Q + +   G+PND +  F+ + +
Sbjct: 339 PESLVQDARVTISACTIFLYYVIYNINDGGIGSIMNSQTASLTSKGVPNDLMSNFNPLCI 398

Query: 398 IVFIPIFEKFVYPFIRRYT-PLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPL 456
           IVF+PI ++ VYP +R+     +P+ +IF GFM  + A    A++Q  +Y+  P  N   
Sbjct: 399 IVFMPILDRVVYPLLRKLRWNFRPVFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYAT 458

Query: 457 GHNTPNHIHVCWQIP-AYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTNAFGS 515
                      W +   Y L  FSE  A  TG E A+ ++P  MK+F+M++FL  +A  +
Sbjct: 459 ECEKGVSPISMWVVAIEYALTGFSECLAMTTGYEIAFERSPPHMKTFVMALFLFMSALSA 518

Query: 516 AIGCALSPVTVDPKFTWLFTGLA-VACFISGCLFWLCFRKYNDTEEE-MNAMDYEEDDEF 573
           A+G  ++P  VDP     F  LA +   ++    W  +  ++  E+E +      + +E 
Sbjct: 519 ALGEIVTPSLVDPHLVIPFGVLAGLGAAVAFAFLWRYWNLHHVMEQERIEREALAKQEEP 578

Query: 574 DLNSISA 580
            LN+I +
Sbjct: 579 ALNTIRS 585

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  222 bits (566), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 162/572 (28%), Positives = 258/572 (45%), Gaps = 44/572 (7%)

Query: 70  TLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYME----------------YGPND 113
           TLR V        + I ++E SER SYYG      N+++                   + 
Sbjct: 44  TLRRVLEHPKWYVYFICLIEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPAHGAAGDS 103

Query: 114 SPKGVLGLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILF 173
           +  G LG+  Q AT L+    F  Y  P+  GY+AD +W +   +  G  + I    I  
Sbjct: 104 ATAGALGMGLQTATALNLLLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGIISHVIFI 163

Query: 174 ITSIPSV-GNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERV 232
           I ++P V GN  +                   K  +   +  Q P     ++ L SGERV
Sbjct: 164 IGALPPVLGNGQAALAPCVIGIITLAIATSFVKPVLLPTLLSQYPHETDVVRTLASGERV 223

Query: 233 IVDSNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIA-VVTLIFG 291
           +VD + +LQ + M FY+ IN+GS   +AT+      G+W A+L+P   + I   V L+ G
Sbjct: 224 LVDRDASLQRMTMTFYWSINIGSFLSVATSYAARDIGYWLAFLIPLILYLIMPAVLLVLG 283

Query: 292 KKQYIQRPIGDKVVA---KSFRVC----WILTKNKFDF-NAAKPS-VHPEENYPWNDK-- 340
           +    + P G  ++A   K  RVC    W       DF N A+PS +       W  K  
Sbjct: 284 RYLRDEPPSGRSMLADCCKVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRAGWRRKGA 343

Query: 341 -------FVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFD 393
                   V + +  L+A  +F++Y IY    G + S   +Q + +  +G+PND +  F+
Sbjct: 344 GGFYAESLVQDTRVTLSASAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPNDLISNFN 403

Query: 394 SIALIVFIPIFEKFVYPFIRRYT-PLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWY 452
            + +IVF+P+ +  +YP +R+     KP+ +IF GFM  + A    A++Q+ +Y   P  
Sbjct: 404 PLCIIVFMPVLDHVLYPVLRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVIYNTSPCG 463

Query: 453 NEPLGHNTPNHIHVCWQIPA-YVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLTN 511
                 +        W +   Y L   SE  A  TG E A+ ++PA MKSF+M++FL T+
Sbjct: 464 RYATECDKGVSPVSMWVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKSFVMALFLFTS 523

Query: 512 AFGSAIGCALSPVTVDPKFTWLFTGLA-VACFISGCLFWL--CFRKYNDTEE-EMNAMDY 567
           A  +A+G  ++P  VDP     F  LA +  F++    W      K  + E  E  A++ 
Sbjct: 524 ALSAALGEIVTPSLVDPHLVIPFGVLAGLGAFMAFVFLWRYWSLDKTMELERAERRALEA 583

