Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.822.292ON72272233590.0
Suva_9.1082.292ON72272329250.0
Smik_9.882.292ON72472529140.0
YIL091C (UTP25)2.292ON72172428740.0
NDAI0B035302.292ON73971823730.0
KAFR0J013402.292ON72872223270.0
NCAS0B062302.292ON72372123240.0
KNAG0A054002.292ON72171722930.0
SAKL0E07546g2.292ON71872722710.0
KLLA0E08229g2.292ON70471022270.0
TDEL0G022202.292ON71071522170.0
TBLA0B059702.292ON71971421980.0
Kpol_1039.462.292ON70470921680.0
Ecym_33312.292ON70871321540.0
KLTH0G10494g2.292ON74775721530.0
Kwal_27.115032.292ON72773721350.0
ZYRO0A02002g2.292ON70970821290.0
TPHA0D015202.292ON71673721280.0
CAGL0D04180g2.292ON70072421090.0
ADL209C2.292ON70456820260.0
Smik_4.4908.469ON5872721064e-04
Skud_4.5058.469ON6042941047e-04
Ecym_13958.469ON565198970.005
KLLA0C15433g8.469ON539199900.033
YDR243C (PRP28)8.469ON588308890.051
TPHA0C018608.469ON607278890.052
TBLA0C055802.164ON540115860.11
NCAS0G025602.164ON556109790.70
SAKL0H11968g8.469ON566202790.78
KLLA0F23716g2.164ON55462780.91
TDEL0F011902.164ON549115771.3
YNL112W (DBP2)2.164ON54662761.9
Ecym_54222.164ON56062751.9
Smik_14.2152.164ON54762751.9
SAKL0E10670g2.164ON574115752.0
KAFR0E028108.469ON568243743.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.82
         (722 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...  1298   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...  1131   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...  1127   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...  1111   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   918   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   900   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   899   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   887   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   879   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   862   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   858   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   851   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   839   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   834   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   833   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   827   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   824   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   824   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   816   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   785   0.0  
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...    45   4e-04
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...    45   7e-04
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...    42   0.005
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...    39   0.033
YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}  ...    39   0.051
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...    39   0.052
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...    38   0.11 
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...    35   0.70 
SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} simi...    35   0.78 
KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129) ...    35   0.91 
TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 a...    34   1.3  
YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa] ...    34   1.9  
Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 b...    33   1.9  
Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 ...    33   1.9  
SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [172...    33   2.0  
KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {O...    33   3.0  

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score = 1298 bits (3359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/722 (89%), Positives = 644/722 (89%)

Query: 1   MSSNSVRENEDHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAXX 60
           MSSNSVRENEDHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDA  
Sbjct: 1   MSSNSVRENEDHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVS 60

Query: 61  XXXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAES 120
                               YDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAES
Sbjct: 61  DVGSEDDLDVGDEDEKKKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAES 120

Query: 121 EPVDDQLEIENGLLGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLSN 180
           EPVDDQLEIENGLLG                    SEDEQDPFESHFNQVPEKDVDDLSN
Sbjct: 121 EPVDDQLEIENGLLGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSN 180

Query: 181 AFKSKNIRYKSVKAPLNGDESYIYAQPXXXXXXXXXXXXXXXXXXXXXFLKQRLKIQNGL 240
           AFKSKNIRYKSVKAPLNGDESYIYAQP                     FLKQRLKIQNGL
Sbjct: 181 AFKSKNIRYKSVKAPLNGDESYIYAQPVVVGEESSVESPYKSSSIYSYFLKQRLKIQNGL 240

Query: 241 QDKKIDPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILK 300
           QDKKIDPLNALQRKLVDPMFQYKDIL               LYTLHVLNHIYKTRDRILK
Sbjct: 241 QDKKIDPLNALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILK 300

Query: 301 NNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFR 360
           NNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFR
Sbjct: 301 NNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFR 360

