Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.832.293ON49149124740.0
Smik_9.892.293ON49149124120.0
YIL090W (ICE2)2.293ON49149124020.0
Suva_9.1092.293ON49149123720.0
NCAS0B062202.293ON48648717010.0
NDAI0B035202.293ON50149516620.0
TDEL0G022302.293ON48848816570.0
CAGL0D04202g2.293ON49950516070.0
ZYRO0A02024g2.293ON48648115850.0
KNAG0A053902.293ON49749315510.0
KAFR0J013302.293ON49149215490.0
SAKL0E07524g2.293ON47949114590.0
KLTH0G10516g2.293ON47448613870.0
Kpol_1003.422.293ON49048813820.0
Kwal_27.115002.293ON47548813710.0
Ecym_33322.293ON51351712011e-161
ADL208W2.293ON50250611881e-159
KLLA0E08207g2.293ON48649411601e-155
TPHA0C034402.293ON57954111371e-150
TBLA0B069902.293ON53653011011e-145
TBLA0B059802.293ON49349910871e-144
KLLA0F01012gna 1ON55643714.1
Skud_16.4443.493ON17357668.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.83
         (491 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   957   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   933   0.0  
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   929   0.0  
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   918   0.0  
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   659   0.0  
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   644   0.0  
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   642   0.0  
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   623   0.0  
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   615   0.0  
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   602   0.0  
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   601   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   566   0.0  
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   538   0.0  
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   536   0.0  
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   532   0.0  
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   467   e-161
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   462   e-159
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   451   e-155
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   442   e-150
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            428   e-145
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   423   e-144
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...    32   4.1  
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...    30   8.9  

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/491 (95%), Positives = 471/491 (95%)

Query: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLS               NVL
Sbjct: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120
           AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD
Sbjct: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
           SLNSNQINYVL     RFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360
           NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI
Sbjct: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420
           NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTIL
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTIL 480

Query: 481 VYATELIGSGS 491
           VYATELIGSGS
Sbjct: 481 VYATELIGSGS 491

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/491 (92%), Positives = 469/491 (95%)

Query: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MTSLSKSFMQSGR+CAACFYLLFTLLSIPISFKVGGLECGLS               NVL
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120
           A+R+GGKLYIFLT+CLYYSQHF+IASLLYLFLSGFSNDELGNVLK R NESESFL+ALK+
Sbjct: 61  ARRYGGKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRPNESESFLEALKN 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
           SLNSNQINYVL     RFVVQPWQF+LTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL
Sbjct: 121 SLNSNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360
           NV+LKNAEMLWGSFIPRGRKKTGDFHDK+IS+LSFEKVSLIS+PFWKFFKNFTFSVPLSI
Sbjct: 301 NVILKNAEMLWGSFIPRGRKKTGDFHDKLISVLSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420
           NEFCQVTIKMASESVSPAIV+NLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIM+GLYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG++QPEIIVDSWGFWNWCNIFCTIL
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGSDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 481 VYATELIGSGS 491
           VYATELIGSGS
Sbjct: 481 VYATELIGSGS 491

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/491 (92%), Positives = 466/491 (94%)

Query: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MTSLSKSFMQSGR+CAACFYLLFTLLSIPISFKVGGLECGLS               NVL
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120
           A+RHGG+LYIF TNCLYYSQHF+IASLLYLFLSGFSNDELGNVLKN+ NESESFL+ALK+
Sbjct: 61  ARRHGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKNKYNESESFLEALKN 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
           SLNSNQINYVL     RFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSNTWIISSLL SGGVITASLYYLYRIYVTPIWPLSIQTASLLG VLSMVCGLGLYGIVS
Sbjct: 181 NSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVS 240

Query: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           QKGSVIESSLFFAYIVRCIYEISPKLATTATDEIL+LFKDVWQKHQRNLPTADNLLCYFH
Sbjct: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360
           NV+LKNAE+LWGSFIPRGRKKTGDFHDK+ISILSFEKVSLIS+PFWKFFKNFTFSVPLSI
Sbjct: 301 NVILKNAEVLWGSFIPRGRKKTGDFHDKLISILSFEKVSLISKPFWKFFKNFTFSVPLSI 360

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420
           NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIM+GLYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG +QPEIIVDSWGFWNWCNIFCTIL
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGVDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 481 VYATELIGSGS 491
           VYATELIGSGS
Sbjct: 481 VYATELIGSGS 491

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  918 bits (2372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/491 (91%), Positives = 465/491 (94%)

Query: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MTSLSKSFMQSGR+CAACFYLLFTLLSIPISFKVGGLECGLS               NVL
Sbjct: 1   MTSLSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVL 60

Query: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120
           A+R+GG+LYIFLT+CLYYSQHFVIASLL+LFLSGFSNDELGNVLKNRSNESESFL+ALK+
Sbjct: 61  ARRNGGRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRSNESESFLEALKN 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
           SLNSNQINYVL     RFVVQPWQF+LTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL
Sbjct: 121 SLNSNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS
Sbjct: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240

Query: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           Q+GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH
Sbjct: 241 QRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300

Query: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360
           NV+LKNAE+LWGSFIPR RK T D H+KIISILSFEKVSLIS+PFW+F KNFTFSVPLSI
Sbjct: 301 NVILKNAEVLWGSFIPRRRKTTSDLHEKIISILSFEKVSLISKPFWRFCKNFTFSVPLSI 360

