Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_10.1791.319ON71371337790.0
YJL061W (NUP82)1.319ON71371331050.0
Suva_6.1371.319ON71871828350.0
Skud_10.1581.319ON71671427740.0
ZYRO0G20680g1.319ON69271114080.0
TDEL0D018801.319ON69170813810.0
NCAS0A092101.319ON71072613711e-180
NDAI0G057501.319ON73473013371e-175
KAFR0A017201.319ON71668313021e-170
KNAG0C058401.319ON74774411901e-152
SAKL0D06930g1.319ON69071710731e-136
Kpol_1035.241.319ON71772210691e-135
TBLA0F013101.319ON74272510381e-130
Kwal_14.25801.319ON6877159141e-112
TPHA0O014601.319ON7217219151e-112
CAGL0J05214g1.319ON7167099091e-111
KLTH0H10692g1.319ON6917188931e-109
Ecym_62901.319ON6717098162e-98
AEL168C1.319ON6737156966e-81
KLLA0F01661g1.319ON6877415434e-59
ZYRO0F00616g2.613ON802123790.68
NCAS0A044502.458ON35979752.1
CAGL0H06259g7.86ON133677733.7
KAFR0K007007.86ON138177734.5
TPHA0H020906.292ON33362706.9
NCAS0I004707.86ON108265717.0
Ecym_31571.509ON1107101717.3
Ecym_81081.170ON68260707.9
CAGL0G03641g7.422ON41551708.7
KNAG0I010208.298ON52970709.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_10.179
         (713 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...  1460   0.0  
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...  1200   0.0  
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...  1096   0.0  
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...  1073   0.0  
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   546   0.0  
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   536   0.0  
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   532   e-180
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   519   e-175
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   506   e-170
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   462   e-152
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   417   e-136
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   416   e-135
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   404   e-130
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   356   e-112
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   357   e-112
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   354   e-111
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   348   e-109
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   318   2e-98
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   272   6e-81
KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...   213   4e-59
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    35   0.68 
NCAS0A04450 Chr1 complement(897030..898109) [1080 bp, 359 aa] {O...    33   2.1  
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    33   3.7  
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    33   4.5  
TPHA0H02090 Chr8 (493355..494356) [1002 bp, 333 aa] {ON} Anc_6.292     32   6.9  
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       32   7.0  
Ecym_3157 Chr3 (294832..298155) [3324 bp, 1107 aa] {ON} similar ...    32   7.3  
Ecym_8108 Chr8 (230588..232636) [2049 bp, 682 aa] {ON} similar t...    32   7.9  
CAGL0G03641g Chr7 (351476..352723) [1248 bp, 415 aa] {ON} highly...    32   8.7  
KNAG0I01020 Chr9 (196336..197925) [1590 bp, 529 aa] {ON} Anc_8.2...    32   9.3  

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score = 1460 bits (3779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/713 (100%), Positives = 713/713 (100%)

Query: 1   MSQSKSLASLPIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLS 60
           MSQSKSLASLPIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLS
Sbjct: 1   MSQSKSLASLPIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLS 60

Query: 61  RHLVLDDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETE 120
           RHLVLDDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETE
Sbjct: 61  RHLVLDDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETE 120

Query: 121 LGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPNNSFGLDARLN 180
           LGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPNNSFGLDARLN
Sbjct: 121 LGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPNNSFGLDARLN 180

Query: 181 DITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPT 240
           DITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPT
Sbjct: 181 DITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPT 240

Query: 241 TDVTVKRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAK 300
           TDVTVKRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAK
Sbjct: 241 TDVTVKRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAK 300

Query: 301 NIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQKEI 360
           NIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQKEI
Sbjct: 301 NIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQKEI 360

Query: 361 ESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATV 420
           ESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATV
Sbjct: 361 ESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATV 420

Query: 421 EGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELR 480
           EGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELR
Sbjct: 421 EGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELR 480

Query: 481 FTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIA 540
           FTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIA
Sbjct: 481 FTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIA 540

Query: 541 KAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLME 600
           KAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLME
Sbjct: 541 KAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLME 600

Query: 601 RFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKR 660
           RFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKR
Sbjct: 601 RFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKR 660

Query: 661 ELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTKTQ 713
           ELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTKTQ
Sbjct: 661 ELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTKTQ 713

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score = 1200 bits (3105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/713 (81%), Positives = 638/713 (89%)

Query: 1   MSQSKSLASLPIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLS 60
           MSQS  L++LPIFQASLSASQSPRYIF+SQNGTRIVFIQDNIIRWYNVLTD  YHSL+ S
Sbjct: 1   MSQSSRLSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFS 60

Query: 61  RHLVLDDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETE 120
           RHLVLDDTFHVISSTSGDLLC FND EIFVMEVPWGYSNVE++SIQDAFQ+FHYS+DE E
Sbjct: 61  RHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEE 120

Query: 121 LGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPNNSFGLDARLN 180
           +GPKS IKKVLFHPKSY DSCIVVLKE+DTI MFDILN QEKPI+LNKPNNSFGLDAR+N
Sbjct: 121 VGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVN 180

Query: 181 DITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPT 240
           DITDL FSKDGLTLYCLNTTEGGDIFAFYPFLPS LLLNE DL+ ILNKSLVMYESLD T
Sbjct: 181 DITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDST 240

Query: 241 TDVTVKRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAK 300
           TDV VKRN+IKQLQFVSKLHENW+S+  KVDI  EYRL KVQGPFTINPFP ELYDYTA 
Sbjct: 241 TDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTAT 300

Query: 301 NIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQKEI 360
           NIATI IDN QNEI C+SFDDGSLILL KDLEMSMSWDV NYVYN+SLVLIERVK+Q+EI
Sbjct: 301 NIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREI 360

Query: 361 ESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATV 420
           +SLITLPEQ+GKLYV S N + QVN  SW ST+SKCINESDLNPL  LKFESK+E+IAT+
Sbjct: 361 KSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATI 420

Query: 421 EGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELR 480
           E +PNLA+I WN+ SNLAL SNK LTFQ +S D K QST  ET I TE+S      +++ 
Sbjct: 421 ERIPNLAYINWNDQSNLALMSNKTLTFQNISSDMKPQSTAAETSISTEKSDTVGDGFKMS 480

Query: 481 FTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIA 540
           FTQP++EIL LN+NFQ+ACISPCE+IIPS DRQIPLKNEASENQLEIFTD+SKEFLQ+I 
Sbjct: 481 FTQPINEILILNDNFQKACISPCERIIPSADRQIPLKNEASENQLEIFTDISKEFLQRIV 540

Query: 541 KAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLME 600
           KAQ+LGVSI+NRIHEQQ ELTRQLQSTCKIISKD DLR+KFEAQNKKWDAQ+ RQS+LME
Sbjct: 541 KAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDDLRRKFEAQNKKWDAQLSRQSELME 600

Query: 601 RFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKR 660
           RFSKL++ LS+I++SNKFKEK IS+ EM+WFKEIRNQILQFN +VHSQKSLQQDLSYLK 
Sbjct: 601 RFSKLSKKLSQIAESNKFKEKKISHGEMKWFKEIRNQILQFNSFVHSQKSLQQDLSYLKS 660

Query: 661 ELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTKTQ 713
           ELTRIE ETI+VDKKSQ+EW+ELRKMLEIDSKIIKECNEEL   SQ+ TTKTQ
Sbjct: 661 ELTRIEAETIKVDKKSQNEWDELRKMLEIDSKIIKECNEELLQVSQEFTTKTQ 713

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/718 (73%), Positives = 620/718 (86%), Gaps = 5/718 (0%)

Query: 1   MSQSKSLASLPIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLS 60
           M QS SLA+LPIFQASLSA+QSPRYIF+S NGTR+V IQD+IIRW ++LTDP YHSL+ S
Sbjct: 1   MPQSDSLAALPIFQASLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNFS 60

Query: 61  RHLVLDDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETE 120
           RHLVLDDTFH ISS SGDLLCF++DQEIFVME+PWGY N+ ++SIQDAFQVFHYSVDE E
Sbjct: 61  RHLVLDDTFHAISSASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELE 120

Query: 121 LGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPNNSFGLDARLN 180
           LG  S IKKVLFHPKSY+DSCIVVLK +DTI MFDILNQQE PIILNK N+SFGLDAR+N
Sbjct: 121 LGSNSPIKKVLFHPKSYNDSCIVVLKNDDTITMFDILNQQEAPIILNKRNSSFGLDARVN 180

Query: 181 DITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPT 240
           DITD  FSKDGLTLYCLNTTEGGDIFAFYPFLPS L L+E DL WILNKSLVMYESL+ T
Sbjct: 181 DITDFAFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLGWILNKSLVMYESLNAT 240

Query: 241 TDVTVKRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAK 300
           TD  VKRNI KQLQFVSKLH+NWDSKL KV ID EYRLVK+QGPFTINPFPNELYD+TA 
Sbjct: 241 TDYKVKRNITKQLQFVSKLHKNWDSKLAKVKIDDEYRLVKMQGPFTINPFPNELYDFTAS 300

Query: 301 NIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKM-QKE 359
            I TI IDNQQNEI C+SFDDGSLI+L +DLEMSMSWDV NYVYN+SL+LIER+K+ QKE
Sbjct: 301 KITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDVDNYVYNNSLILIERIKLQQKE 360

Query: 360 IESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIAT 419
           ++SL  LP+Q+GKLYV  ++ V+Q++ TSWTS +SKCI+ESDLN L D+KF SK E+IAT
Sbjct: 361 MKSLTALPDQLGKLYVTLESSVHQLDCTSWTSVLSKCIDESDLNALADVKFVSKFEDIAT 420

Query: 420 VEGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQS----TETETDIGTEESGLAKC 475
           +  + N A+I WN+ S+LAL S ++LT Q +S  +K QS     E +T++ +++S   K 
Sbjct: 421 IHQLSNFAYINWNDKSSLALISKEKLTIQNISNHKKEQSLNAPAELDTNVNSDKSDTGKR 480

Query: 476 RYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEF 535
            YE+ FTQP++EIL+LNE+FQ+ C+SPCE+IIP  DRQ+PLKNEA+ENQLEIFTD+SKEF
Sbjct: 481 GYEISFTQPINEILSLNESFQKVCLSPCERIIPPADRQLPLKNEANENQLEIFTDISKEF 540