Query: 361 DDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILE 420
           DDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILE
Sbjct: 361 DDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILE 420

Query: 421 NTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWY 480
           NTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWY
Sbjct: 421 NTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWY 480

Query: 481 INEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQI 540
           INEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQI
Sbjct: 481 INEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQI 540

Query: 541 FQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEK 600
           FQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEK
Sbjct: 541 FQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEK 600

Query: 601 TTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNN 660
           TTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNN
Sbjct: 601 TTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNN 660

Query: 661 PEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYE 720
           PEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYE
Sbjct: 661 PEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYE 720

Query: 721 FK 722
           FK
Sbjct: 721 FK 722

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score = 1131 bits (2925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/723 (77%), Positives = 599/723 (82%), Gaps = 2/723 (0%)

Query: 1   MSSNSVRENEDHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAXX 60
           MS  S REN++H RGHRKRGRQE+RKIKR++ RRTEDVD +++D+VAEE V     DA  
Sbjct: 1   MSGKSARENDEHFRGHRKRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVETKAEDAIS 60

Query: 61  XXXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRMKTKAE-ESSDRTTQSDGNENAE 119
                               YDALLTILKSEHPEPKR KTKA  E+++   Q+  NEN +
Sbjct: 61  DAGSESDLDIGDEEEKQEKVYDALLTILKSEHPEPKRKKTKATGENNEAVDQTGVNENTD 120

Query: 120 SEPVDDQLEIENGLLGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLS 179
           SEPVDDQLEIENGLL                     SEDEQDPFESHFNQV EK VDD+S
Sbjct: 121 SEPVDDQLEIENGLL-SDQEDDSDDDGDENEQDEVDSEDEQDPFESHFNQVSEKYVDDVS 179

Query: 180 NAFKSKNIRYKSVKAPLNGDESYIYAQPXXXXXXXXXXXXXXXXXXXXXFLKQRLKIQNG 239
           NAFK+ NI+YKSVK+PL  DES IY++P                     FLKQRLKIQNG
Sbjct: 180 NAFKANNIKYKSVKSPLGDDESCIYSKPVVNGDETPVERPYKSSSIYSYFLKQRLKIQNG 239

Query: 240 LQDKKIDPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRIL 299
           L DKKIDPL +LQ+KLVDPMFQYKDIL               LYTLH LNHIYKTRDRIL
Sbjct: 240 LLDKKIDPLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTRDRIL 299

Query: 300 KNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQF 359
           KNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRD AY VVDKII KSGIDQVDKKGKFYDQF
Sbjct: 300 KNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKFYDQF 359

Query: 360 RDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMIL 419
           RDDSLPP SKP+SFQHIF+GNT+DFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMIL
Sbjct: 360 RDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMIL 419

Query: 420 ENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMW 479
           ENTDKKKRQDDFLSSIE+MVIDQLHSIEYQNISHI TIFDH+NKIPDQQHEADFSRIRMW
Sbjct: 420 ENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIRMW 479

Query: 480 YINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQ 539
           YINEQAK  RQTMVFTKYISP  NSLINGRCRN+AGRWKNH+ I  ETSSIGQLGLKIRQ
Sbjct: 480 YINEQAKLLRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGLKIRQ 539

Query: 540 IFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKE 599
           IFQRFD IGNSI+EEPDYRFKFFTSV+IPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKE
Sbjct: 540 IFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKE 599

Query: 600 KTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPN 659
           KTTILFGDINEYSSQ+QLNANRSLFQQGR+KV+LYTERLHHYRRY+IKGVK+VIFYKPPN
Sbjct: 600 KTTILFGDINEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFYKPPN 659

Query: 660 NPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVY 719
           NPEFY+ETVR+IGKNAF GNTDLNISTVRC+YSKLDG+SLERIVGTKRA VLSHAQKEVY
Sbjct: 660 NPEFYNETVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQKEVY 719