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420
           NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIM+GLYW
Sbjct: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMKGLYW 420

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG +QPEIIVDSWGFWNWCNIFCTIL
Sbjct: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPDQPEIIVDSWGFWNWCNIFCTIL 480

Query: 481 VYATELIGSGS 491
           VYATEL+GSGS
Sbjct: 481 VYATELVGSGS 491

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/487 (65%), Positives = 392/487 (80%), Gaps = 9/487 (1%)

Query: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAKR 63
           +S SF++  R+C+A FYLLFTL+SIPISFK+GGL CGL+               ++ A++
Sbjct: 2   ISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARK 61

Query: 64  HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSL- 122
           +G +++I LTN LYY QHF+IASLLYLFLSGFSN++L ++L++ +   +S  D  K ++ 
Sbjct: 62  YGSRIHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKNVA 121

Query: 123 NSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182
           +S Q N+VL     RF VQPWQF+L+ STPFFTLSEGFFTILAIQA+GETN+WL  ++NS
Sbjct: 122 SSTQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINS 181

Query: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQK 242
           NTW+ISSLLASGGVITASLYYLYRIYVTPIW LS+QTASLLGF LS+V GLG+YGIV+ K
Sbjct: 182 NTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDK 241

Query: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302
           GSVIESS+FFAYIVRCIYEISPKLATTAT+EIL++FK+VWQ+HQ NL + +NLL Y+HNV
Sbjct: 242 GSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNV 301

Query: 303 VLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINE 362
           VLKN E +W SF      K  D  +  I+  S E+V  I  P WK  K FT +VP SINE
Sbjct: 302 VLKNIETIWESF------KIND--NSFITSFSTERVITIFMPIWKLLKTFTITVPSSINE 353

Query: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYS 422
            C VT KMA ES+SPA+++NLCFRVL+FYSATRIIPALQR++D +LRKSRRIM+ LYWYS
Sbjct: 354 LCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRRDDNELRKSRRIMKVLYWYS 413

Query: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTILVY 482
           PCILIAMY HLILQYSGELK +LC+WGC+ K F ++QP+IIVDSWGFWNWCNIF TILVY
Sbjct: 414 PCILIAMYAHLILQYSGELKDELCLWGCNSKIFPSDQPKIIVDSWGFWNWCNIFFTILVY 473

Query: 483 ATELIGS 489
           A+ELIG+
Sbjct: 474 ASELIGT 480

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/495 (64%), Positives = 387/495 (78%), Gaps = 7/495 (1%)

Query: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAKR 63
           +S SFM+  R  +A FYLLFTL+SIPISFK+GGL+CGL+               ++LA++
Sbjct: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61

Query: 64  HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSLN 123
           +G    IFLT  LYYSQH +IASLLYLFLSGFS+++L   L + + + +   D ++ +L+
Sbjct: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNLS 121

Query: 124 SNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183
           S   N+ L      F VQPW+++L+ STPFFTLSEGFFTILAIQAVGETN+WL N++NSN
Sbjct: 122 STNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLVNEINSN 181

Query: 184 TWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKG 243
           TWIISSLL SGGVITASLYYLYRIYVTPIW LSIQTASLLGF LS+V GLGLYGIV++KG
Sbjct: 182 TWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYGIVTEKG 241

Query: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVV 303
           SVIESSLFFAYIVRCIYEISPKLATTATDEIL++FK+VWQ+HQ NLPT DNLL Y++N V
Sbjct: 242 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLFYYNNFV 301

Query: 304 LKNAEMLWGSFI-------PRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSV 356
           L++ +MLW   +       P     +    + + + LS + +  I +P WK FKNFT SV
Sbjct: 302 LRHIDMLWELLVSKINQNDPNNTLPSSFNINFLTTFLSKDLLLRICKPIWKLFKNFTVSV 361

Query: 357 PLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMR 416
           P SI+E   VT +MA ESVSPA+VINLCFRVL+FYSATRIIPALQR+ND +L+KSRRIM+
Sbjct: 362 PSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRRNDSELKKSRRIMK 421

Query: 417 GLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIF 476
            LYWYSPC+LIAMYTHLILQYSGELKKDLC+WGC+ KW    QPE+IVDSWGFWNWCNIF
Sbjct: 422 ILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLIPNQPELIVDSWGFWNWCNIF 481

Query: 477 CTILVYATELIGSGS 491
            TI++YA+EL G+ +
Sbjct: 482 FTIIIYASELFGTTA 496

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/488 (65%), Positives = 382/488 (78%), Gaps = 3/488 (0%)

Query: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MT++SKSF+Q  R+  A FYLL TL++IPISFKVGGL CGLS               +++
Sbjct: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60

Query: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120
           A+ +G K YI  T  +YY QHF+IASLLYLFLSGFSN+EL  VL++ S   +S ++ L++
Sbjct: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPEQSLVNVLRN 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
           ++ SN  +++L     R+VVQPWQ VLT ST FF LSEGFFT+L IQA+GETNRWL +++
Sbjct: 121 NVFSNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWLLDEM 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSNTWII+SLL SGGVITASLYYLYRIYVTPIW LS+QTASLLGF LS+VCG+GL+GIVS
Sbjct: 181 NSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLFGIVS 240

Query: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           + GSVIESSLFFAYIVRCIYEISPKLATTATDEIL++ K  WQKHQ+NL T +NLL Y+ 
Sbjct: 241 KNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLLSYYQ 300