Query: 536 LQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQ 595
           L+KI KAQSLGVSIYNRIHEQQ ELTRQLQST KII+KD  L+KK EAQ +KW++Q  RQ
Sbjct: 541 LRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSKIIAKDEILQKKLEAQTEKWNSQSSRQ 600

Query: 596 SKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDL 655
           ++LM RF KLTENLS++++S+KFKE+NIS+ EMEWFKEIRNQILQFN +VHSQKS+QQDL
Sbjct: 601 AELMTRFGKLTENLSKVAESDKFKEQNISHGEMEWFKEIRNQILQFNGFVHSQKSIQQDL 660

Query: 656 SYLKRELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTKTQ 713
           SYLKREL RIE+ETI  DKKSQ+EW+ELRKMLE+DSKIIKECNEEL H SQQLTTKTQ
Sbjct: 661 SYLKRELIRIESETINADKKSQNEWDELRKMLEVDSKIIKECNEELVHVSQQLTTKTQ 718

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score = 1073 bits (2774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/714 (73%), Positives = 613/714 (85%), Gaps = 2/714 (0%)

Query: 1   MSQSKSLASLPIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLS 60
           MS+S SL +LPIFQASLSASQSP YIF+S NGTR+VFIQDNIIRW N LT+  Y SL  S
Sbjct: 1   MSKSNSLVALPIFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFS 60

Query: 61  RHLVLDDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETE 120
           RHL+LDDTF VISS SGDLL FFN QEIFVMEVPWGY+N+E  S+QDAFQ+FHYSV + E
Sbjct: 61  RHLILDDTFRVISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVE 120

Query: 121 LGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPNNSFGLDARLN 180
            G +SLIKKVLFHPKSYHDSCIVVLKE+DTI MFDILNQQ KPI+LNK +NSFGLDAR+N
Sbjct: 121 NGSRSLIKKVLFHPKSYHDSCIVVLKEDDTITMFDILNQQHKPIVLNKRSNSFGLDARVN 180

Query: 181 DITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPT 240
           DITDL FS+DGLTLYCLNTTEGGD+FAFYP LP  LLL E DL WILNKSLVMYESLD T
Sbjct: 181 DITDLAFSRDGLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLGWILNKSLVMYESLDST 240

Query: 241 TDVTVKRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAK 300
           TD+TVKRNIIKQLQ VSKLHEN DS+L KV+ID EYRLVK+QGPFTINPFP+ELY+YTA 
Sbjct: 241 TDITVKRNIIKQLQLVSKLHENLDSQLGKVEIDEEYRLVKMQGPFTINPFPDELYEYTAA 300

Query: 301 NIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQK-E 359
           NI TI IDN QNEI C+ FDDGSL LL +DLEMSMSWDV NYV+N+SLVLIER+K+Q+ +
Sbjct: 301 NITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNYVHNNSLVLIERIKIQETD 360

Query: 360 IESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIAT 419
           I+SL TLPE++GKLYVFS+N V+Q++ST+W++ +S+CI ESDLN LGD+KFESK+ENI T
Sbjct: 361 IKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESDLNALGDVKFESKLENIVT 420

Query: 420 VEGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYEL 479
           +E   NLA+I WN+TSNL L +  +LTFQ +S D+++Q+T+ + +  ++     K  YE+
Sbjct: 421 IEHPSNLAYISWNDTSNLVLTARGKLTFQNISNDKELQTTKFDANNKSDRIDAGK-HYEM 479

Query: 480 RFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKI 539
            FTQP++EIL+LNE+FQ+ACISPCE+IIP   RQ+PLKNEASENQLEIFT +SKEFLQKI
Sbjct: 480 SFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNEASENQLEIFTGISKEFLQKI 539

Query: 540 AKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLM 599
            KAQSLG SIYNRI EQQ ELTRQLQ+T KIISKD DL++K  AQNKKWDAQ+ RQ KLM
Sbjct: 540 IKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQEKLGAQNKKWDAQVSRQVKLM 599

Query: 600 ERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLK 659
           ERF KLTENLS+I++S K +EKNI+  EM+WFKEIRNQILQFN +V SQKSLQQDLSY+K
Sbjct: 600 ERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQILQFNNFVRSQKSLQQDLSYMK 659

Query: 660 RELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTKTQ 713
           +ELTRIE ETI+ D+K+Q+EW+ELRKMLE DSKIIKECNEEL H SQQLTT TQ
Sbjct: 660 KELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNEELMHVSQQLTTNTQ 713

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/711 (41%), Positives = 450/711 (63%), Gaps = 24/711 (3%)

Query: 6   SLASLPIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVL 65
           S+ S  IF+ +  +S+  R++ TSQ+G+++V  QD+ IRW N   D  Y  + L     +
Sbjct: 2   SIGSHSIFKRASGSSK--RFLCTSQDGSKVVIYQDSSIRWCNAF-DSKYEFMLLEP--TI 56

Query: 66  DDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKS 125
           +D  HV+ S +G LL  +N +E+ ++E+PWGYS V      + FQ F YSVD  +     
Sbjct: 57  EDVEHVVLSPTGTLLLLYNSREVRIVEIPWGYSQVS----YEGFQKFRYSVDSRQ---DP 109

Query: 126 LIKKVLFHPKSYHDSCIVVLKENDTIIMFD---ILNQQEKPIILNKPNNSFGLDARLNDI 182
           LIKKVLFHP +Y + CIV+LK ++TI + D     ++Q K ++LN+ + +FG++  + DI
Sbjct: 110 LIKKVLFHPLAYREHCIVILKTDNTIHLLDRYYPYDKQPKLLVLNQHDGAFGMEGLVTDI 169

Query: 183 TDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTD 242
             + FS+DGLTLY L+  EG DI+AFYP LP ++ ++ + L  +++KSLV YE+L   T 
Sbjct: 170 ESITFSQDGLTLYALSVAEGCDIYAFYPCLPCSIEIDSHKLDLLMHKSLVQYENLSVETP 229

Query: 243 VTVKRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAKNI 302
              KRN IKQ QF+SKL +  ++   K+DI  ++  V+ QGPFTI PFP+  YD TA  +
Sbjct: 230 DATKRNTIKQFQFISKLRQGLENDQTKIDIPMDWLRVRGQGPFTIAPFPDRYYDRTAVQL 289

Query: 303 ATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQKEIES 362
             + I    N++  +SFDDG++++L +DLE++M WD   Y YN+SLVL+E +++++    
Sbjct: 290 KILPI-GANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNNSLVLVESIRLERG--E 346

Query: 363 LITLPEQMGKLYVFSKNF-VYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATVE 421
           L+     + + +V      +Y V+++ W+  +S CI+ SDL P+ DL+F+S+I  I  V 
Sbjct: 347 LVLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIADLQFKSEISKIEGVS 406

Query: 422 GMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELRF 481
            + + A    +        S   +  ++ +V+ +  + + E     +++ +   RYE+  
Sbjct: 407 QIDSYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDE-----KKANVDIPRYEVAL 461

Query: 482 TQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIAK 541
            QP+SEIL+LN +FQ     P  +++  + RQ  L NE++E QLEI T VSKEFLQKI K
Sbjct: 462 NQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVSKEFLQKIVK 521

Query: 542 AQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLMER 601
           AQ+LG +++NR  EQQ ELTRQLQ + +I+SK   LR K ++Q+ + +++I RQ KL++R
Sbjct: 522 AQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKIQRQDKLLQR 581

Query: 602 FSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKRE 661
           F+ L+E L  I++S KF+E NI++ EM WFKEIRNQ+L FN YVH QK+ Q  L YL++E
Sbjct: 582 FNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQKNQQDQLRYLQKE 641

Query: 662 LTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTKT 712
           L  I  E   V +KS+SEW EL  +LE D+KIIKECN +L HAS ++   T
Sbjct: 642 LENISLEDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAHASSEVGFST 692

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/708 (40%), Positives = 445/708 (62%), Gaps = 31/708 (4%)

Query: 11  PIFQASLSA-SQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDDTF 69
           PIF+ SL+A S S R+  T+ +G R V +QD+ IRW NV ++P YHS++L R     D  
Sbjct: 7   PIFRPSLTAQSGSDRFFLTTSDGGRAVVVQDSCIRWCNV-SEPGYHSMTLER--AFKDVK 63

Query: 70  HVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKK 129
           HV+ S SG+ LC +ND E+ ++EVPW Y+ V   S+ +AFQ+F +  DE        IK+
Sbjct: 64  HVVMSNSGEFLCLYNDDELRIIEVPWAYTEVS--SMANAFQLFRFVSDEAR------IKQ 115

Query: 130 VLFHPKSYHDSCIVVLKENDTIIMFDILNQQE----KPIILNKPNNSFGLDARLNDITDL 185
           VLFHP +Y    +V+LK++D+I    I+N Q+    KP +LN  N ++ LD+ + D+  +
Sbjct: 116 VLFHPLAYQQETVVILKDDDSIT---IMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECI 172

Query: 186 VFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTV 245
            FS+DGLTLY L+ +EG DI+AFYP L   +  ++  L  ++ KSL+ Y+ L+  TD  V
Sbjct: 173 TFSQDGLTLYVLSVSEGADIYAFYPCLAPRMQFDKQGLDRLMYKSLIQYDVLNVGTDSEV 232

Query: 246 KRNIIKQLQFVSKLHENWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAKNIATI 305
           KRN IKQL+FVS LH+  +S+   ++I    R V+ QGPFTI PFP ++Y  T   IA++
Sbjct: 233 KRNTIKQLKFVSGLHKQQNSQ-RILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASL 291

Query: 306 SIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKM-QKEIESLI 364
            I N QNE+  +S DDG++ +LL+DL+++M+WD   Y YN+S  L+E + +  +EI+ ++
Sbjct: 292 PI-NDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIV 350

Query: 365 TLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATVEGMP 424
               + G+  V +   V+ ++++ W+  ++ C+ ESDL PL + K ES++      +   
Sbjct: 351 VGDHKYGQFSVMTPEGVFSIDTSKWSGVMASCLTESDLRPLAETKLESEVTFTELKDSPK 410

Query: 425 NLAHIYWNNTS-NLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELRFTQ 483
           ++A  +WN T  ++   SN+E+  + VS     Q  +        E      +Y   ++Q
Sbjct: 411 SVA--WWNTTPQSVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPE------KYNAHYSQ 462

Query: 484 PLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIAKAQ 543
           P++EI+ LN+ FQ        ++IP  +RQ PLKNEASE QL++ T+ SK+F+ KIA  Q
Sbjct: 463 PIAEIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIAVGQ 522