Query: 720 EFK 722
           EFK
Sbjct: 720 EFK 722

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score = 1127 bits (2914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/725 (77%), Positives = 599/725 (82%), Gaps = 4/725 (0%)

Query: 1   MSSNSVRENEDHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAXX 60
           M+  SVRE  DH RG+RKRGRQELRKIKRSS RRT+D   +++D+VA+E V     D   
Sbjct: 1   MNGESVREKNDHFRGYRKRGRQELRKIKRSSVRRTKDESVNEVDHVADEIVHSTGEDKIS 60

Query: 61  XXXXXXXXXXXXXXX-XXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENA- 118
                                YDALLTILKSEHPEPKR KT+A+E +    +  GNEN  
Sbjct: 61  DIGSEEDNLDVEDEEGKKEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVN 120

Query: 119 -ESEPVDDQLEIENGLLGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDD 177
            E EPVD+QLEIENGLLG                    SEDEQDPFESHFNQV EK VDD
Sbjct: 121 VEYEPVDEQLEIENGLLGDREDDNDDDSNENEKDDMD-SEDEQDPFESHFNQVSEKYVDD 179

Query: 178 LSNAFKSKNIRYKSVKAPLNGDESYIYAQPXXXXXXXXXXXXXXXXXXXXXFLKQRLKIQ 237
           LSNAFKSK+I+YKSVKA L  DESYIYA+P                     FLKQRLK+Q
Sbjct: 180 LSNAFKSKSIKYKSVKASLGDDESYIYAKPFMVGEEALVESPYRSSSIYSYFLKQRLKVQ 239

Query: 238 NGLQDKKIDPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDR 297
           NGL DKKIDPL  +Q+KL+DPMFQYKDIL               LY LHVLNHIYKTRDR
Sbjct: 240 NGLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDR 299

Query: 298 ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYD 357
           ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTR+VAYRVVDKIISKSGIDQVDKKGKFYD
Sbjct: 300 ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYD 359

Query: 358 QFRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQM 417
           QFRDDSLPP+SKP+SFQHIFKGNT+DFFVVGLKFTRKAIKLYSNFYQSDII+CSPLGIQM
Sbjct: 360 QFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQM 419

Query: 418 ILENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIR 477
           ILENTDKKKRQDDFLSSIE+MVIDQLHSIEYQNISHI TIFDH+NKIPDQQHEADFSRIR
Sbjct: 420 ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIR 479

Query: 478 MWYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKI 537
           MWYINEQAK FRQTMVFTKYISP  NSLINGRC NMAGRWKNH+ IG E+SSIGQLGLK+
Sbjct: 480 MWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKV 539

Query: 538 RQIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYM 597
           RQIFQRFD IGNSI+EEPDYRFKFFTSV+IPSIVKS GYEDGIL+YIPDYTDFIRIRNYM
Sbjct: 540 RQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYM 599

Query: 598 KEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKP 657
           KEKTTILFGDINEYS+QRQLNANRSLFQQGRLKVMLYTERLHHYRRY+IKGVKSV+FYKP
Sbjct: 600 KEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKP 659

Query: 658 PNNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKE 717
           PNNPEFY+ETVRFIGKNAF GNTDLNISTVRCIYSKLDG+SLERIVGTKRAAVLSHAQKE
Sbjct: 660 PNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKE 719

Query: 718 VYEFK 722
           VYEFK
Sbjct: 720 VYEFK 724

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score = 1111 bits (2874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/724 (77%), Positives = 593/724 (81%), Gaps = 5/724 (0%)

Query: 1   MSSNSVRENEDHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAXX 60
           MS +SVRE  D+ RG+RKRGRQELRKIKRSS R TE    + ++ VAE+   R+D D   
Sbjct: 1   MSDSSVREKNDNFRGYRKRGRQELRKIKRSSAR-TEGGSTETLEDVAEDIDHRSDEDEVS 59