Query: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360
           +VVLKNAEM+W S + R +           +I    K+     P WKFFK F  SVP SI
Sbjct: 301 DVVLKNAEMVWESIVLRTKNSDA---TTFTAIQPLNKLWHAFTPIWKFFKGFVLSVPSSI 357

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420
               QVT+K+ASESVSPAIV+NLCFRVL+FYSATRIIPALQRKN ++LRKSRRIM  LYW
Sbjct: 358 GGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQRKNTRELRKSRRIMNVLYW 417

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGEL  DLC+WGCSEKWFG+ QP+I +++W FWNWCNIF T+L
Sbjct: 418 YSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGSGQPKIEINTWVFWNWCNIFWTVL 477

Query: 481 VYATELIG 488
           +Y +ELIG
Sbjct: 478 IYGSELIG 485

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/505 (62%), Positives = 381/505 (75%), Gaps = 25/505 (4%)

Query: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           M  +++   +S R+ +A  YL+ TL+SIPISFK+GGL+CGLS               +VL
Sbjct: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60

Query: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESE-----SFL 115
           A+R   + Y+F T+ LYYSQH VIA LL+LFLSGFSN+E    L    +  E     SFL
Sbjct: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120

Query: 116 DALKDSL-----NSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVG 170
           D LK  +       N  N+ L     +F+VQPWQ++L+ STPFFTL EGFFTILAIQA+G
Sbjct: 121 DLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAIG 180

Query: 171 ETNRWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMV 230
           ETN+WLS ++NSNTWII+SLL SGGVIT SLYYLYRIYVTPIW L+IQ+ASLLGFVLS+V
Sbjct: 181 ETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSIV 240

Query: 231 CGLGLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLP 290
             LGLYGI+S+KGSVIESSLFFAYIVRCIYEISPKLAT AT+EILDL KDVWQ HQRNL 
Sbjct: 241 FCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNLL 300

Query: 291 TADNLLCYFHNVVLKNAEMLWGSFI-PRGRKKTGDFHDKIISILSFEKVS--LISRPFWK 347
             DNLL Y+HNVVLKNAEM+W SFI PR R           S+ + EK+   L   P WK
Sbjct: 301 NRDNLLAYYHNVVLKNAEMVWESFILPRSR-----------SLNAMEKIRFWLDVTPVWK 349

Query: 348 FFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQ 407
           FFKNFT SVP SI E   VT KMASES+SPA+++NLCFR+L+FYSATRIIPALQR + K+
Sbjct: 350 FFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPALQRSSYKE 409

Query: 408 LRKSRRIMRGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGA-EQPEIIVDS 466
            R+SRRI++ LYWYSPC+LIAMYTHLILQYSGELK++LC+WGC+  WFG+ +QP I+ DS
Sbjct: 410 QRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSKDQPRIVTDS 469

Query: 467 WGFWNWCNIFCTILVYATELIGSGS 491
           W FWNWCNIF T+LVYA ELIG+ +
Sbjct: 470 WSFWNWCNIFWTVLVYANELIGTQA 494

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/481 (63%), Positives = 369/481 (76%), Gaps = 3/481 (0%)

Query: 9   MQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAKRHGGKL 68
           +QS RV  ACFYLL  L++IPISFKVGGL CGLS               ++  + +  + 
Sbjct: 5   VQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASRF 64

Query: 69  YIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSLNSNQIN 128
           Y+F T  +YYSQH +IASLLYLFLSGFSN+EL  +L++ S   +S L+ LK +  S   N
Sbjct: 65  YVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPEQSLLEVLKSNPFSAHSN 124

Query: 129 YVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIIS 188
           ++L      ++VQPWQ++L+ ST FF+LSEGFFTILAIQAVGE++RWL  ++NSN W I+
Sbjct: 125 WILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSNIWNIT 184

Query: 189 SLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKGSVIES 248
           SLL SGGVITA+LYYLYRIYVTP+W LSIQTASLLGF LS+VCGLGLYGIVS+ GSVIES
Sbjct: 185 SLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNGSVIES 244

Query: 249 SLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVVLKNAE 308
           SLFFAYIVRCIYEISPKLATTATDEIL++FK+ WQKHQRN  + +NLL Y+H+VVL +AE
Sbjct: 245 SLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVVLDSAE 304

Query: 309 MLWGSFIPRGRKKTGDF-HDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINEFCQVT 367
           M+W S + +    +  F H  +   L   K + I +P   FFKNFT SVP SI    QVT
Sbjct: 305 MMWESIVSKTVTTSDPFYHTSMFPPL--RKFTDIFKPVGIFFKNFTISVPSSIEGLFQVT 362

Query: 368 IKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYSPCILI 427
           +KMAS+SVSPAIV+NL FRVL+FYSAT+IIPALQ K D+QL KSRRIM  LYWYSPCILI
Sbjct: 363 LKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQGKGDRQLNKSRRIMNVLYWYSPCILI 422

Query: 428 AMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTILVYATELI 487
           AMYTHLILQYSGEL +DLC+WGC+  WF   Q +I+VDSWGFWNWCNIF TILVY +ELI
Sbjct: 423 AMYTHLILQYSGELNRDLCLWGCNSMWFSLNQTKIVVDSWGFWNWCNIFWTILVYGSELI 482