Query: 544 SLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLMERFS 603
           +LGV+++NRI+EQQL+LT QL+++ +++ K   +   F +Q+ + DA   R S LM RF+
Sbjct: 523 TLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMSRFN 582

Query: 604 KLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKRELT 663
           K  +NL +I  S +FK+  IS  E+EWFKEIR Q+L FN  VH+QK LQ  L +LK+E+ 
Sbjct: 583 KFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQEMN 642

Query: 664 RIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTK 711
           RI   T   + +++ EW+ELR MLE D+ I+++CN +L+ A++Q+  +
Sbjct: 643 RIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSAARQVPAQ 690

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  532 bits (1371), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 290/726 (39%), Positives = 463/726 (63%), Gaps = 34/726 (4%)

Query: 1   MSQSKSLASLPIFQA-SLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSL 59
           MS   S+AS PIFQ    +   +PR++FTS +GTR+V +Q  ++RW +V T   ++S+++
Sbjct: 1   MSNIDSIASHPIFQGLDCTQDAAPRFLFTSHHGTRMVVLQGGLLRWCSV-TASSFNSMTI 59

Query: 60  SRHLVLDDTFH--------VISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQV 111
                  D F          I S SG+ +C + +  I V+E+PWGY    + S+   FQ+
Sbjct: 60  -------DFFQPESTAPQKAILSNSGEFICVYTNHTIEVIEIPWGYV-TPSPSMVSKFQL 111

Query: 112 FHYS-VDETELGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPN 170
           F Y+  D+    P   IK+VLFHP++Y DSC+VVL +N TI + D+  Q  K I LNK  
Sbjct: 112 FSYNNKDDDGYSP---IKQVLFHPEAYKDSCLVVLYDNGTISLMDV-TQITKTITLNKRV 167

Query: 171 NSFGLDARLNDITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKS 230
            +FG+D ++ DI  + FSKDG TLY L+ ++GGDI+AFYP LP  L +    ++ +L++S
Sbjct: 168 ATFGIDTQITDIESICFSKDGWTLYALSISDGGDIYAFYPCLPQQLEVKREKITSLLHES 227

Query: 231 LVMYESLDPTTDVTVKRNIIKQLQFVSKLH----EN-WDSKLNKVDIDSEYRLVKVQGPF 285
           +++YESL   TD  VKRN+I+Q+QFV+KL+    EN  +S  + ++I+ EYRL++ QGPF
Sbjct: 228 VLLYESLKLDTDRDVKRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYRLIRGQGPF 287

Query: 286 TINPFPNELYDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYN 345
           TI+P+P  LY  TA  I+T+ I N  NE+ C+ FDDGS+ LL KDL ++MSWDV NYV+N
Sbjct: 288 TIDPYPERLYSATALEISTLPI-NSNNELMCMIFDDGSIALLFKDLPLTMSWDVDNYVHN 346

Query: 346 DSLVLIERVKMQK-EIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNP 404
           +S  L+E ++++  +++ +++ P+  G+ ++F  + ++ V++  W+  ++K I+ S+LN 
Sbjct: 347 NSFSLVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAIDNSNLNE 406

Query: 405 LGDLKFESKIENIATVEGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQK-MQSTETET 463
           L ++ F SK++   T  G+   +   W     +   + +++    V + +  +       
Sbjct: 407 LLEMNFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVYMHPVEMRKSGILGNNKPV 466

Query: 464 DIGTEESGLAKCRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASEN 523
            +  EE  L    Y+  F QP+ E++ LN+ FQ+ C     ++I   +RQ+ L NE +E 
Sbjct: 467 LVNNEE--LKHQEYKTSFKQPVEELMALNKLFQQQCSMGVSKLIAPEERQVLLNNENNEV 524

Query: 524 QLEIFTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEA 583
           QLE+ +DVSKE + KI + Q+L +++++R+ EQQ ELTRQL+    I+SK  DLR+K E 
Sbjct: 525 QLELLSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQSDLRRKSEE 584

Query: 584 QNKKWDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNC 643
           Q+++WD Q  R S+L++R   L   + EI+ S K KE  I++ E+EWFKEIRNQ+L+FN 
Sbjct: 585 QSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEIRNQVLKFNS 644

Query: 644 YVHSQKSLQQDLSYLKRELTRIETETIQV-DKKSQSEWNELRKMLEIDSKIIKECNEELQ 702
           +VH+Q+  Q++L++LK++L RI  ET Q+ D+KS  EW+ELR +L+ D++II+ECN+EL 
Sbjct: 645 FVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQIIQECNKELL 704

Query: 703 HASQQL 708
             ++ L
Sbjct: 705 STTEAL 710

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  519 bits (1337), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 289/730 (39%), Positives = 444/730 (60%), Gaps = 35/730 (4%)

Query: 7   LASLPIFQASLSASQ-SPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVL 65
           +AS PIF  S+  ++ S R+ FTS  GTR+V +Q  I++W NV+ D  YHS+ +    + 
Sbjct: 8   IASHPIFGTSIITNEDSQRFFFTSHQGTRMVLLQGCILKWCNVI-DTTYHSMKVKS--IF 64

Query: 66  DDTFHVIS---STSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELG 122
           ++   +I    S SGD LC +  + I ++E+PWGY  + +  +   FQ FHY +  +   
Sbjct: 65  NNKRKIIDVKLSESGDFLCIYTTKTIDILEIPWGYEKIPD-ELLSKFQPFHYDISSSTSA 123

Query: 123 PKSL--IKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPNNSFGLDARLN 180
             S   IK+VLFHPKSYH++C+V+L E+  I + D     E  I +N+P  + G++ R+ 
Sbjct: 124 LSSPSDIKQVLFHPKSYHETCLVILYEDSIIQLIDTTASTE-TITINQPTGTLGVETRVI 182

Query: 181 DITDLVFSKD-GLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDP 239
           DI  + F K  GL LY L+ ++GGDI+A YP LP+ L +++ ++  +L KS+V+Y+SL  
Sbjct: 183 DIESICFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKEVDLLLQKSIVLYDSLKE 242

Query: 240 TTDVTVKRNIIKQLQFVSKL------------------HENWDSKLNKVDIDSEYRLVKV 281
                VKRN+IKQLQF +KL                  H   D KL  +D+D EYRLV  
Sbjct: 243 NMSNDVKRNVIKQLQFATKLQGQFLEQLKGEKDEERTRHAQKDLKL-ILDVDLEYRLVNF 301

Query: 282 QGPFTINPFPNELYDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGN 341
           QGPFTI+PFPNELY  TAK    + I N+ NE+  ++FDDGS+ LL +DLE++MSWD+ N
Sbjct: 302 QGPFTISPFPNELYSATAKESQCMKI-NENNELLIMTFDDGSVALLFRDLELTMSWDIAN 360

Query: 342 YVYNDSLVLIERVKMQ-KEIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINES 400
           Y++++S  L+E +K++  +I  LI   +  GK ++ S + +  V++ SW+  ++K I++S
Sbjct: 361 YIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVIMLVHTNSWSDKLAKAIDDS 420

Query: 401 DLNPLGDLKFESKIENIATVEGMPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTE 460
           +LN L ++ FES+I     +    N     ++   ++   S+  +  + ++    M + +
Sbjct: 421 NLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVSSDNVFVENLTKKHSMNNIK 480

Query: 461 TETDIGTEESGLAKCRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEA 520
             +   + E   A+  Y++ F QP+ E++TLNE FQ+ C  P  ++I   DRQI L NE+
Sbjct: 481 GSSTSNSNEET-AESEYKVTFKQPIDELMTLNELFQKQCRMPFSKLIKPEDRQIELSNES 539

Query: 521 SENQLEIFTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKK 580
           +E QLEI TD+SKE + KI   Q+LG +++NR+ EQQLELTRQL+ T  +  K   ++ K
Sbjct: 540 NEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTRQLKHTQIVFEKQDCIKNK 599

Query: 581 FEAQNKKWDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQ 640
            +   K+W+ Q+ R  KL +R   L E L  I+ S       I++ E+EWFKEIRNQ+ +
Sbjct: 600 NKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYPITSVELEWFKEIRNQVHK 659

Query: 641 FNCYVHSQKSLQQDLSYLKRELTRIETE-TIQVDKKSQSEWNELRKMLEIDSKIIKECNE 699
           FN +VH+Q+   ++LS+LK+EL RI  + T  VD+KS+ EW ELR +LE DSKIIKECN 
Sbjct: 660 FNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWEELRAILEQDSKIIKECNI 719

Query: 700 ELQHASQQLT 709
           EL   ++ + 
Sbjct: 720 ELTKTTESMA 729

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  506 bits (1302), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 272/683 (39%), Positives = 434/683 (63%), Gaps = 37/683 (5%)

Query: 41  NIIRWYNVLTDPCYHSLSLSRHLVLDDTFH--VISSTSGDLLCFFNDQEIFVMEVPWGYS 98
           N +RW +V +   YHSL L   L  DD+ +  VI S SG  LC ++ + + ++E+PWGY 
Sbjct: 52  NQLRWGSVASSQ-YHSLPL---LFFDDSAYENVIISNSGQFLCLYDKKSLSLIEIPWGYD 107

Query: 99  NVENISIQDAFQVFHYSVDETELGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILN 158
                SI+ +FQ     V+++     S IKK+LFHPK+  D C+V+L END I +FD+  
Sbjct: 108 GAVT-SIKSSFQRVFRDVNKS-----SDIKKILFHPKAADDGCVVILFENDVICLFDL-- 159

Query: 159 QQEKPIILNKPNNSFGLDARLNDITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLL 218
           ++ + + LNK  N  G++ R+ DI D+ FS+DGLTLY L+ T+GGDI+AFYP LP  L L
Sbjct: 160 RKSEKLFLNKTANKLGIETRVTDIEDMEFSQDGLTLYMLSVTDGGDIYAFYPCLPPKLSL 219

Query: 219 NENDLSWILNKSLVMYESLDPTTDVTVKRNIIKQLQFVSKLHENW--DSKLNKVDIDSEY 276
            ++ L  + NKS ++Y+SLD T  + V++N++KQ++F++ L ++   ++K + ++I +++
Sbjct: 220 KKSVLEDLFNKSRILYDSLDSTVSIEVRKNVLKQIKFIASLRDSSSDETKNSCLEISNDF 279