Query: 568 EEDDEFDLNSISA--PKANDIEILEPTESLRS 597
           EE     + S+ +    A D++  E  E + S
Sbjct: 584 EEGAMPAITSVRSYVSGAEDVDHPEGLEHVLS 615

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  214 bits (546), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 161/560 (28%), Positives = 251/560 (44%), Gaps = 53/560 (9%)

Query: 69  KTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEY-----------GPNDSPKG 117
           K LRHV        ++I ++EL+ER SYYG      N+ +Y           GP+D   G
Sbjct: 44  KRLRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPG 103

Query: 118 VLGLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSI 177
            LG   Q AT L+   +F  Y  P+  GYVAD + G+   +  G    +    I  I ++
Sbjct: 104 ALGRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAAL 163

Query: 178 PSVGNRDSXXXXXXXXXXXXXXXXXX-XKANISVLIADQLPKRKPFIKVLKSGERVIVDS 236
           P+V   ++                    K  +  ++  Q P     +K L +GERVI++ 
Sbjct: 164 PAVIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNR 223

Query: 237 NITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYI 296
           + +LQ + M FY+ INVGS   +AT       G+W ++L+P   F I    L+  K   +
Sbjct: 224 DASLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKV 283

Query: 297 QRPIGDKVVA---KSFRVC----WILTKNKFDF-NAAKPS----------VHPEENYPWN 338
             P+G+ + A   K  +VC    W        F   AKPS             +E + + 
Sbjct: 284 TPPLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGF-YK 342

Query: 339 DKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALI 398
           +  V++ +  LAAC +F++Y IY      + S    QA  M   G+PND +  F+ +A+I
Sbjct: 343 ESLVEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAII 402

Query: 399 VFIPIFEKFVYPFIRRYT-PLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLG 457
           + +PI +  + P +RR     KP+ +IFFGFM    A    A++Q+ +Y        P G
Sbjct: 403 ITMPIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYN-----TSPCG 457

Query: 458 HNTPNHIHVCWQIP---------AYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFL 508
            +         Q+           YVL   SE FA  TG E A+ ++P  MK+F+MS+FL
Sbjct: 458 KHASTCSETIRQVSPLSRWLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFL 517

Query: 509 LTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFR-KYNDTEEEMNAMDY 567
           +T A  S +    + +  DP     F   AV     G LF + F  +Y + ++ M A   
Sbjct: 518 VTTALSSILTQIFNGIMTDPYLVIPFILFAVL----GTLFAILFLYRYWNLDKVMEAERR 573

Query: 568 EED--DEFDLNSISAPKAND 585
           E    D  ++ + + P   D
Sbjct: 574 ERAILDPLEILAHNGPPDYD 593

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  199 bits (507), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 158/564 (28%), Positives = 246/564 (43%), Gaps = 47/564 (8%)

Query: 69  KTLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEY----GPN---------DSP 115
           +TLR +        +LI  +EL+ER SYYG      NY  Y    G N         ++ 
Sbjct: 50  RTLRRIVVHPSWYVYLICFIELAERASYYGTGDRLNNYYTYPLPEGGNGAGATAHGSEAN 109

Query: 116 KGVLGLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFIT 175
            G LG     AT L    +F  Y  P+  GY+ D + G   T+  G    +A   I  ++
Sbjct: 110 SGALGKGLATATSLGLLLKFTSYFFPLVTGYLCDMYMGHVRTLWYGIWTGVASHIIFILS 169

Query: 176 SIPSV-GNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIV 234
           ++P V  + D+                   K  +  L+  Q P     +K L++GERVI+
Sbjct: 170 ALPVVLKHPDAAMALSLIGLITLSVCTAFVKPVLLPLLLQQYPHETNVVKTLETGERVII 229

Query: 235 DSNITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQ 294
           D + +LQ + M FY+ IN+G+   +AT+      GFW A+L+P   +    V     +  
Sbjct: 230 DRDASLQRMTMTFYWAINIGAFMSLATSYAAKEVGFWLAFLIPLIIYMAMPVVFSLVQPH 289