Query: 488 G 488
           G
Sbjct: 483 G 483

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/493 (59%), Positives = 375/493 (76%), Gaps = 8/493 (1%)

Query: 3   SLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAK 62
           +L+  F++  R+C+   YLL TL+SIPISFKVGGL CGL+               +++A+
Sbjct: 4   TLTSGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIAR 63

Query: 63  RHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSL 122
           ++G ++YI L++ LYY QHF+IASLL+LFLSGFSN EL  +++N +   ES    L  S+
Sbjct: 64  KNGNRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIENDAIPIESLTSILNVSM 123

Query: 123 NSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182
           +S++ N++      ++VV PW+FVL+ STPFFTLSEGFFTILAIQA+GETN+WL  + NS
Sbjct: 124 SSSEANWIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNS 183

Query: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQK 242
           N WIISSLL S  VI+A+LYYLYRIYVTPIW L++QTASLLGFVLS+V GLG+YGIVS  
Sbjct: 184 NAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDS 243

Query: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302
           GSVIESSLFFAYIVRCIYEISPKLATTATDE+L+LFKDVWQK Q NLP  +NL+ Y++NV
Sbjct: 244 GSVIESSLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNV 303

Query: 303 VLKNAEMLWGSFIPR-GRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSIN 361
           +LKN EM W +FI R G   T +++  ++            +P WKFFKNFT SVP SI 
Sbjct: 304 ILKNIEMAWDNFILRTGTSGTFNYNPSLL----LNNTWKFCKPIWKFFKNFTLSVPFSIR 359

Query: 362 EFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWY 421
           E   +T KM+ ESVSPA+VINLCFR+L+FYSATRI+P+LQRK+ ++ R+SR++M  +YWY
Sbjct: 360 EILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDAREQRRSRKVMELVYWY 419

Query: 422 SPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG--AEQPE-IIVDSWGFWNWCNIFCT 478
           SPCILIAMY HLILQYS ELK +LC+WGC+    G   +Q E ++VD+W FWNWCN+FCT
Sbjct: 420 SPCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETVVVDAWRFWNWCNVFCT 479

Query: 479 ILVYATELIGSGS 491
           ILVYA ELIG  +
Sbjct: 480 ILVYANELIGDTT 492

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/492 (60%), Positives = 376/492 (76%), Gaps = 8/492 (1%)

Query: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           MT LSKS ++  R+ +  FYLLFTL+SIP+SFK+GG+ CGLS               ++L
Sbjct: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60

Query: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120
           A++ G + YI LT+ +YY QH +IASLLY FLSGFSNDEL  VLK+ + + E  L A +D
Sbjct: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEKIE-VLVANQD 119

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
            + S   N++L      +VV+PW+FVL+ STPFF L+EGFFTILAIQA+GETNRWLS++ 
Sbjct: 120 LMVSES-NWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWLSDEK 178

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSN+WIISSLLAS GV+TASLYYLYRIYVTPIW LS QTA+LLG VLS+  GLG++GI+S
Sbjct: 179 NSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIHGIIS 238

Query: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
           ++GSV+ESSLFFAYIVRCIYEISPKLATTATDEIL+LFK+VWQ+HQ  LP  DN+L Y+ 
Sbjct: 239 ERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNILNYYR 298

Query: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360
           +V+LKN EM+W +F+ + ++ +   +  + S  + E   +   P WKFFKNFT SVP SI
Sbjct: 299 SVILKNTEMIWEAFLSKTKQHS---NHTLNSFFTAENFWIHFNPLWKFFKNFTISVPFSI 355

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420
           +E   + ++MASES+SPA+V+NLCFRVL+FYSATRIIP+LQRK  +  RKSRRIM+ LYW
Sbjct: 356 SELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSLQRKEVRDSRKSRRIMKVLYW 415

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEK---WFGAEQPEIIVDSWGFWNWCNIFC 477
           YSPCILIAMYTHLILQYSGELK++L +WG   K       E+  I+VDSW FWNWCNIF 
Sbjct: 416 YSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDKEENNIVVDSWSFWNWCNIFW 475

Query: 478 TILVYATELIGS 489
           TIL+Y  EL G+
Sbjct: 476 TILIYGGELFGT 487

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/491 (59%), Positives = 357/491 (72%), Gaps = 17/491 (3%)

Query: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAKR 63
           L +S +QS R C   FYLL  L++IPISF+VGGL CGLS                +++K+
Sbjct: 2   LPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSKK 61

Query: 64  HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSN-ESESFLDALKDSL 122
           +  +LY  +T+ +YY QHF+I SLL+LFLSGF+NDEL   +    N   ES ++ L++  
Sbjct: 62  YN-RLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRN-- 118

Query: 123 NSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNS 182
            S + +++      +F V+PWQFVL  STP+FTL EGFFT+L IQA+GETN+WL    NS
Sbjct: 119 KSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKNS 178

Query: 183 NTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQK 242
           NTWII SLL SGGVIT SLYYLYRIYVTP+W LSIQTASLLGF LS+VCGLGLYGIVS K
Sbjct: 179 NTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSGK 238

Query: 243 GSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNV 302
           GSVIESSLFFAYIVRCIYEISP+LAT+A DEI  + KD WQKHQ NLPT DNLL Y+ NV
Sbjct: 239 GSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLPT-DNLLSYYRNV 297

