Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_11.223singletonON94944424e-58
YKL031WsingletonOFF137991173e-08
Skud_11.197singletonON8577986e-06
Skud_2.2663.131ON52229587.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_11.223
         (94 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_11.223 Chr11 (369174..369200,369204..369377,369381..369386,...   174   4e-58
YKL031W Chr11 (382072..382485) [414 bp, 137 aa] {OFF} Dubious op...    50   3e-08
Skud_11.197 Chr11 (361091..361345) [255 bp, 85 aa] {ON} YKL031W ...    42   6e-06
Skud_2.266 Chr2 complement(481563..483131) [1569 bp, 522 aa] {ON...    27   7.8  

>Smik_11.223 Chr11
          (369174..369200,369204..369377,369381..369386,
          369390..369464) [282 bp, 94 aa] {ON} YKL031W (REAL)
          Length = 94

 Score =  174 bits (442), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 85/94 (90%)

Query: 1  TEDNEVNYNSENERQKESEKRMCRGRVYTQYQFPQLVCAFFVPICSLTRXXXXXXXXXVR 60
          TEDNEVNYNSENERQKESEKRMCRGRVYTQYQFPQLVCAFFVPICSLTR         VR
Sbjct: 1  TEDNEVNYNSENERQKESEKRMCRGRVYTQYQFPQLVCAFFVPICSLTRGGGKKKEKKVR 60

Query: 61 RAGCASPLPHQHTTLTPKPRAAVVSVYCTHASRI 94
          RAGCASPLPHQHTTLTPKPRAAVVSVYCTHASRI
Sbjct: 61 RAGCASPLPHQHTTLTPKPRAAVVSVYCTHASRI 94

>YKL031W Chr11 (382072..382485) [414 bp, 137 aa] {OFF} Dubious open
           reading frame, unlikely to encode a protein; not
           conserved in closely related Saccharomyces species
          Length = 137

 Score = 49.7 bits (117), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 1   TEDNEVNY-NSENERQKESEKRMCRGRVYTQYQFPQLVCAFFVP--ICSLTRXXXXXXXX 57
           TEDNEVN+  SENERQKE E       +Y     P  VC FF+   + S           
Sbjct: 7   TEDNEVNHIYSENERQKERENECAGPCLYLAP--PADVCIFFLFPFVLSPRGGGKEKKKK 64

Query: 58  XVRRAGCASPLPHQHTTLTP--KPRAAVVSVYCTHASRI 94
            VR+  CASPL   H  +TP  KPRAAVVS   TH+S +
Sbjct: 65  KVRKVRCASPLLLLHPDITPNTKPRAAVVSNRSTHSSTV 103

>Skud_11.197 Chr11 (361091..361345) [255 bp, 85 aa] {ON} YKL031W
          (REAL)
          Length = 85

 Score = 42.4 bits (98), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 11 ENERQKESEKRMCRGRVYTQYQFPQLVCAFFVPICSLTRXXXXXXXXXVRRAGCASPLPH 70
          E ERQKESE   C G         +    FFVP+CSL R          R   CA PL  
Sbjct: 1  ERERQKESENE-CAGAASIPVSTARYGHIFFVPVCSLHRTKKKKKKKKAR---CA-PLVQ 55

Query: 71 QHTTLTP--KPRAAVVS 85
          QH   TP  KPRAAVVS
Sbjct: 56 QHPHTTPATKPRAAVVS 72

>Skud_2.266 Chr2 complement(481563..483131) [1569 bp, 522 aa] {ON}
           YBR138C (REAL)
          Length = 522

 Score = 26.9 bits (58), Expect = 7.8,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 18/29 (62%)

Query: 2   EDNEVNYNSENERQKESEKRMCRGRVYTQ 30
           EDN++NY  EN ++K+S  R    R+  Q
Sbjct: 436 EDNKMNYRKENSKKKDSFSRELIERLQVQ 464

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.131    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,042,644
Number of extensions: 263743
Number of successful extensions: 714
Number of sequences better than 10.0: 5
Number of HSP's gapped: 710
Number of HSP's successfully gapped: 5
Length of query: 94
Length of database: 53,481,399
Length adjustment: 65
Effective length of query: 29
Effective length of database: 46,028,109
Effective search space: 1334815161
Effective search space used: 1334815161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 59 (27.3 bits)