Query: 295 YIQR-PIGDKVVAKSFRVCWIL--------TKNKFDFNAAKPSVHPE-ENYPWNDK---- 340
              R P G  ++A   +V ++          K    ++ A PS   +     W  K    
Sbjct: 290 IKDRAPSGYSLLADCMKVLYVAFGKGWNARRKEGVFWDYALPSNQRQMGKVGWRKKSPFY 349

Query: 341 ---FVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIAL 397
               V + K  L+AC +F +Y IY      + +   +Q   M  +G+PND +  F+ +++
Sbjct: 350 KESLVQDTKITLSACFIFCYYIIYNMNDNQLTTIINSQTGSMTKNGVPNDVISNFNPLSI 409

Query: 398 IVFIPIFEKFVYPFIRRYT-PLKPITKIFFGFMFGSFAMTWAAVLQ-------SFVYKAG 449
           IV IPI +  +YP +RR     KP+ +IF GFM    +    A++Q       S  Y A 
Sbjct: 410 IVLIPILDYGLYPLLRRLRINFKPVYRIFTGFMLAVASSVAGALIQWRIYETSSCGYHAT 469

Query: 450 PWYNEPLGHNTPNHIHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLL 509
               + LG +  +   V  +   Y L   SE  A  T  E AY ++P  MKSF++++FL 
Sbjct: 470 TCSEKGLGVSPLSSWIVAVE---YTLSGASECLAMTTAYEIAYDRSPEHMKSFVLALFLF 526

Query: 510 TNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYN-----DTEEEMNA 564
           T+A  +AI   ++P+  DP     F   A   FISGC F   FR  +     +  E    
Sbjct: 527 TSAVSAAITQIVNPILKDPLLIVPFALFAGIGFISGCHFLWKFRNLDKEMLQEKRERELL 586

Query: 565 MDYEEDDEFDLNSISAPKANDIEI 588
            +  E DE ++  I   K +   I
Sbjct: 587 QESSESDELEVVEIKDVKGSRSNI 610

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  184 bits (468), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 144/533 (27%), Positives = 241/533 (45%), Gaps = 45/533 (8%)

Query: 70  TLRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEY------------GPNDSPKG 117
           TLR +     +  + I ++E +ER S+YG      N+ +Y            GP +   G
Sbjct: 38  TLRRIVTSPKIHLYFICLIEFAERGSFYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPG 97

Query: 118 VLGLNSQGATGLSYFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSI 177
            LG     AT +    +F  Y   +  GY++D + G+   +  G  + +    +  I ++
Sbjct: 98  ALGKGLAVATAMGLLLKFTSYTFSIITGYISDVYIGQIKMLWIGVWLGVGSHILFIIAAL 157

Query: 178 PSV-GNRDSXXXXXXXXXXXXXXXXXXXKANISVLIADQLPKRKPFIKVLKSGERVIVDS 236
           PSV  + +                    K  +  L+  Q P +   +K L SGERVIVD 
Sbjct: 158 PSVLAHTNVAYALSVVALLSLSLCTSFVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDR 217

Query: 237 NITLQNVFMFFYFMINVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTL-IFGKKQY 295
           + +LQ + M FY+ INVG+   +AT       G+W A+ +P   + +  + L    +   
Sbjct: 218 DASLQRMTMVFYWAINVGAFLSLATAYSAQRVGYWLAFTVPLIIYLLMPIVLWKLQEDIK 277

Query: 296 IQRPIGDKVVAKSFRVC-----WILTKNKFD---FNAAKPSVHPEENYP---------WN 338
              P  + V+A+S +V      W   K  +    ++ AKP+   ++            ++
Sbjct: 278 TNEPSRESVLAESLKVLKVCYEWGWIKRYWSGQFWDYAKPTNLIQQGRIGWRKKKAGFYD 337