Query: 277 RLVKVQGPFTINPFPNELYDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMS 336
           R VK QGPFT+ P+P +LY+ TAK I T+ I N  NE+F I+FD+G++ LLLKDLE+SMS
Sbjct: 280 RQVKAQGPFTVAPYPEKLYEATAKEIYTLDIGNN-NELFAITFDNGTVTLLLKDLELSMS 338

Query: 337 WDVGNYVYNDSLVLIERVKMQKEIESLITLPEQMGKLYVFSKNF--VYQVNSTSWTSTIS 394
           W+  NYVYN+S VLIE V+M  E   L+      G++++ S+N   V ++++T+W+  +S
Sbjct: 339 WNADNYVYNNSFVLIESVEMGPESIKLLKSSSLTGQMFI-SQNHSSVRKIDTTAWSFKVS 397

Query: 395 KCINESDLNPLGDLKFESKIENIATVEGMPNLAHIYWNNTSNLALASNKELTFQT----- 449
           KCI  SDL  L D+ F+SKI ++   E +             +   SN  +  +T     
Sbjct: 398 KCITNSDLTSLIDVDFKSKISDLDIKENVDCYGVWSLRGERGILFVSNSSVISRTLPESD 457

Query: 450 ----VSVDQKMQSTETETDIGTEESGLAKCRYELRFTQPLSEILTLNENFQRACISPCEQ 505
               + +D+  +S   E  +          +YE+ FTQP+SEI+ LN++FQR C  P ++
Sbjct: 458 SSFVIKLDEMSRSKNIEDPVTK--------KYEVSFTQPISEIMNLNDSFQRICRHPFKK 509

Query: 506 IIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQ 565
           II   +RQ  L N+++E QL   T++S + +  I + QSLG+ + NR++EQQ ELT+QL+
Sbjct: 510 IISPEERQTVLSNDSNETQLATLTEISNDLVSNIVEGQSLGLVLRNRLYEQQYELTKQLK 569

Query: 566 STCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISN 625
            + ++I K   L+  ++ +  +W+  + +Q +L++RF+ L  NL++I +S +  +  IS 
Sbjct: 570 ESIQLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFNALNGNLAKIHESKEISKTPISE 629

Query: 626 AEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKRELTRIETETIQVDKKSQSEWNELRK 685
            E+EWFKE+RNQIL+FN +VH  +++Q+ +++L++ L+RIE++  Q      SEW E +K
Sbjct: 630 KEVEWFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLSRIESKVGQRSSHLTSEWAEFKK 689

Query: 686 MLEIDSKIIKECNEELQHASQQL 708
           +LE D+ IIKECNEEL  A  QL
Sbjct: 690 ILETDTNIIKECNEELTKAHTQL 712

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  462 bits (1190), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 275/744 (36%), Positives = 434/744 (58%), Gaps = 50/744 (6%)

Query: 2   SQSKSLASLPIFQ--ASLSASQSPRYIFTSQNGTRIVFIQ--DNIIRWYNVLTDPCYHSL 57
           S S+ +   PI Q  A L +  S RY+FT+  GT+ V++   + ++RW +V  D  Y+S+
Sbjct: 15  SVSQLMGQRPILQPTAGLPSDLSSRYVFTTDKGTKYVYLDKTNGLLRWGSVSEDE-YNSM 73

Query: 58  SLSRHLVLDDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVD 117
            L      D + +VI S SG+ LC ++   + V+EVPW Y N E +S      VF  S  
Sbjct: 74  PLKISNFADKSVNVILSDSGEFLCVYSKDCVTVIEVPWRYRNPEEMSY-----VFQTSF- 127

Query: 118 ETELGPKSLIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPIILNKPNNSFGLDA 177
             E+   S IKKVLFHP++   +C+V+L E+DTI +FD+  +    I LN P+ + G++ 
Sbjct: 128 -KEIRKDSFIKKVLFHPRAIKKTCMVILFEDDTIYLFDV--EDNNKIALNVPSGNIGIED 184

Query: 178 RLNDITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESL 237
           R+  I D+ FS+DGLTLY L+  + GD++A YP LP  L +++ +L  ++N+S+++Y+SL
Sbjct: 185 RITSIADIEFSQDGLTLYVLSAEDCGDVYAIYPCLPPILAMSQKELKSLMNRSVLLYDSL 244

Query: 238 DPTTDVTVKRNIIKQLQFVSKLHENWDSK---LNKVDIDSEYRLVKVQGPFTINPFPNEL 294
             TT   VK+ +IKQ++F+S+L      K    N ++ID+ YRL K QGPFTI PFP +L
Sbjct: 245 TETTPSAVKKGVIKQVEFISQLQNISHGKEEISNVLEIDTIYRLAKPQGPFTIAPFPEKL 304

Query: 295 YDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERV 354
           Y  TA  I  ++I    NEI CI++D+G+ + L KDLE+SM+WDVG   YN+SLVL+E  
Sbjct: 305 YSATATEICPLNIGGG-NEILCIAYDNGTALFLFKDLELSMAWDVGGIYYNNSLVLMEEF 363

Query: 355 KMQKEIESLITLPEQMGKLYVF-----------SKNFVYQ-------------VNSTSWT 390
            +Q E    I    +M  L +F           SK+F+               V++ +W+
Sbjct: 364 DLQTESAVSILKSFKMDGLILFKVSDSVQHIDVSKSFIQDGDLLVQQSSMIRCVDTKAWS 423

Query: 391 STISKCINESDLNPLGDLKFESKIENIATVEGMPNLAHIYWNN--TSNLALASNKELTFQ 448
           S +S CI+  D+N L  + F+SK    A + G    +   WN+  T  +   +NK +T +
Sbjct: 424 SVVSDCIDRHDINALITVSFKSKGHTWA-IAGSDITSCGAWNHGGTEGVTWITNKSVTCK 482

Query: 449 TVSVDQKMQSTETETDIGTEESGLAKCRYELRFTQPLSEILTLNENFQRACISPCEQIIP 508
            +   +K  S + E    +E+   A  + E  F+ P+SE+  LN N+Q  C      II 
Sbjct: 483 EL---KKQVSWKPEQSTSSEKKKQAFPKPE--FSVPISELNALNINYQDTCRIGFHDIIS 537

Query: 509 STDRQIPLKNEASENQLEIFTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTC 568
             DRQ PL N ++E QL++ T +S   L  + K Q LG+++YNR+ EQQLELT+QLQ + 
Sbjct: 538 PLDRQKPLLNPSNEKQLQVMTSLSNYLLATVGKGQGLGMTLYNRLLEQQLELTKQLQCSN 597

Query: 569 KIISKDVDLRKKFEAQNKKWDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEM 628
           KI+ K   + KK E Q   W+ ++ +Q+KL ERFS L + L+ I K+ K  +  I++ E 
Sbjct: 598 KILMKQPAIAKKLEEQKSVWNEKLAKQNKLKERFSSLQQKLAAIDKTKKSTDLVITDEES 657

Query: 629 EWFKEIRNQILQFNCYVHSQKSLQQDLSYLKRELTRIETETIQVDKKSQSEWNELRKMLE 688
            WFKE++ + L FN  V+ Q+S+Q DL +LKREL+   +++ ++   + +EW+ L++ML+
Sbjct: 658 VWFKEVKKEALTFNDLVYKQESVQDDLRFLKRELSTFVSDSQRLPGTANTEWHSLQEMLK 717

Query: 689 IDSKIIKECNEELQHASQQLTTKT 712
            DS +++   ++ + AS Q++ + 
Sbjct: 718 HDSLLLRADKKDKKDASSQVSRRA 741

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  417 bits (1073), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 258/717 (35%), Positives = 415/717 (57%), Gaps = 50/717 (6%)

Query: 11  PIFQ-ASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDDTF 69
           PIFQ  S+     P+ + T+Q+G R+V IQ + IR        C  S   S++ +++   
Sbjct: 7   PIFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRL-------C--SSGNSQYQIIECGI 57

Query: 70  HVISST----SGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKS 125
           + ++      SG LLC +N+ E+ V+ +P  + +     ++     ++ +V       KS
Sbjct: 58  NTVAGAALNNSGTLLCAYNETELQVIVLPSPFVSSHGGILKP--HTYNITV-------KS 108

Query: 126 LIKKVLFHPKSYHDSCIVVLKENDTIIMFDILNQ--QEKPIILNKPNNSFGLDARLNDIT 183
            IK+V +HP+   DS  VVL ++DTI M+++ N+  Q+   +LN   N  G+ + + DI 
Sbjct: 109 PIKQVQWHPRGKLDSVPVVLHKDDTIAMYELYNEDFQQPTAVLNTMQNQLGVTSHITDIE 168

Query: 184 DLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDV 243
            + FSKDGL LY LN++EGGD++A YPFLPS L++ E  L     KS + YE+L      
Sbjct: 169 SMCFSKDGLALYLLNSSEGGDVYALYPFLPSVLVIPEQHLEMCFYKSCINYENLSSDDSP 228

Query: 244 TVKRNIIKQLQFVSKLHENWDSK-LNKV-------DIDSEYRLVKVQGPFTINPFPNELY 295
           TVKRN+IKQLQFVS+LH+ + S+ ++K        +I   YR  K+QGPFTINPF  +LY
Sbjct: 229 TVKRNVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFTINPFAEKLY 288

Query: 296 DYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVK 355
             TA  I T+ ID + NE+  + FD+G+++   +DL++SM W+  +   N+SLV++E + 
Sbjct: 289 SATATQITTMPID-EFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNSLVVLESLD 347

Query: 356 MQKEIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIE 415
           +    + +   P +   L    K+FV  V+S+ WT  +S+CIN S+L  L  +  +S   
Sbjct: 348 ILSG-QIICLTPHKFAVLG--PKSFV--VDSSEWTKALSECINFSNLEVLSQINIKS--- 399

Query: 416 NIATVEGMPNLAHIYWNNT-SNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAK 474
            I  V G    A ++ +N    L   S+K +   T+      +  +T+  +      + +
Sbjct: 400 TITPVNGAFTQAGLWESNGEKQLIFMSDKSVKSITLP-----EPNKTKDAVSKTVQPVTE 454

Query: 475 CRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKE 534
            +YE  F+QP+ EIL LN+ FQ  C    + +IP     +PL+N+++E+QL + TD+SKE
Sbjct: 455 VKYEPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKE 514

Query: 535 FLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIR 594
              KI + Q+LG+ I+NR+ EQ+ ELTRQL+ + +I+ K   L++++  QN +W+    +
Sbjct: 515 VFSKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKK 574