Query: 61  XXXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQ--SDGNENA 118
                               YDALLTILKSEHPEPKR + +A+ES+    +   D +EN 
Sbjct: 60  DVDSGDDFDIEDEEGKKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENT 119

Query: 119 ESEPVDDQLEIENGLLGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDL 178
           E  PVDDQLEIENGLL                     SEDEQDPFESHFNQVPEK VD L
Sbjct: 120 EHGPVDDQLEIENGLL--GNHEDDNDDDSSGDEKDIDSEDEQDPFESHFNQVPEKFVDKL 177

Query: 179 SNAFKSKNIRYKSVKAPLNGDESYIYAQPXXXXXXXXXXXXXXXXXXXXXFLKQRLKIQN 238
           SNAFK+K+++YKSVK  L+  ESYIYA+P                     FLKQRLK+QN
Sbjct: 178 SNAFKTKSVKYKSVKGSLSDSESYIYAKPVVIGEEALVESPYRSSSIYSYFLKQRLKVQN 237

Query: 239 GLQDKKIDPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRI 298
           GL DKK DPL ALQ+KLVDPMFQYKDIL               LY LHVLNHIYKTRDRI
Sbjct: 238 GLLDKKTDPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRI 297

Query: 299 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQ 358
           LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTR+VAYRVVDKIISKSGIDQVDKKGKFYDQ
Sbjct: 298 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQ 357

Query: 359 FRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI 418
           FRDDSLPPKSKP+SFQHIF+GNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI
Sbjct: 358 FRDDSLPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI 417

Query: 419 LENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRM 478
           LENTDKKKRQDDFLSSIE+MVIDQLHSIEYQNISHI TIFDHLNKIPDQQHEADFSRIRM
Sbjct: 418 LENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRM 477

Query: 479 WYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIR 538
           WYINEQAK FRQTMVFTKYISP  NSLINGRCRNMAGRWKNH+ IG E SSIGQ GLKIR
Sbjct: 478 WYINEQAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIR 537

Query: 539 QIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMK 598
           QIFQRFD IGNSI+EEPDYRFKFFTSV+IP IVKSTGYEDGILIYIPDYTDFIRIRNYMK
Sbjct: 538 QIFQRFDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMK 597

Query: 599 EKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPP 658
           EKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRY+IKGVKSV+FYKPP
Sbjct: 598 EKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPP 657

Query: 659 NNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEV 718
           NNPEFY+E VRFIGKNAF GNTDLNISTVRCIYSKLDG+SLERIVGTKRAAVLSHAQKE+
Sbjct: 658 NNPEFYNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEI 717

Query: 719 YEFK 722
           YEFK
Sbjct: 718 YEFK 721

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  918 bits (2373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/718 (63%), Positives = 536/718 (74%), Gaps = 13/718 (1%)

Query: 16  HRKRGRQELRKIKRSSGRRTE-DVDADKIDYVAEEPVGRNDNDAXXXXXXXXXXXXXXXX 74
           HRKRGRQELR I+RS+ +++  D +  + +   E     ++                   
Sbjct: 24  HRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTEELLQEESEEGEEDEEDDQSEQEEVDED 83

Query: 75  XXXXXXYDALLTILKSEHPEPK-----RMKTKAEESSDRTTQSDGNENAESEPV--DDQL 127
                 Y ALLTIL++EHPEPK     + K   E+ SD    + G+   E   +  D+  
Sbjct: 84  ERKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSIIEEDETE 143

Query: 128 EIENGLLGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNI 187
           +IENGLL                     S+DEQDPFESHFN+  E+ VD L  AF+S+ I
Sbjct: 144 QIENGLL--DRDDEQSDDDQLNDSNDVESDDEQDPFESHFNKPTEQFVDKLHAAFESREI 201