Query: 303 VLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINE 362
           VLKN EM+W + +    +KTG       S  + + V L  +P WKF KNFT SVP SI E
Sbjct: 298 VLKNGEMIWDAIV----QKTGT-----TSPSTTQMVWLRLQPLWKFTKNFTISVPSSIRE 348

Query: 363 FCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYS 422
             +VT+KMA+ESV+P +VINL FR+L+FYSATRIIPALQ+ +    + SRR+MR +YWYS
Sbjct: 349 IFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKDDSNGRKSSRRLMRLIYWYS 408

Query: 423 PCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQP--EIIVDSWGFWNWCNIFCTIL 480
           PCI+IAMYTHLILQYSGEL  DLC+WGC   W     P  +++VD+WGFWNWCN+FCT+ 
Sbjct: 409 PCIVIAMYTHLILQYSGELNNDLCLWGCFP-WSHTNDPSSKVVVDAWGFWNWCNVFCTLA 467

Query: 481 VYATELIGSGS 491
           +Y  ELIG  S
Sbjct: 468 IYGLELIGGKS 478

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/486 (56%), Positives = 348/486 (71%), Gaps = 15/486 (3%)

Query: 6   KSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAKRHG 65
           +S +QS RVC   FYLL  L++IPISF+VGGL CGLS                + A+  G
Sbjct: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63

Query: 66  GKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSLNSN 125
                 L +  YY+QHF I SLL+LFLSGFSNDEL   +   +   ES +D L+ +  S 
Sbjct: 64  ---LAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDESLIDLLRSTTQSQ 120

Query: 126 QINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTW 185
              +V      ++VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN W
Sbjct: 121 --TWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGNGSNMW 178

Query: 186 IISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKGSV 245
           +IS L+ASGGVITA+LYYLYRIYVTPIW LS+QTASLLGF  S+V GLG+YGIVS +GS 
Sbjct: 179 VISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIVSGRGST 238

Query: 246 IESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVVLK 305
           IESSLFFAYIVRC+YEISP+LAT+A DEI  L K+ W    R+L ++D LL Y+ +++LK
Sbjct: 239 IESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYYRDIILK 298

Query: 306 NAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINEFCQ 365
           N EM+W + + R     G     + +  S+ +V    +P WKF K+FT SVP SI E   
Sbjct: 299 NGEMVWDAILARTNVNVGASGTPVWA--SWNRV----QPLWKFVKHFTSSVPSSIQEIFY 352

Query: 366 VTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYSPCI 425
           +T++MA E+++PA+VINLCFR+L+FYSATRIIPALQ+K+    R+SRR MR LYWYSPCI
Sbjct: 353 LTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKKHK---RRSRRFMRMLYWYSPCI 409

Query: 426 LIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTILVYATE 485
           +IAMYTHLILQYSG++  DLC+WGC   W   + P+++VDSWGFWNWCNIFCT+ +YA+E
Sbjct: 410 VIAMYTHLILQYSGQISNDLCLWGCF-PWSVPDTPKVVVDSWGFWNWCNIFCTMAIYASE 468

Query: 486 LIGSGS 491
           L+GS S
Sbjct: 469 LLGSKS 474

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/488 (53%), Positives = 338/488 (69%), Gaps = 1/488 (0%)

Query: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           M  + K+ ++S +V   CFYLL  + +IPISFK+GGL CGL+               N++
Sbjct: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNII 60

Query: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120
           A+R G K  I +T+  +Y Q+F+I SLL+LFL+GF+N++L   +++     E+FLD L+ 
Sbjct: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPKETFLDLLRG 120

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
            +  +  N++L      + V+PWQ +L+ STP FTL EGFFTIL IQ +GE N WL ++ 
Sbjct: 121 DIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWLKHER 180

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
           NSN WIISSLL SGG+IT SLYYLYRIY TPIW LS+  A+LLGF LS+V  LG+YGIVS
Sbjct: 181 NSNIWIISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIYGIVS 240

Query: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
             GSVIESSLFFAYIVRCIYEI+P+LATTAT+E L+  K+VWQ H  NL  AD  + YF+
Sbjct: 241 HNGSVIESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFISYFY 300

Query: 301 NVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSI 360
           +     A   W  F  R     G  H+  +   S   +     P W+  K  TFSVP SI
Sbjct: 301 DSFHMQAHKFWTLFTSR-TPYYGYLHNYCMDYPSLVMIRSNFYPIWETLKTLTFSVPTSI 359

Query: 361 NEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYW 420
           +E   +T++MA +SVSPAI+INLCFR+++FYSATRIIPA+Q++   + RK R IM+ LYW
Sbjct: 360 SELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRIIPAIQKRTRSETRKIRGIMKALYW 419

Query: 421 YSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTIL 480
           YSPCILIAMYTHLILQYSGELKKDLC+WGC   WFG +Q  I VD+W FWNWCNIF TI+
Sbjct: 420 YSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFGEDQERINVDAWSFWNWCNIFWTII 479

Query: 481 VYATELIG 488
           +Y +ELIG
Sbjct: 480 IYGSELIG 487

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/488 (55%), Positives = 347/488 (71%), Gaps = 15/488 (3%)

Query: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAKR 63
           + +S +QS RVC   FYLL  L++IPI+F+VGGL CGLS                + A+ 
Sbjct: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAARA 61

Query: 64  HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSLN 123
            G   +  L +  YY+QHF I SLL+LFLSGFSNDEL + +   +   ES +D L+ S +
Sbjct: 62  RG---FAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDESLIDLLRSSTH 118