Query: 595 QSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQD 654
           Q  +  RF KL   L+EIS S K K+  IS  EMEWFKEI++Q+  FN +V  Q+ +++ 
Sbjct: 575 QENIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQ 634

Query: 655 LSYLKRELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTK 711
           L +++ EL        +V K+   +W EL+++L +DS+IIKECNE L  A+++L  K
Sbjct: 635 LEFVQSELKTAGER--RVSKEDVFDWAELQELLSVDSEIIKECNEGLVEAAKELDEK 689

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  416 bits (1069), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 266/722 (36%), Positives = 422/722 (58%), Gaps = 38/722 (5%)

Query: 11  PIF-QASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDDTF 69
           PIF + S+S   + R+ F++ NGTRI+  QD+ IRW     +  Y S++L R   +D T 
Sbjct: 7   PIFKRPSVSRELTKRFFFSANNGTRIILFQDSTIRWSFSSDNDHYQSMAL-RDSDMDVTG 65

Query: 70  HVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENIS--IQDAFQVFHYSVDETELGPKSLI 127
            +IS   GD LC +N  +I V+E+PWG +NV+ IS  +  + Q   Y+ +E +L     +
Sbjct: 66  AIISDP-GDYLCLYNSHQIRVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLS----V 120

Query: 128 KKVLFHPKSYHDSCIVVLKENDTIIMFDILN---QQEKPI--ILN-KPNNSFGLDARLND 181
           K+VLFHP S     +VVL     I   D+ N     + PI   LN   +N  G+D R+ +
Sbjct: 121 KQVLFHPLSKSSPFLVVLFSGSQIAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVEN 180

Query: 182 ITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTT 241
           I  +VF+ D L+LY L  T   D++ FYP LP    L++N +  ++NKS+V+YE+L    
Sbjct: 181 IQYVVFADDCLSLYSLTDT---DVYCFYPCLPPVASLSKNRVDELINKSIVLYENLGIDA 237

Query: 242 DVTVKRNIIKQLQFVSKLH------ENWDSKLN-KVDIDSEYRLVKVQGPFTINPFPNEL 294
           D  V++N+IKQLQ  S L       EN + ++   V+ID E+R  K QG F+I+P+P  L
Sbjct: 238 DDIVRKNVIKQLQLASSLRKKIEEFENANGEVEVNVEIDLEFRQTKAQGYFSISPYPESL 297

Query: 295 YDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERV 354
           Y  T K I+ + I  + NE+F +SFD+G+++++ KD E +MSWDV +Y +N+S  L+E +
Sbjct: 298 YTCTGKQISVLPI-GEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEII 356

Query: 355 KMQ-KEIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESK 413
           K + +E+ +++ L  ++GK  V  +     V++T W+S ISKCI ++DL PL  L+ +S 
Sbjct: 357 KFKPEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKST 416

Query: 414 IENIATVEGMPNLAHIYWNNT---SNLALASNKELTFQTVSVDQKMQSTETETDIGTEES 470
           I +I + +   N   I WN+    S L + +N  + +Q    + + +  E+  +I TE  
Sbjct: 417 ITHINS-DMQINSCGI-WNSGEAKSLLLVDTNVVVGYQLFKKEVEFKP-ESAEEISTELE 473

Query: 471 GLAKCRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTD 530
                +    FT P +E+   N  FQ A   P  ++IP+  +Q+P  + A E QL+I  D
Sbjct: 474 NFTLDK----FTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILND 529

Query: 531 VSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDA 590
           +S++   KI + QSLG+ +Y+R+ EQQ +L+ QL  T KI+ +   ++  + AQ  K D 
Sbjct: 530 ISRDVGSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQGDYPAQLSKLDE 589

Query: 591 QIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKS 650
           ++ +Q  L +   K+  NL+ I +S K K   +S  E++ FKE+R+QIL FN +VH QK 
Sbjct: 590 KLKKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKD 649

Query: 651 LQQDLSYLKRELTR-IETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLT 709
            +Q++ +LK+EL + I+    +  K   +EW ELR++L  D+KIIKECNE+L   S++L 
Sbjct: 650 QKQNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLTQISKELD 709

Query: 710 TK 711
           TK
Sbjct: 710 TK 711

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  404 bits (1038), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 264/725 (36%), Positives = 401/725 (55%), Gaps = 43/725 (5%)

Query: 8   ASLPIFQAS-LSAS---QSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSL-SRH 62
            S PIF+ + LS+S    SPR+ FT+    R+V +QD  IRW    +   YHS ++ SR+
Sbjct: 16  TSHPIFKRNYLSSSFQETSPRFFFTTNRDNRVVVVQDGSIRWCYTFSQ-NYHSYTIASRN 74

Query: 63  LVLDDTFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELG 122
             + D+   + S SG  +C+++D +I +ME+PW +SN  N S     Q + YS  +  L 
Sbjct: 75  FDIKDS---LISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSFKKYSLT 131

Query: 123 PKSLIKKVLFHPKSYHDSCIVVLKENDTIIM------FDILNQQEKPIILNKPNNSFGLD 176
               +K+VLFHP +  +SC+VVL  +DTI+       FD+L+      ILNK + S GL 
Sbjct: 132 ----VKQVLFHPLATLESCLVVLLSDDTIVFIDFSKSFDLLSSD---YILNKKSKSIGLS 184

Query: 177 ARLNDITDLVFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYES 236
           ++++DI  L FS+DGLTLY L+++   D++AFYP LP +   +   L  ++NKS+V YE 
Sbjct: 185 SQISDIQSLTFSQDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLENLVNKSVVQYEE 244

Query: 237 LDPTTDVTVKRNIIKQLQFVSKLH--------ENWDSKLNKVDIDSEYRLVKVQGPFTIN 288
           L       +K NIIKQL+F S L+        E+ DSK  K D+  EYRL++ QGPFTI+
Sbjct: 245 LREDDPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPLEYRLIRPQGPFTIS 304

Query: 289 PFPNELYDYTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSL 348
           PFP+ LY  +  +I ++ ID   NE+  +SF DGS++ L +DLE++MSWD  N+  N+SL
Sbjct: 305 PFPDSLYYSSPTHIVSVPIDTT-NELLVLSFSDGSVVSLFQDLELTMSWDQDNFNENNSL 363

Query: 349 VLIERVKMQKE-IESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGD 407
           VL+E +K +++ I  L T   Q G  Y+      ++V ++ W+ST++ CI  SD+  L +
Sbjct: 364 VLLELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLAICIKSSDIRDLSN 423

Query: 408 LKFESKI---ENIA---TVEGM---PNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQS 458
           L  +S I   +N A   T  G    P ++ + + N S +   + K     +      + S
Sbjct: 424 LLIKSVIKPFDNAAYELTSGGWWCSPTISSLLFINKSTVIELNEKPKLLLSDDTTHLLTS 483

Query: 459 TETETDIGTEESGLAKCRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKN 518
              +  I   E  + K   EL     +S++  +N  F+          IPS +R + L N
Sbjct: 484 ELAQKYIPPLEDKIFKI--ELPMGILISDLNNMNTVFKEESNKQLTIPIPSQERNVTLFN 541

Query: 519 EASENQLEIFTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLR 578
           + +ENQLE  T +SK    KI+  QSLG  IYN+I +QQ  +  QL+ T +++ K+  L 
Sbjct: 542 KTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVELQLRQTQRLLEKEKILN 601

Query: 579 KKFEAQNKKWDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQI 638
            K+  Q  K  A   RQ KLM R   + E L +          +IS  E+E+FKEIR Q+
Sbjct: 602 TKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNISISKKELEFFKEIRKQV 661

Query: 639 LQFNCYVHSQKSLQQDLSYLKRELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECN 698
           L FN +VH QK     L ++K+EL RI+ E   VD+    +W+ LR ML  D+  I+ C 
Sbjct: 662 LLFNEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDRLRDMLHDDATTIETCT 721

Query: 699 EELQH 703
           E +++
Sbjct: 722 ESIKN 726

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  356 bits (914), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 230/715 (32%), Positives = 372/715 (52%), Gaps = 49/715 (6%)

Query: 9   SLPIFQASL-SASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDD 67
           S PIF     S+ +S R++F     ++   +Q N +RW +      Y  L     +   D
Sbjct: 5   SHPIFDTKTNSSGKSRRFVFNIGIASKYGVLQGNTLRWCSAGGHE-YQYLEFEPRI---D 60

Query: 68  TFHVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLI 127
              V+ + SG LLC +N +++ ++ V W  S  + I I                 P + I
Sbjct: 61  YTSVVINESGSLLCLYNSKQVQILAVSWDESKSDTILI----------------SPPAGI 104

Query: 128 KKVLFHPKSYHDSCIVVLKENDTIIMFDILNQQ--EKPIILNKPNNSFGLDARLNDITDL 185
           K+ L+HP+    SC+ VL   D I ++++L +   E   ILN      G+ + + DIT +
Sbjct: 105 KQALWHPRGRLGSCLAVLTTQDEICLYELLTEDYTEPTTILNTCTKELGMGSVVKDITSM 164

Query: 186 VFSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTV 245
            FS DGLTLY L+T+EG DI++ YP LPS + ++   L  + NK+L+ Y+ L+      +
Sbjct: 165 SFSSDGLTLYLLSTSEGADIYSIYPCLPSEMEISGALLKSVFNKALLQYQDLNDNDSPDL 224

Query: 246 KRNIIKQLQFVSKLHENWDSKLNK---VDIDSEYRLVKVQGPFTINPFPNELYDYTAKNI 302
           +R + KQLQFVSKL +  D K  +   V I   +R  + QGPFTINPFP+ LY  T + +
Sbjct: 225 RRKVTKQLQFVSKLQKKNDYKDTESHVVTISKAHRSPRAQGPFTINPFPDNLYLATGRQV 284

Query: 303 ATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQKEIES 362
             I +     E+  ISFDDG+++    D E  MSW+   +  N+SL+++  V +  EI +
Sbjct: 285 EVIKLQGCAAELLLISFDDGTILECFPDREPVMSWEDEGFCENNSLIVLGSVNIGGEI-A 343

Query: 363 LITLPEQMGKLYV-FSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATVE 421
           L+      G  +V  S   V  V+       I   +N+ D++   +       E +    
Sbjct: 344 LVN-----GYTFVVLSSAKVTFVSLRKLAQVIESSLNDCDISYFDEADLS---EEVVEKN 395