Query: 188 RYKSVKAPLNGDESYIYAQPX---XXXXXXXXXXXXXXXXXXXXFLKQRLKIQNGLQDKK 244
           +YK+ K  ++   S I ++P                        F+KQRLKIQN L + K
Sbjct: 202 KYKATKIVIDDSHSVISSKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLLNPK 261

Query: 245 IDPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILKNNQR 304
           +DPL  LQ++L+DPMFQYKDIL               LY LH LNH+YKTRDRILKNNQR
Sbjct: 262 VDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKNNQR 321

Query: 305 LQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSL 364
           LQDN DTE+LDQGFTRPKVLIVVPTRD AY V DKII KSG+DQVDKKGKFYDQF+DDSL
Sbjct: 322 LQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFKDDSL 381

Query: 365 PPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDK 424
           PP SKP+SFQ IFKGNTNDFFV+GLKFTRKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDK
Sbjct: 382 PPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVENTDK 441

Query: 425 KKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQ 484
           KKRQDDFLSSIE++++DQLHS+EYQN++HI TIFDHLNKIP +QH+ADFSRIRMWYIN+Q
Sbjct: 442 KKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYINDQ 501

Query: 485 AKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRF 544
           AK FRQTMVFTKY+SP  N++IN RCRN  GRWKNH+ + PE SSIG+LGLKI+QIFQRF
Sbjct: 502 AKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIFQRF 561

Query: 545 DTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTIL 604
           D +G SIV+EPDYRFK FTSV+IPSIVKST Y+DGILIYIPDYTD++RIRNY+KEKT IL
Sbjct: 562 DIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKTRIL 621

Query: 605 FGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFY 664
           FGDINEYS QR+LN+NRSL QQGR+KV+LYTERLHHYRRY+IKGVKSV+FYKPP NPEFY
Sbjct: 622 FGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNPEFY 681

Query: 665 SETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722
           +E VRFIGKNAF GNTDLNISTVR +Y KLDG+SLERIVGTKRA +L HAQ EVYEFK
Sbjct: 682 NEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEFK 739

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/722 (62%), Positives = 540/722 (74%), Gaps = 12/722 (1%)

Query: 11  DHHRGHRKRGRQELRKIKRSSGRRTEDVD--------ADKIDYVAEEPVGRNDNDAXXXX 62
           D + G RKRGR+ELR I+R+ GR+  D          ++    V EEP    + D     
Sbjct: 9   DGYDGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANGD--DVG 66

Query: 63  XXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEP 122
                             Y ALLTILKSEHPEPK+ K +         +     +A  E 
Sbjct: 67  DEVGDEASDDEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQDESDASEEE 126

Query: 123 VDDQLEIENGLLGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLSNAF 182
            D+  +IEN L+G                    S++EQDPFE+HFN V EK  D L  +F
Sbjct: 127 EDETQQIENALMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSF 186

Query: 183 KSKNIRYKSVKAPLNGDESYIYAQPXXXXXXXXX--XXXXXXXXXXXXFLKQRLKIQNGL 240
           K+ +I+YKS K P++ DE  I+++P                       FLKQRLK+QN L
Sbjct: 187 KNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNL 246

Query: 241 QDKKIDPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILK 300
            D K+DPL  LQ++LVDPMFQYKDIL               LY+LHVLNH+YKTRD+ILK
Sbjct: 247 MDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILK 306

Query: 301 NNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFR 360
           NNQRLQDN DTE LDQGFTRPKVLIVVPTRD AY+V++KII+KSGIDQVDKKGKF DQF 
Sbjct: 307 NNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFF 366

Query: 361 DDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILE 420
           +DSLPP SKP+SFQ IFKGNTNDFFV+G+KFTRKAIKLYSNFYQSDII+CSPLGIQMILE
Sbjct: 367 EDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILE 426

Query: 421 NTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWY 480
           NTDKKKRQDDFLSSIE+M+IDQLHSIEYQNISH+ TI +H+NKIP +QH+ADFSR+RMWY
Sbjct: 427 NTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWY 486