Query: 124 SNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSN 183
           S    ++       +VV+PWQF+L +STP+FTL EGFFT+L IQAVGETNRWLS    SN
Sbjct: 119 SQP--WIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRGHGSN 176

Query: 184 TWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKG 243
            W+IS L+ SGGVITA+LYYLYRIYVTPIW LS+QTASLLGF  S+V GLG++GIVS +G
Sbjct: 177 VWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGIVSGRG 236

Query: 244 SVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVV 303
           S IESSLFFAYIVRC+YEISP+LAT+A DEI +L KD W    R+L ++D  L Y+ +++
Sbjct: 237 STIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAYYRDII 296

Query: 304 LKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINEF 363
           LKN EM+W + + R            ++ +S+ +V    +P WKF K+FT SVP SI E 
Sbjct: 297 LKNGEMIWDAVLARTNVNVSG--AGPVAWISWHRV----QPLWKFVKHFTSSVPSSIQEI 350

Query: 364 CQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYSP 423
             +T+ MA E+++PA+VINLCFR+L+FYSATRIIPALQRK+    R+SRR MR LYWYSP
Sbjct: 351 FLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRKHK---RRSRRFMRMLYWYSP 407

Query: 424 CILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGFWNWCNIFCTILVYA 483
           CI+IAMYTHLI+QYSG++  DLC+WGC   W   E  +++VDSWGFWNWCNIFCT+ +YA
Sbjct: 408 CIVIAMYTHLIMQYSGQISNDLCLWGCF-PWSPPEGSKVVVDSWGFWNWCNIFCTMAIYA 466

Query: 484 TELIGSGS 491
           +EL GS S
Sbjct: 467 SELFGSKS 474

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  467 bits (1201), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 253/517 (48%), Positives = 336/517 (64%), Gaps = 37/517 (7%)

Query: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAKR 63
           LS+  ++S R   A FYL   L++IPISF+VGGL CGLS                +    
Sbjct: 2   LSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTTN 61

Query: 64  HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKDSLN 123
             GK +  L + +YY QHF+I S+L+LFLS F++D+L  ++ + +  + S     + ++N
Sbjct: 62  GSGK-FKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNVN 120

Query: 124 S-----------NQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGET 172
                       N+ +        +++V+PWQ++L  +TP+FTL+EGFFT+LAIQA+GET
Sbjct: 121 ESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGET 180

Query: 173 NRWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCG 232
            RWL    NSNTW+I SLL SG VIT S++YLYRIYVTPIWPLS+QTA+LLGF LS+V G
Sbjct: 181 GRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFG 240

Query: 233 LGLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTA 292
           LGLYGI+S KGS IESSLFFAY+VRCIYEISP+LA TA  EI  +  D WQ  Q  L + 
Sbjct: 241 LGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTL-SK 299

Query: 293 DNLLCYFHNVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFE--------KVSLI--- 341
           +NLL Y+ N  + NAE  W S + +    T    ++  +I  +         K +LI   
Sbjct: 300 NNLLTYY-NTFVSNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIILQ 358

Query: 342 ------SRPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATR 395
                  +  W F KNF+  +P SI+E   VT+KMA ES++PA++ NL FRVL+FYSATR
Sbjct: 359 TQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATR 418

Query: 396 IIPALQRKNDKQLRKSRRIMRGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKW- 454
           IIPALQ+       +SR++MR +YWYSPCI+IAMYTHLIL+YSGEL  DLCIWGC   W 
Sbjct: 419 IIPALQKATGAT--QSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFP-WL 475

Query: 455 -FGAE-QPEIIVDSWGFWNWCNIFCTILVYATELIGS 489
            F A+ + + +VD+W FWNWCN+F T+L+YA ELIGS
Sbjct: 476 NFSAKTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGS 512

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  462 bits (1188), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 326/506 (64%), Gaps = 30/506 (5%)

Query: 6   KSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAKRHG 65
           K  ++S R   A FYL   L+++PISF++GGL CGLS                + A   G
Sbjct: 4   KGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAATRG 63

Query: 66  GKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRS------------NESES 113
            + +  + + LYY QHF++ S+L+LFLSGF+ND+L   L                N +ES
Sbjct: 64  DE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMNES 122

Query: 114 FLDALKDSLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETN 173
            L  L  S +       L     R+VV+PWQ++L  +TP FTL+EGFFT+LAIQ +GET 
Sbjct: 123 LLQLLGRSRDDRATMAYLHYY--RYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180

Query: 174 RWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGL 233
           RWL    NS  W+ISSL+ SG VIT S+YYLYRIYVTPIWPLS+ TA+LLGF LS+V GL
Sbjct: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240

Query: 234 GLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTAD 293
           GLYGI+S KGS IESSLFFAY+V CIYEISP+LA TA  EI  +  + WQ  Q  LP  +
Sbjct: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP-KN 299

Query: 294 NLLCYFHNVVLKNAEMLWGSFIPRG-RKKTGDFHDKIISILSFEKVSLI-------SRPF 345
           +LL Y+ N +L NAE LW   + +     + +      S++  + + L+       S+  
Sbjct: 300 SLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQL 358

Query: 346 WKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKND 405
           W F KNF+  +P SI+E   VT+ +A ES++ A+V NL FRV++FYSATRIIPALQR   
Sbjct: 359 WSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATG 418