Query: 422 GMPNLAHIYWNN-TSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELR 480
           G    A I  ++  S +AL S  E T   + +   + + +  T +GT ++ + + R    
Sbjct: 396 GRFCSAIICASSEKSCVALLS--ETTTSHIDIPFSLDAPKMRTALGTAKTDVEQYR---P 450

Query: 481 FTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIA 540
           + QPL+E+L LNE  Q     P +  +  + RQ  L NE++E+QL + T +SKE + +IA
Sbjct: 451 YGQPLNEVLALNEKVQALLKKPLQTGVSPSLRQAKLNNESNEDQLSLLTSISKEVMTRIA 510

Query: 541 KAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLME 600
            AQ+L +S+Y R+  QQ ELT+ L++  K+      + ++ + Q+ +W+A   +   +  
Sbjct: 511 SAQTLALSLYLRLSCQQGELTQHLETVSKVEELQSKVLRRLKDQSSRWEAAQAKNKSISS 570

Query: 601 RFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKR 660
           R  +++  L ++S S KF+ + ISN E+EWFKEIR+Q+++FN  VH Q+SL   LS LK 
Sbjct: 571 RLEQISSKLKQVSSSGKFQSQPISNHELEWFKEIRDQVIRFNRLVHEQQSLGNTLSNLKC 630

Query: 661 ELTRIET-------ETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQL 708
           EL  +          +   D K +  W+ELR +L  D +II EC + LQ  ++QL
Sbjct: 631 ELEYVHVESKEGKSGSSSADNKDEVPWDELRALLAKDLRIIGECQDSLQGVAKQL 685

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  357 bits (915), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 241/721 (33%), Positives = 396/721 (54%), Gaps = 47/721 (6%)

Query: 16  SLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVL-TDPCYHSLSLSRHLVLDDTFHVISS 74
           S+    S R   T  NG +I+  Q+N +R+  V   D  + S++L + ++ D    +I+ 
Sbjct: 14  SVGKVSSKRSSITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMIGD--VSIIAD 71

Query: 75  TSGDLLCFFNDQEIFVMEVPWG-YSNVENISIQDAFQVFHYSVDETELGPKSLIKKVLFH 133
             G+ LC FN+ EI V+E+PW  +   E+ S Q    V   S D    G  + I+K+LFH
Sbjct: 72  QIGNYLCLFNEFEIRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFG--TTIQKILFH 129

Query: 134 PKSYHDSCIVVLKENDTIIMFDI---LNQQEKP---IILNKPNNSFGLDARLNDITDLVF 187
           P      C+VVL +N  I   DI   L  +E P   I         GL + ++DI D+ F
Sbjct: 130 PLGLAYPCLVVLLKNSNICSIDIKRILKVEEIPSTCITTFHTKGVMGLSSCIDDIIDISF 189

Query: 188 SKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTVKR 247
           S D L+LY L  T   DI+ FYPFL   + + +N++  +  KS++++E+L+  +   V+R
Sbjct: 190 SSDKLSLYALTET---DIYLFYPFLIPTISVTKNEIDQLFQKSIILFENLENDSSEAVRR 246

Query: 248 NIIKQLQFVSKLH----------ENWD-SKLNKVDIDSEYRLVKVQGPFTINPFPNELYD 296
           NIIKQLQ +S L           +N D +K+  +DI++EYR V  QG F+I PFP ELY 
Sbjct: 247 NIIKQLQLLSTLSGDIKTQMKQVKNTDETKIYNIDINTEYRSVNAQGSFSIAPFPEELYK 306

Query: 297 YTAKNIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKM 356
            +A N++ I I    NE++ I++DDG++++L +DLE SMSWD  +Y +N+S +L+E++K 
Sbjct: 307 QSAVNLSVIQI-GHGNELYVITYDDGTVLILYRDLESSMSWDSNDYTFNNSFILLEKLKF 365

Query: 357 Q-KEIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIE 415
              E +S++ +P + G   +     V  ++++ W+  +S+CI ++D+  L  L  ES  +
Sbjct: 366 NPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRNLAGLSIESHKQ 425

Query: 416 NIATVEGMPNLAHIYWNNTSNLALASNKELTFQT----VSVDQKMQSTETETDIGTEESG 471
            I T+E  PN + I WN        + KEL F T    +S D    + E+   +      
Sbjct: 426 TINTLEE-PN-SCILWNE------HNKKELLFITETKLISSDILESNNESAEKLPVPAIN 477

Query: 472 LAKCRYELR---FTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIF 528
             K   +L+   ++QP+ EI    + ++ +C  P  ++IP+  RQ P  N+ +E+QL   
Sbjct: 478 DIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDENEDQLAYI 537

Query: 529 TDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKW 588
           T++S+E   KI + Q++ + ++ R+ EQQ     QL  T K +  +  +++ ++ Q+ K 
Sbjct: 538 TEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNKELLHNKTIKQTYDIQSTKI 597

Query: 589 DAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQ 648
                R +KL ER SKL E + +I +S ++K   I+++E + FKEI+ Q+L FN  V+ Q
Sbjct: 598 KHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVLIFNDAVNRQ 657

Query: 649 KSLQQDLSYLKRELTRIETETIQ----VDKKSQSEWNELRKMLEIDSKIIKECNEELQHA 704
           +  Q+ + +L+ EL  I  +  Q    +    + EWNEL  +L  D+KII++CN EL  A
Sbjct: 658 QEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIEDCNAELSSA 717

Query: 705 S 705
           S
Sbjct: 718 S 718

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  354 bits (909), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 234/709 (33%), Positives = 391/709 (55%), Gaps = 49/709 (6%)

Query: 16  SLSASQSPRYIFTSQNGTRIVFIQD-NIIRWYNVLTDPCYHSLSLSRHLVLDDTFH---- 70
           + + + + R++F+S +GT+IV I D   +RW       C+ + +  + L  D  F     
Sbjct: 12  AFTGNAAQRFLFSSSDGTKIVSIADRGHLRW-------CHSTSTTYKSLDFDLQFEGKVE 64

Query: 71  -VISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKK 129
             +SST+ D +C +N  E+ V+EVPW YS  EN  ++    ++ +  DE        IK+
Sbjct: 65  GAVSSTTADYVCIYNRDELHVLEVPWMYSGEEN-GLKHLCHIYSHKFDENHS-----IKQ 118

Query: 130 VLFHPKSYHDSCIVVLKENDTIIMFDIL-NQQEKPII-LNKPNNSFGLDARLNDITDLVF 187
           VLFHPKSY DS I+VL  +D+I M +   N+ +K +I LN  N++ GL  R+NDI  ++F
Sbjct: 119 VLFHPKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSALGLYDRINDIQKIIF 178

Query: 188 SKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTVKR 247
           S+DGL+L  L+  EG DIF  YP LP    ++ +++  +  KSL++Y +++  T    KR
Sbjct: 179 SQDGLSLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSLLLYNNMNVNTTPQEKR 238

Query: 248 NIIKQLQFVSKLHENWDSKLNK---VDIDSEYRLVKVQGPFTINPFPNELYDYTAKNIAT 304
           NI+KQL F+ K+     +  N    + ++  Y   + QGPF++ P+PNELYD+ A +I  
Sbjct: 239 NIVKQLNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMATDINI 298

Query: 305 ISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQ-KEIESL 363
           I I    + +  I+F +G+++L L DLE  MSWD+  +  ++SL L+E++K++  +    
Sbjct: 299 IQITQNIS-LLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKF 357

Query: 364 ITLPEQMGKLYV---FSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATV 420
           +++P   GK  V      NF   VN+  W++ +++ I++SD+  L +LK +S IEN+  +
Sbjct: 358 LSIPGTYGKFVVTDNVKSNFF--VNTCDWSTILAQIIDDSDIKLLANLKVKSNIENLQQL 415

Query: 421 EGMPNLAHIYWNN---TSNLALASNK--EL--------TFQTVSVDQKMQSTETETDIGT 467
                 + IYW N   + N  ++  K  EL        T +   +DQ     E++ D+  
Sbjct: 416 -ATTFKSIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPE 474

Query: 468 EESGLAKCRYELRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEI 527
            ++GL    YE++F +PL+EI    + + +   +     IP   R  PLKN ++ENQLE 
Sbjct: 475 LKNGL----YEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSAPLKNSSNENQLES 530

Query: 528 FTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKK 587
            T +S+ +++ I+ AQ+LG     R+ +   E +RQ+++T +I     +  +  E QN K
Sbjct: 531 LTKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKFWDNFEQIREVQNTK 590

Query: 588 WDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHS 647
            D    +Q KLMER S L + +    +       NIS AE EWF EI+  +++FN YV  
Sbjct: 591 IDKVKEKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRK 650

Query: 648 QKSLQQDLSYLKRELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKE 696
             +  Q+L ++K +  +I  +   +  ++  EWN+L+++L  D KII E
Sbjct: 651 ASTNHQELEFIKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKIISE 699

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  348 bits (893), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 232/718 (32%), Positives = 382/718 (53%), Gaps = 55/718 (7%)

Query: 11  PIFQA-SLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDDTF 69
           PIFQA SL  S+S R    +++ +R + ++ N ++W  ++  P Y  + L+    + +  
Sbjct: 7   PIFQARSLGESRSERLCLHTKDLSRTILLEGNSLKWC-LMDAPNYEYMELN---AISNYT 62

Query: 70  HVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKK 129
             + + SG LLC  N  EI V+ + W  +  E+  I+    V                K+
Sbjct: 63  SAVLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGV----------------KQ 106

Query: 130 VLFHPKSYHDSCIVVLKENDTIIMFDILNQ--QEKPIILNKPNNSFGLDARLNDITDLVF 187
           VL+HP+   DSC+ VL + D I+++++L++       +LN   N  G+ + + DI  + F
Sbjct: 107 VLWHPRGRLDSCLTVLNKRDEILLYELLSEDFSAPTTVLNASTNELGMGSSVKDIESVCF 166

Query: 188 SKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTVKR 247
           S DGLTLY ++ +EG D+F+ YP +PS L +    L +  NK+L+ Y+ L       +K 
Sbjct: 167 SADGLTLYLMSVSEGADVFSIYPCMPSELSITRKALKYNFNKALLQYQELSEGDSPELKL 226