Query: 481 INEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQI 540
           IN+QAK FRQTM+FTKYISP  NSL+NG+C+N +GRWKNH+ I   +SSI ++G+KIRQI
Sbjct: 487 INDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQI 546

Query: 541 FQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEK 600
           FQRF+T+  S+V+EPDYRFKFFTSV +P+IVK+TGYEDG LIYIP+YTD+IR+RNY+K+K
Sbjct: 547 FQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDK 606

Query: 601 TTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNN 660
           TTILFGDINEYS Q+QLN+NRSLFQQGR+KV+LYTERLHHYRRY+IKGVK+V+FY+PP N
Sbjct: 607 TTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKN 666

Query: 661 PEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYE 720
           PEFY+E VR+IGKNAF GNTDLNISTVRC+YSKLD +SLE IVG+KRA VL HAQ EVYE
Sbjct: 667 PEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYE 726

Query: 721 FK 722
           FK
Sbjct: 727 FK 728

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/721 (61%), Positives = 532/721 (73%), Gaps = 17/721 (2%)

Query: 12  HHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAXXXXXXXXXXXXX 71
            H G +KRGRQELR I+RS+G +    +      V    +  ++                
Sbjct: 10  QHAGSKKRGRQELRTIRRSAGAKVSSQE------VFNSSIVDDEEQELNESNESEQEEDI 63

Query: 72  XXXXXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQL---- 127
                    Y ALLTILKSEHPE K+ K K  + S ++ +  G+E A  +  DD++    
Sbjct: 64  DEEEKKNKVYGALLTILKSEHPELKKKKKKRVDDS-KSGEDKGSELASDDGKDDEIDEAQ 122

Query: 128 EIENGLL---GXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLSNAFKS 184
           +IE+GL                         SEDEQDPFESHFNQV EK  DDL+ AF +
Sbjct: 123 QIEDGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDLNTAFNT 182

Query: 185 KNIRYKSVKAPLNGDESYIYAQPX---XXXXXXXXXXXXXXXXXXXXFLKQRLKIQNGLQ 241
            +++YKS K+ +  +++ I + P                        FLKQRL++ N + 
Sbjct: 183 GSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLRVANDML 242

Query: 242 DKKIDPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILKN 301
           D K DPL  LQ++LVDPMFQY+DIL               LY LH LNH+YKTRDRILK+
Sbjct: 243 DSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTRDRILKD 302

Query: 302 NQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRD 361
           N RLQDN DTE+ DQGFTRPKVLIVVPTRD AY V+ KIISKSG+DQVDKKGKF DQF D
Sbjct: 303 NGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKFNDQFHD 362

Query: 362 DSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILEN 421
           ++LPP SKP+SFQHIFKGNTNDFFV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+QMI+EN
Sbjct: 363 ETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVEN 422

Query: 422 TDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYI 481
           TDKK RQDDFLSSIE+++IDQLHSIEYQN++H+ TIFDHLNKIP+QQHEADFSRIRMWYI
Sbjct: 423 TDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSRIRMWYI 482

Query: 482 NEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIF 541
           N+QA+ FRQTM+FTKY++P  N+LIN RCRN AGRWKNH  I PE S+I QLGLK++Q F
Sbjct: 483 NDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGLKVKQTF 542

Query: 542 QRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKT 601
           QRFD +G S+++EPDYRFK F+SV+IPSIVKST Y DGILIYIPDYTD++RIRNY+KEKT
Sbjct: 543 QRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRNYLKEKT 602

Query: 602 TILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNP 661
           T+LFGDINEYS QR+LN+NRSLFQQGR+KV+LYTERLHHYRRY++KGVKSV+FYKPP NP
Sbjct: 603 TLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFYKPPTNP 662