Query: 406 KQLRKSRRIMRGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAE--QPEII 463
               +SR++MR +YWYSPCI+IAMYTH+IL+YSGEL  +LCIWGC   W  +E  +   +
Sbjct: 419 GT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCF-PWLQSEANRDRWV 475

Query: 464 VDSWGFWNWCNIFCTILVYATELIGS 489
           VD+WGFWNWCN+F T+L+YA ELIGS
Sbjct: 476 VDAWGFWNWCNLFFTLLIYAVELIGS 501

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  451 bits (1160), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 248/494 (50%), Positives = 306/494 (61%), Gaps = 52/494 (10%)

Query: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           M  + KS +Q+ R+     YL   L++IPISF+VGGL CGLS                ++
Sbjct: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99

Query: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALKD 120
               G  L    +  +YY QH +I S+L++FLS F N +   V      +SE F      
Sbjct: 100 LLDRGSAL----STLIYYLQHLLIPSILFMFLSYFENIDSDTV------DSEYF------ 143

Query: 121 SLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDL 180
                             +V+PWQ  L  STP FTL EG FTILAIQA+GET RWL    
Sbjct: 144 ------------KVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWLKMSR 191

Query: 181 NSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVS 240
            SN W+I SLL SGG+IT SL+Y YRIYVTP+W LS  +ASLLGF  S+VCG+GLYGI +
Sbjct: 192 RSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLYGI-N 250

Query: 241 QKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFH 300
             GSV+ESSLFFAY+VR +YEISPK+A  A DEI D+ K+ W+ HQ NLP  DNLL    
Sbjct: 251 GSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL---- 306

Query: 301 NVVLKNAEMLWGSFI---PRGRKKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVP 357
            ++ KN   +W   +   PR  K           I   ++   I  P W   KNFT SVP
Sbjct: 307 ELMTKNYRAIWSQIVEHTPRNHK----------YIKMMDQCKWILNPLWNSVKNFTKSVP 356

Query: 358 LSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRG 417
           +SI E   VT KMA ES+ PA+VINL FR+L+FYSATRIIP LQR N K+ R  RRIM  
Sbjct: 357 ISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQR-NTKERRSFRRIMNF 415

Query: 418 LYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAE-QPEIIVDSWGFWNWCNIF 476
           +YWYSPCI+IAMYTHLIL+YSG+LK DLCIWGC    F  E +P+I+VDSW FWNWCNI+
Sbjct: 416 VYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC----FPYETEPKIVVDSWSFWNWCNIY 471

Query: 477 CTILVYATELIGSG 490
            T+L+YA EL+GS 
Sbjct: 472 STMLIYALELMGSN 485

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  442 bits (1137), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 247/541 (45%), Positives = 327/541 (60%), Gaps = 65/541 (12%)

Query: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAKR 63
           + +  + SG      FYLL  +++IPISFK+GG+ CGLS                ++ KR
Sbjct: 51  IPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKR 110

Query: 64  --HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVL----------KNRSNES 111
             H   L + L + L+Y Q+F+I+SLL ++L GF+N +L   L          KN +N  
Sbjct: 111 LTHNTTLRL-LASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169

Query: 112 ESFLDALKDSL----------NSNQIN----------------------YVLXXXXXRFV 139
              L  +KD              N +N                      ++L        
Sbjct: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIF 229

Query: 140 VQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLNSNTWIISSLLASGGVITA 199
           ++PW+F+L  STPFFTL EGFFTIL IQ +GETN WL    +S+ W+I SLL+SGGVITA
Sbjct: 230 IKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289

Query: 200 SLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQKGSVIESSLFFAYIVRCI 259
           +LYYL RIYVTP W L++ TAS+LGF LS+V GLG++GIVS+ GS IESSLFFAYIVRCI
Sbjct: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349

Query: 260 YEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHNVVLKNAEMLWGSFIPRGR 319
           YE+SP+LA +ATDE L+ F +VWQ +Q  +  ADN+L Y    ++ +A   + S      
Sbjct: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIM-DAFSSFSSIEHHLF 408

Query: 320 KKTGDFHDKIISILSFEKVSLISRPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAI 379
            KT +        L   K +LI + FW F KNFT +VP SIN+  Q+T +MA +S+SPAI
Sbjct: 409 PKTIE--------LGISK-NLIVKQFWVFLKNFTINVPSSINDLIQITAQMAVDSISPAI 459

Query: 380 VINLCFRVLMFYSATRIIPALQRKNDKQLRKSRRIMRGLYWYSPCILIAMYTHLILQYSG 439
           +INL FR+++FYSATRIIPA+QR+           M  +YW+SPC+LIAMYTHLILQ+SG
Sbjct: 460 IINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTHLILQFSG 519

Query: 440 ELKKDLCIWGCSEKWFGAEQP---------EIIVDSWGFWNWCNIFCTILVYATELIGSG 490
           ELKK++C+W C E W  +             IIVDSW FWNWCNIF TI++YA+ELIG  
Sbjct: 520 ELKKNICLWNC-ENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYASELIGGR 578

Query: 491 S 491
           S
Sbjct: 579 S 579

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  428 bits (1101), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 235/530 (44%), Positives = 333/530 (62%), Gaps = 47/530 (8%)

Query: 6   KSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVLAKRHG 65
           KS  QS R+   CFYL+  L++IP +FK+GGL CGLS               +++AKR  
Sbjct: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTL 65