Query: 248 NIIKQLQFVSKL----HENWDSKLNKVD---IDSEYRLVKVQGPFTINPFPNELYDYTAK 300
              +QL F+S L    H+  DS+ N +    I   YR  + QGPFTI+PFP +LY  TAK
Sbjct: 227 KATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFPEKLYLATAK 286

Query: 301 NIATISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWDVGNYVYNDSLVLIERVKMQKEI 360
            I  I+++++  E+  I+FDD +++    DL   MSW+       +SL+ +  +K+   I
Sbjct: 287 QIKAIALEDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSLISVGSLKLPGSI 346

Query: 361 ESLITLPEQMGKLYVF-SKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIAT 419
            SLI      G  +V  S      VN +  T +I + +++ D   L +   E   E I  
Sbjct: 347 -SLI-----YGSCFVLISAEKAAVVNLSRLTRSIERSLDDCDATELSE---EDLTEEITE 397

Query: 420 VEGMPNLAHIY-WNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYE 478
            +G    A ++  +    + L S KE+T    S+D  + S +T     TE+   ++   +
Sbjct: 398 KKGTFQSAGLWPESGMQKIVLLSEKEIT----SID--ISSMQTPASSTTEKIEKSETNRQ 451

Query: 479 LRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQK 538
             ++QPLSE+ TLN+  Q    SP   +IP+  RQ  L N  +E+QL + TD+SKE L +
Sbjct: 452 RPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLTDISKEVLSR 511

Query: 539 IAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKL 598
           +  AQ+LG+S++ R+  QQ EL + L+   ++ +K   +     +Q  +W+A   +   +
Sbjct: 512 VTLAQTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWEAIQEKNKSI 571

Query: 599 MERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYL 658
             RF  L  N+++ISKS++ + + I+ AEMEWFKE+RNQ+++FN  VH Q+ L + LS L
Sbjct: 572 ALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQDLAEALSSL 631

Query: 659 KRELTRIETETIQVDKKSQSE--------WNELRKMLEIDSKIIKECNEELQHASQQL 708
           K  L  +  ++ +   +S+          W+EL+ ML  DS+IIKEC  ELQ  +Q+L
Sbjct: 632 KLSLEYVRVDSAEAASRSKKSAESAGGVPWDELQAMLAKDSRIIKECQAELQCTTQEL 689

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  318 bits (816), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 216/709 (30%), Positives = 367/709 (51%), Gaps = 55/709 (7%)

Query: 11  PIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDDTFH 70
           PIFQ     + S  ++   +N T+IV   D  +R+  V      H+   S+HL +  + H
Sbjct: 7   PIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTE----HTFK-SKHLDIKHSEH 61

Query: 71  VISSTSGDLLCFF--NDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIK 128
            I + SG L+ F+  ND E+F M+                      S    ELG    IK
Sbjct: 62  SILNNSGTLIAFYGSNDVELFDMDG-------------------KKSCLRVELG----IK 98

Query: 129 KVLFHPKSYHDSCIVVLKENDTIIMFDIL--NQQEKPIILNKPNNSFGLDARLNDITDLV 186
           +VL+HP +Y DSC+VVL + +TI ++++   N     ++LN+     G+ + +++I  + 
Sbjct: 99  QVLWHPLAYLDSCLVVLTKENTIELYELAKANFMYPTVVLNEKLPQLGISSHVSEICSMA 158

Query: 187 FSKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTVK 246
           FS DGLTLY L+  EGGD++A +P LPS L +  +       K+  +YES+D  T    K
Sbjct: 159 FSPDGLTLYLLSLEEGGDVYALHPLLPSRLRIKRSFWESQWYKATALYESIDKDTPNEKK 218

Query: 247 RNIIKQLQFVSKLHE--NWDSKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAKNIAT 304
             +I+   FVSK+++  + DS+   V+I    R+V  +GPF+I  FP ELY+ TA  + T
Sbjct: 219 IAMIEHFDFVSKIYKMIDKDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNTTATKLIT 278

Query: 305 ISIDNQQNEIFCISFDDGSLILLLKDLEMSMSWD--VGNYVYNDSLVLIERVKMQKEIES 362
           + ++++   +  +SFDDG+++ L  D+E+ MSW   + N     S VLIE+ +   EI +
Sbjct: 279 LPVNDEGAYVLILSFDDGTILSLFPDIELLMSWSRSLNNAC---SFVLIEKFRAGGEIFA 335

Query: 363 LITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATVEG 422
           + +       + +  KN  + V    +   + +CI E D+ P+ D+K  S I  +A    
Sbjct: 336 IES------GVAILEKNNAHIVR-FPYLKALGECIKEGDIAPMVDVKLTSDITPLAGSYH 388

Query: 423 MPNLAHIYWNNTSNLALASNKELTFQTVSVDQKMQSTETETDIGTEESGLAKCRYELRFT 482
                 + WN  S   +        +++  D  + S +   D    ++G    +Y + F 
Sbjct: 389 ----TVVTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKPRVDPAISQNG----KYTVCFP 440

Query: 483 QPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIAKA 542
             + E+L  N+  Q     P   ++P   + +PL +E +E+QL   T +S E + +I  A
Sbjct: 441 STMEELLKTNKALQHTLRQPL-PLVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIILA 499

Query: 543 QSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKLMERF 602
           QSLG  +YNR   QQ EL RQL++  K+  + V L++  ++   + D+   +   L  R 
Sbjct: 500 QSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSRL 559

Query: 603 SKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYLKREL 662
            KL ++L ++++S KF E  +S  E  WF+E++N +L FN YV     L ++L++LK+EL
Sbjct: 560 EKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNFLKKEL 619

Query: 663 TRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQLTTK 711
             IE+    +  +    + +L+ +L +DSK+I +CN++L  A++ L  K
Sbjct: 620 ELIESNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDLENK 668

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  272 bits (696), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 211/715 (29%), Positives = 347/715 (48%), Gaps = 65/715 (9%)

Query: 11  PIFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTDPCYHSLSLSRHLVLDDTFH 70
           PIF A    +    +  T  +GT+IV   +  +R     T+  Y S     H  +D    
Sbjct: 7   PIFNADALGASHRLHAHTHGDGTKIVGYYNKHLR-LGRFTEQTYKSW----HAEVDAKAS 61

Query: 71  VISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKKV 130
            I + SG LL F+ D  I                     +V      +  L     IK+V
Sbjct: 62  SILNGSGSLLAFYGDHII---------------------EVVDREGKKITLTVNGGIKQV 100

Query: 131 LFHPKSYHDSCIVVLKENDTIIMFDILNQQ--EKP-IILNKPNNSFGLDARLNDITDLVF 187
           L+HP +Y DSC+VVL   +TI +++ LN+   EKP ++LN+P +  G+ +R+ DIT++ F
Sbjct: 101 LWHPLAYLDSCLVVLTGQETIEIYE-LNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAF 159

Query: 188 SKDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLSWILNKSLVMYESLDPTTDVTVKR 247
           + DGL+LY  +T+EGGD+    P LPS +  +    +   NK+  +Y +L   T    K 
Sbjct: 160 APDGLSLYLFSTSEGGDVHVICPLLPSRIKADRAKWARQWNKATALYSTLTKDTPDDAKV 219

Query: 248 NIIKQLQFVSKLHENWD--SKLNKVDIDSEYRLVKVQGPFTINPFPNELYDYTAKNIATI 305
             I+ L+FV++L +  +      ++ I    R    QGP+ I+ FP +LY      +  +
Sbjct: 220 ATIEYLEFVTQLLQAIEKNGSDGELVIPEHRRRTISQGPYNIHGFPEKLYSAVGTKLTVV 279

Query: 306 SIDNQQNEIFCISFDDGSLILLLKDLEMSMSW--DVGNYVYNDSLVLIERVKMQKEIESL 363
            +   +  +  +SFDD + ILL    E+ MSW  D+ N     +L+L+E      E  + 
Sbjct: 280 PLGESEAHLLLLSFDDSTNILLFPSTEVLMSWTKDLKNAY---TLMLVE------EFTAT 330

Query: 364 ITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATVEGM 423
            T       + V   +   +V    +   +  CI + +L  L D+ F S I  I      
Sbjct: 331 GTAFATCDGVAVLGIDSAQRVE-IPYLQALEDCIRDCNLAALQDINFTSSICKI------ 383

Query: 424 PNLAH--IYWNNTSNLALASNKELTFQTVSVDQKMQS-TETETD--IGTEESGLAKCRYE 478
           P   H    +N   N  +    +   + V   +  +S TETE D   G E +      Y 
Sbjct: 384 PGKFHSVARFNAPGNKGIILVGDHHAKIVPSTEAAKSDTETELDSQPGKEPT------YT 437

Query: 479 LRFTQPLSEILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQK 538
           + F   L EIL  N+  QR    P   ++P   + IPL ++ +E  L   T++SKE + +
Sbjct: 438 VCFPNSLEEILNTNKELQRRKHQPLP-LVPPALKNIPLNSDLNEQHLATLTNISKEVMDR 496

Query: 539 IAKAQSLGVSIYNRIHEQQLELTRQLQSTCKIISKDVDLRKKFEAQNKKWDAQIIRQSKL 598
           I  +QS G+ ++NR+  QQ EL RQ+++   I S+   LR   EA + +  + + R  +L
Sbjct: 497 IILSQSAGLLMHNRLSLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRL 556

Query: 599 MERFSKLTENLSEISKSNKFKEKNISNAEMEWFKEIRNQILQFNCYVHSQKSLQQDLSYL 658
            +R   L   L+ I+ S+KF +  +S  E +WF+E++NQ + FN YV     L+ +L++L
Sbjct: 557 KQRLCMLQSTLNRINSSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFL 616

Query: 659 KRELTRIETETIQVDKKSQS--EWNELRKMLEIDSKIIKECNEELQHASQQLTTK 711
           K EL  +  E  Q D++ +   ++  L+++L++DSKII EC + L  A+++L  K
Sbjct: 617 KNELESL-PEHRQHDRQEEEPFDFRRLQELLKLDSKIITECTDNLSAAARELERK 670

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score =  213 bits (543), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 207/741 (27%), Positives = 349/741 (47%), Gaps = 109/741 (14%)

Query: 12  IFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTD--PCYHSLSLSRHLVLDDTF 69
           IFQ     S +P       N   I   QDNI+R   V +D    Y S ++    V +   
Sbjct: 12  IFQ---EVSLNPSDRLVCNNSNTIYLWQDNILR---VQSDHETQYRSYNVELPFVPE--- 62