Query: 662 EFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEF 721
           EFY+E VR+IGK+AF GN DLNISTVR +Y KLDG+SLERIVG+KRA +L HAQ EVYEF
Sbjct: 663 EFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQNEVYEF 722

Query: 722 K 722
           +
Sbjct: 723 Q 723

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  887 bits (2293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/717 (63%), Positives = 530/717 (73%), Gaps = 14/717 (1%)

Query: 18  KRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAXXXXXXXXXXXXXX-XXXX 76
           KRGR+ELR +KR++ R   D    +   V ++ VG  D                      
Sbjct: 7   KRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSDSDAEAR 66

Query: 77  XXXXYDALLTILKSEHPEPKRMKTKAEESS---DRTTQSDGNENAESEPVDDQLEIENGL 133
               Y ALLTILKSEHPE K+ KTK        D+    D N + E E  +++ +I+N +
Sbjct: 67  KGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDN-HEELEEENEEEQIDNAI 125

Query: 134 LGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSVK 193
           L                     SEDEQDPFESHFNQ PE +++ L  AFKSK ++Y+SVK
Sbjct: 126 LDNRTQSDSEDEQDVAAEEFD-SEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSVK 184

Query: 194 -APLN----GDESYIYAQPXX---XXXXXXXXXXXXXXXXXXXFLKQRLKIQNGLQDKKI 245
             P       DE  IY++P                        FLK+RLKIQN L + K 
Sbjct: 185 LQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLLENKP 244

Query: 246 DPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILKNNQRL 305
           D L ++Q++LVDPMFQYKDIL               LY LH LNH+YKTRDRILKNNQRL
Sbjct: 245 DNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQRL 304

Query: 306 QDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLP 365
           Q+N DTE LDQGFTRPKVLI+ PTRD AY +V  II+KSGIDQVDK+GKF DQF +DSLP
Sbjct: 305 QENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSLP 364

Query: 366 PKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKK 425
           P SKP+SFQ IFKGNTNDFFV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+QMI+ENTDKK
Sbjct: 365 PSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKK 424

Query: 426 KRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQA 485
           KRQDDFLSSIEI +IDQLHSIEYQNISH+ TIF+HLN IPD+QH+ADFSRIRMWYIN+QA
Sbjct: 425 KRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQA 484

Query: 486 KFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFD 545
           +FFRQTMVFTKYISPT NS+ING+CRN +GRWKNHR +  E S IG+L L++RQIFQRF+
Sbjct: 485 RFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRFE 544

Query: 546 TIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILF 605
             G SIV+EPDYRFKFFTSV+IP I+KSTGYEDGILIYIP+YTD++R+RNY+KEKT ILF
Sbjct: 545 VTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRILF 604

Query: 606 GDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYS 665
           GDINEYSSQ+QL ANRSLFQQGRLKV+LYTERLHHYRRY+IKGVKSVIFYKPP++PEFY+
Sbjct: 605 GDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFYT 664

Query: 666 ETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722
           E VR IG+NAF GNTDLNISTVRCIYSKLD ++LE +VGT+RA VL H Q E+YEFK
Sbjct: 665 EVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/727 (60%), Positives = 524/727 (72%), Gaps = 14/727 (1%)

Query: 1   MSSNSVRENEDHHRG----HRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDN 56
           M++ S R N D   G     +K GR+ELR I R++ R   +    K D+  E  +   + 
Sbjct: 1   MNNVSKRSNRDESHGGYKKAKKTGRKELRTITRANARHANE---SKDDFENEPDMSSEEE 57

Query: 57  DAXXXXXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNE 116
           +                       Y+ALLT+L+SEHP  K  K +      +    +G E
Sbjct: 58  ELADNKPRSDEEEEEDIETKKQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVE 117

Query: 117 NAESEPVDDQLEIENGLLGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVD 176
               E  D++  IEN L+                      ED+ D FE HFN V E    
Sbjct: 118 TYSDE--DEEEAIENALV---ETNDDEDDVGSDINGDEDDEDKADSFELHFNNVSELQAT 172