Query: 66  GKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVL-KNRSNESESFLDALKDSLN- 123
              YI L+  +YY QH VIASLLY+F++ FS+  L  +L  N++++  S L  +K+  + 
Sbjct: 66  NNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSK 125

Query: 124 --SNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLN 181
             S   +Y+L      + VQPW ++L+ STPFFTL EGFFTIL IQA+GET  WL     
Sbjct: 126 SVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWLLLKKQ 185

Query: 182 SNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQ 241
              + + + L S GVI  ++++LY+IY   +W LSIQTASLLG  +S+V  +G++GI S 
Sbjct: 186 KKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFST 245

Query: 242 KGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHN 301
            GS+IESSLF  YI+RC YEISP+L+T+AT EILD  K+ WQ HQ ++   +++L Y++N
Sbjct: 246 NGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNN 305

Query: 302 VVLKN--AEMLWGSFIPRG-------------RKKTGDFH-------DKIISILSFEKVS 339
           V+LKN  +  L+ S   +              ++ T ++          +I ++ F+ + 
Sbjct: 306 VLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIY 365

Query: 340 ----LISRPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATR 395
               + + P ++  K+F  ++P S+    QVT K+A +SVSP+IVINLCFRVL+FYSATR
Sbjct: 366 QNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATR 425

Query: 396 IIPALQRKNDKQLRKSRRIMRGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGC----- 450
           IIPA+QRKN  + ++SR  ++  Y +SPCI+IAMYT+LILQYSGELK DLCIWGC     
Sbjct: 426 IIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISK 485

Query: 451 --SEKW------FGAEQP----EIIVDSWGFWNWCNIFCTILVYATELIG 488
             S++        G++      E IV+SWGFWNWCNIFCTI +Y  EL+G
Sbjct: 486 SISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  423 bits (1087), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 234/499 (46%), Positives = 324/499 (64%), Gaps = 20/499 (4%)

Query: 1   MTSLSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSXXXXXXXXXXXXXXXNVL 60
           M+ + K+  +S R   A  YLL  L+++PI+F++GGL+CGL+               N +
Sbjct: 1   MSQVLKNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAI 60

Query: 61  AKRHGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRSNESESFLDALK- 119
           A++   + +I  TN LYY Q+F I  +L++FLS FS+ EL   + + +   E+    LK 
Sbjct: 61  ARKLRWQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKN 120

Query: 120 -DSLNSNQINYVLXXXXXRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSN 178
            D+  S  I+++       + +  W+F L+ STP F L EGFFTILAIQ +GETN WL+ 
Sbjct: 121 NDTYPSKTISFI-YKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNIWLTT 179

Query: 179 DLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGI 238
             NS+ WII SL+ S  ++T S+YY+Y+IYVTP+W LS Q ASLL F  S+V G+ +YGI
Sbjct: 180 VKNSSIWIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVAIYGI 239

Query: 239 VSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCY 298
           VS +GSV+ESSLFFAYIV CIYEISP +ATTA D+I D  K+ WQ HQRN   +DNLL Y
Sbjct: 240 VSHRGSVVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDNLLIY 299

Query: 299 FHNVVLKNAEMLWGSFIPRGRKKTGDFHDKIISILSFEKVSLISRPF---WKFFKNFTFS 355
           ++N ++KN +      I +   K  +F +K  S+L F+ V +  + F    K  K FT  
Sbjct: 300 YYNSLIKNVDEFIKLKIIKLTTK-DNFSNKFNSLL-FQCVKISKKSFKFILKLSKRFTLG 357

Query: 356 VPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRK------NDKQLR 409
           +P SI E   +T+KMASES+SP I++NLC+RVL+FY+ATRIIPAL+ +      N+ + +
Sbjct: 358 IPSSIYELYSITLKMASESISPVILVNLCYRVLIFYAATRIIPALESRSNGFSNNNIKTK 417

Query: 410 KSRRIMRGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAEQPEIIVDSWGF 469
            + + M+ LYWYSPCILIAMYT+LILQYSGELK +  +W        +   E++VDSW F
Sbjct: 418 SNSKFMKVLYWYSPCILIAMYTNLILQYSGELKSEFKLWNN------SNNNEVVVDSWRF 471

Query: 470 WNWCNIFCTILVYATELIG 488
           WNWCNIF TI +Y +ELIG
Sbjct: 472 WNWCNIFWTITLYGSELIG 490

>KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn
          Length = 556

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 346 WKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVL 388
           W FF N+T  +PL I     +TI   +E+++P+IV+ LC+ ++
Sbjct: 125 WLFFLNWTVVLPLEIC-VASMTINFWNENINPSIVVALCYSLV 166

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 177 SNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPI-WPLSIQTASLLGFVLSMVCG 232
           + D NS+        A+ G+ T SLY ++  +  P+ WPL + T   L FV +   G
Sbjct: 30  TQDRNSSRVNFCMFAAAYGIFTDSLYGVFANFFEPLAWPLVLFTLDFLNFVFTFTAG 86

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,079,655
Number of extensions: 1984876
Number of successful extensions: 7275
Number of sequences better than 10.0: 36
Number of HSP's gapped: 7368
Number of HSP's successfully gapped: 37
Length of query: 491
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 377
Effective length of database: 40,409,475
Effective search space: 15234372075
Effective search space used: 15234372075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)