Query: 70  HVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKK 129
            ++ S SG L+ F  + E++VMEV       E   ++  F         T LG    IKK
Sbjct: 63  QMVISPSGGLVAFHANSELYVMEVN------EQSRLRKHFN--------TSLG----IKK 104

Query: 130 VLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPI-ILNKPNNSFGLDARLNDITDLVFS 188
           +L+HP + +    V+L ++ TI ++D+ + + + I + N+ + SFGL   +  + D+ F 
Sbjct: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164

Query: 189 KDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLS-------------WILNKSLVMYE 235
             GLTLY L++    DI+A +P LP    L  ND S             ++L+KSL +Y 
Sbjct: 165 PTGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYN 224

Query: 236 SLD----------PTTD---VTVKRNIIKQLQFVSKLHENWDSKLNKVDI--DSEYRLVK 280
           SLD          P  +   +T+K +++KQ+QF     +N     + +D       R   
Sbjct: 225 SLDKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYKKN-----DGIDTFTSKAIRNSV 279

Query: 281 VQGPFTINPFPNELYDYTAKNIATISI--DNQQNEIFCISFDDGSLILLLKDLEMSMSWD 338
            QGPF I  FP  L    AK +  ++I    ++  +  + F DG+ ++L  D E+ MSW 
Sbjct: 280 PQGPFIIKKFPTAL---NAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWS 336

Query: 339 V-GNYVYND-SLVLIERVKMQKEIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKC 396
           +  N  +N+ S++ +   K Q ++     L     KL VF+ +    +    W   +++C
Sbjct: 337 LRSNTTFNNLSVITMFNAKGQCQL-----LNSSEPKL-VFTGDSSTTIMEMPWLEPLAQC 390

Query: 397 INESDLNPLGDLKFESKIENI-ATVEGMPNL--AHIYWNNTSNLALASNKELTFQTVSVD 453
           I   D + + D+KFE+KI  +  T  G+ +     I +N  S   + SN + T Q     
Sbjct: 391 IRLHDFSIIDDVKFENKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDKSTTQ----- 445

Query: 454 QKMQSTETETDIGTEESGLAKCRYELRFTQP-----LSEILTLNENFQRACISPCEQIIP 508
           + +  T+             + +Y  + + P     L  +LT  +      IS     IP
Sbjct: 446 KPINRTD-------------EVKYTYKPSLPTSGKELDMLLTKYKTEANGFISG----IP 488

Query: 509 STDRQIPLKNEASENQLEIFTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTC 568
            +   +PLKN ++E QLE+ +++ KE ++++   Q +   ++N+ +E+  EL RQL+ T 
Sbjct: 489 DSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTN 548

Query: 569 KIISKDVDLRKKFEAQNKKWDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEM 628
           +I      L        +++     +   L +R  KL E  S I  + K +  +IS AE+
Sbjct: 549 EIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAEL 608

Query: 629 EWFKEIRNQILQFNCYVHSQKSLQQDLSYLKRELTRIETETIQVDKKSQSEWNELRKMLE 688
            WFK I+NQ+L+FN YVH    L+++L +L    T++ + T   D  S+ E++ L++ML 
Sbjct: 609 VWFKSIKNQVLKFNNYVHLTNKLREELEFLD---TQLRSTTKGDDFFSELEFSSLQQMLL 665

Query: 689 IDSKIIKECNEELQHASQQLT 709
            D K+I  C  EL  + + L 
Sbjct: 666 NDKKVINSCMNELSASIEDLA 686

>ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar to
           uniprot|Q04660 Saccharomyces cerevisiae YMR049C ERB1
           Protein required for maturation of the 25S and 5.8S
           ribosomal RNAs homologous to mammalian Bop1
          Length = 802

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 54/123 (43%), Gaps = 18/123 (14%)

Query: 266 KLNKVDIDSEYRLVKVQGPFTINPFP---NELYDYTAKNIATISIDNQQNEIFCISFDDG 322
           + NK++ID E  + K+  P  + PFP   + +Y      I T+SID           DDG
Sbjct: 401 RRNKLNIDPESLIPKLPSPKDLRPFPIRCSTVYAGHQGRIRTLSID-PSGLWLATGSDDG 459

Query: 323 SLILLLKDLEMSMSWDV--GNYVYNDSLVLIERVKMQKEIESLITLPEQ-MGKLYVFSKN 379
           ++ +          W++  G  VY   L+  E  K Q  IE L   PE+  G L V +  
Sbjct: 460 TVRI----------WEILTGREVYKVQLIDTEE-KSQDHIECLEWNPEKDTGILAVAAGE 508

Query: 380 FVY 382
            +Y
Sbjct: 509 TIY 511

>NCAS0A04450 Chr1 complement(897030..898109) [1080 bp, 359 aa] {ON}
           Anc_2.458 YKL114C
          Length = 359

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 4/79 (5%)

Query: 487 EILTLNENFQRACISPCEQIIPSTDRQIPLKNEASENQLEIFTDVSKEFLQKIAKAQSLG 546
           EI   N+N ++   +P   I+P     I L N      LE      + FL  + + +SLG
Sbjct: 58  EIAKFNDNCEKFNYNPLTDILPHGHYLINLANP----DLEKVDKSYESFLDDLKRCESLG 113

Query: 547 VSIYNRIHEQQLELTRQLQ 565
           + +YN      L+  RQ+Q
Sbjct: 114 IGLYNFHPGSVLKGDRQVQ 132

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 37/77 (48%), Gaps = 4/77 (5%)

Query: 79   LLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKKVLFHPKSYH 138
            LL FF D + + +E P    + E  SI D F +  +  + TE+  K L K+V+   K  H
Sbjct: 1147 LLDFFEDDDYYYIETPV---HGETGSI-DLFDLIEFKTNMTEIEAKLLFKQVVSGVKHLH 1202

Query: 139  DSCIVVLKENDTIIMFD 155
            D  IV     D  I+ D
Sbjct: 1203 DQGIVHRDIKDENIIVD 1219

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 37/77 (48%), Gaps = 4/77 (5%)

Query: 79   LLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKKVLFHPKSYH 138
            LL FF D E + +E P    + E  SI D F +  ++ + TE   K L K+V+   K  H
Sbjct: 1192 LLDFFEDDEYYYIETPV---HGETGSI-DLFDLIEFTSNMTEFEIKLLFKQVVSGVKHLH 1247

Query: 139  DSCIVVLKENDTIIMFD 155
            D  IV     D  I+ D
Sbjct: 1248 DQGIVHRDIKDENIIVD 1264

>TPHA0H02090 Chr8 (493355..494356) [1002 bp, 333 aa] {ON} Anc_6.292
          Length = 333

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 316 CISFDDGSLILLLKD--LEMSMSWDVGNYVYNDSLVLIERVKMQKEIESLITLPEQMGKL 373
           C+S D  S IL   D    + + W  GN VY DSL +  +  +  E E LIT+   +   
Sbjct: 70  CLSIDPQSFILKKTDQVSRIQLVWCHGNVVYCDSLTIDSQNIVGFETEPLITVDFDVSAY 129

Query: 374 YV 375
           YV
Sbjct: 130 YV 131

>NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86
          Length = 1082

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 79  LLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKKVLFHPKSYH 138
           LL FF D+E + ME P   ++ E  SI D F +     + TE   K + K+V+   K  H
Sbjct: 893 LLDFFEDEEYYYMETP---AHGETGSI-DLFDLIELKKNMTEYEEKLIFKQVVSGLKHLH 948

Query: 139 DSCIV 143
           D  IV
Sbjct: 949 DQGIV 953

>Ecym_3157 Chr3 (294832..298155) [3324 bp, 1107 aa] {ON} similar to
           Ashbya gossypii AFR416C
          Length = 1107

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 46/101 (45%), Gaps = 14/101 (13%)

Query: 358 KEIESLITLPEQMGKLYVFSKNFVYQV-------------NSTSWTSTISKCINESDLNP 404
           K ++S   +P++ G L    K F+ ++             N    +S    CI  + L  
Sbjct: 762 KILKSEYRVPKEYGALDFEGKEFIPELRLWLDSEEVNRATNFDGTSSNAQHCIPRTHLGK 821

Query: 405 LGDLKFESKIENIATVEGMPNLAHIYWNNTSNLALASNKEL 445
           L  L+F+  ++NIA++  + ++  + W NT+ L     KE+
Sbjct: 822 LSHLEFKEVLQNIASLPELEDILSVIW-NTNKLTAIRQKEI 861

>Ecym_8108 Chr8 (230588..232636) [2049 bp, 682 aa] {ON} similar to
           Ashbya gossypii AEL128C
          Length = 682

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 648 QKSLQQDLSYLKRELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQHASQQ 707
           ++ L  DL Y KR+  R+E E  +++KK Q E   L+K LEI+ +   E  + ++ A++Q
Sbjct: 507 KRPLDPDL-YEKRKRRRMEWEKQELEKKKQEEVRYLKKKLEIEKQKKSELQQIIEEANKQ 565

>CAGL0G03641g Chr7 (351476..352723) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P38174 Saccharomyces cerevisiae
           YBL091c MAP2 methionine aminopeptidase
          Length = 415

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 652 QQDLSYLKRELTRIETETIQVDKKSQSEWNELRKMLEIDSKIIKECNEELQ 702
           QQD + L+R  T  E   +  D + QSEWN++RK  EI  ++ K    +L+
Sbjct: 70  QQDFN-LER-TTDAEKRYLARDMEKQSEWNDVRKGAEIHRRVRKNVQNKLK 118

>KNAG0I01020 Chr9 (196336..197925) [1590 bp, 529 aa] {ON} Anc_8.298
           YDR131C
          Length = 529

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query: 375 VFSKNFVYQVNSTSWTSTISKCINESDLNPLGDLKFESKIENIATVEGMPNL-----AHI 429
           +F ++ + Q++  SW  T    IN  D+  LGD  +   +E+ + V   PN+     + +
Sbjct: 239 IFDRHMLKQLSLVSWYDTEDADINMYDVWQLGDFFYFPNVEDCSLVSLYPNVTFLKDSGL 298

Query: 430 YWNNTSNLAL 439
            W N   L +
Sbjct: 299 NWRNMKRLKV 308

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,381,684
Number of extensions: 3622731
Number of successful extensions: 15814
Number of sequences better than 10.0: 464
Number of HSP's gapped: 16449
Number of HSP's successfully gapped: 576
Length of query: 713
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 596
Effective length of database: 40,065,477
Effective search space: 23879024292
Effective search space used: 23879024292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)