Query: 339 DKFVDEIKRALAACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSIALI 398
           +K+V + K  ++AC +F++Y IY   +  +     +QA  ME  G+PND    F+ I++I
Sbjct: 338 EKYVYDTKLTISACTIFLYYVIY-QMHSNLDEPMRSQAGSMEGEGVPNDLFSNFNPISII 396

Query: 399 VFIPIFEKFVYPFIRRY-TPLKPITKIFFGFMFGSFAMTWAAVLQSFVYKAGPWYNEPLG 457
           V +PI +  +YP +RRY    KP+ +IF GFM G    T  A++Q  VY   P     +G
Sbjct: 397 VVMPILDYVLYPLLRRYRINFKPVYRIFCGFMIGCLGSTVGAIIQWRVYNTSP--CGYMG 454

Query: 458 HNTPNHIH------VCWQIP-AYVLISFSEIFASITGLEYAYSKAPASMKSFIMSIFLLT 510
             T   +H        W +   Y L   SE  A  TG E A+ ++P  MK F++++F+ T
Sbjct: 455 ATTCPELHHKKSPLSRWLVAIEYALGGTSECLAMTTGYEIAFERSPKKMKGFVLALFMFT 514

Query: 511 NAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWLCFRKYNDTEEEMN 563
            A  SAI   ++P   DP   +L    AV   +      +   +Y D +++M 
Sbjct: 515 VAISSAIILPITPFFKDP---YLIQPFAVCAGVGALTAIIFLWRYWDLDKQMK 564

>KNAG0K01620 Chr11 (336059..337282) [1224 bp, 407 aa] {ON} 
          Length = 407

 Score = 34.3 bits (77), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 90/228 (39%), Gaps = 39/228 (17%)

Query: 285 VVTLIFG-----KKQYIQRPIGDKVVAKSFRVCWILTKNKFDFNAAKPSVHPEENYPWND 339
           +VTL++G     +K ++ R     + A +       TK   D  A K S++P      + 
Sbjct: 191 IVTLLYGVCGIARKNHVFRNFLVMMAALASIQVISYTKATCDMLAGKLSINPSTGEVTDL 250

Query: 340 KFVDEIKRAL----AACKVFVFYPIYWTQYGTMISSFITQASMMELHGIPNDFLQAFDSI 395
              D +K +L     +  V VF  ++   +G   +S I Q+S + L GI          I
Sbjct: 251 FLFDRLKASLICGLGSLSVGVFAVMWHRWFGKPSASLIQQSSHLSLIGI-------MSII 303

Query: 396 ALIVFIPIFEKFVYPFIRRYTP-----LKPITKIFFGFMFGSFAM-----------TWAA 439
            L+ F+P   K  Y  I  Y       L  +  +FFG +   F++               
Sbjct: 304 LLLPFVPDL-KLSYQVISFYYADKTFWLTLMGSLFFGTVPCLFSLLHLNKKNPPEFVTTV 362

Query: 440 VLQSFVYKA-GPWYNEPLGHNTPNHIHVCWQIPAYVLISFSEIFASIT 486
            L S ++     W  EP+         V W++  Y+++  S IF S+T
Sbjct: 363 NLGSIIFMGLAEWLTEPIQTTI-----VRWEVIGYIVLVLSCIFLSMT 405

>KLLA0F07513g Chr6 (707516..710662) [3147 bp, 1048 aa] {ON} similar
           to uniprot|P31380 Saccharomyces cerevisiae YAL019W FUN30
           Protein whose overexpression affects chromosome
           stability potential Cdc28p substrate homolog of Snf2p
          Length = 1048

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 19/25 (76%), Gaps = 2/25 (8%)

Query: 553 RKYNDTEEEMNAMDYEE--DDEFDL 575
           RK ND EEE + +DYEE  DD+FD+
Sbjct: 441 RKRNDDEEEFSDVDYEESDDDDFDV 465

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,307,491
Number of extensions: 2703957
Number of successful extensions: 9910
Number of sequences better than 10.0: 35
Number of HSP's gapped: 10084
Number of HSP's successfully gapped: 35
Length of query: 602
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 487
Effective length of database: 40,294,809
Effective search space: 19623571983
Effective search space used: 19623571983
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)