Query: 177 DLSNAFKSKNIRYKSVKAPLNGDESYIYAQPXXXXXXXXXXXX-XXXXXXXXXFLKQRLK 235
            L++AF+ K IRYKSVK P+N DE +IY++P                      F+KQ+LK
Sbjct: 173 KLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVVAPSCKKSLHSYFIKQKLK 232

Query: 236 IQNGLQDKKIDPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTR 295
           IQN L D K + L  LQ+ LVDPMFQY+D+L               LY LHVLNH+YKTR
Sbjct: 233 IQNNLLDDKKEALAPLQKNLVDPMFQYQDLLYEYRSYEQEEEYRD-LYALHVLNHVYKTR 291

Query: 296 DRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKF 355
           DRIL+N+Q+LQDN D E LDQGFTRPKVLIVVPTRDVAY++V KII KSG+DQVDK+GKF
Sbjct: 292 DRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKF 351

Query: 356 YDQFRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGI 415
            DQF D SLPP SKP+SF+HIFKGNTNDFFV+G KFTRK +KLYSNFYQSD+I CSPLGI
Sbjct: 352 QDQFFDASLPPSSKPKSFKHIFKGNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGI 411

Query: 416 QMILENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSR 475
           Q+ILENTDKKKRQDDFLSSIE+MVIDQLHSIEYQN+SHI TIF H+NKIP QQH+ADFSR
Sbjct: 412 QLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSR 471

Query: 476 IRMWYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGL 535
           IRMWYINEQA  FRQTMVFTKY SP  NSLING+CRN AGRWKNH  + PE SSI QLGL
Sbjct: 472 IRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGL 531

Query: 536 KIRQIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRN 595
           K+RQIFQRFD +G S ++EPDYRFKFFTSV+I SI+KSTGYEDGIL+YIPDYTD++R+RN
Sbjct: 532 KVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRN 591

Query: 596 YMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFY 655
           +++EKTT+LFGDINEYS Q+QL +NR+LFQQG++KV+LYTERLHH+RRY+IKGVKSVIFY
Sbjct: 592 HLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFY 651

Query: 656 KPPNNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQ 715
           KPP NPEFY E VR+IGK+AF G+ DLNISTVRC+Y KLDG+SLER+VGTKRAAVL+H Q
Sbjct: 652 KPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQ 711

Query: 716 KEVYEFK 722
            E+YEFK
Sbjct: 712 NEIYEFK 718

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/710 (60%), Positives = 519/710 (73%), Gaps = 11/710 (1%)

Query: 14  RGHRKRGRQELRKIKRSSGRRTE-DVDADKIDYVAEEPVGRNDNDAXXXXXXXXXXXXXX 72
           R   K GR++LR+I R+  +R   D +A   D     P   +D+D               
Sbjct: 5   RAGPKSGRKQLREITRAGQKRVRYDDEATVADLT---PDNESDSD---NAEPSVAAERED 58

Query: 73  XXXXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQLEIENG 132
                   Y+ALLT+LKSEHPE K    K  +   +  + D  EN      D+Q  IEN 
Sbjct: 59  VEQHRGQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQNIENA 118

Query: 133 LLGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSV 192
           L                      SEDE DPFESHF++  E  +      FK K ++YKS 
Sbjct: 119 LDDVSGGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSS 178

Query: 193 KAPLNGDESYIYAQPXXXXXXXXXXXXXXXXXXXXXFLKQRLKIQNGLQDKKIDPLNALQ 252
           K  ++ +ES IY++P                     F+KQ+LK+ N  Q+  + PL  +Q
Sbjct: 179 KTDVSEEESLIYSKPCLDDEEVLPVKGKQTLSSY--FIKQKLKLANDFQNNGL-PLTEIQ 235

Query: 253 RKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILKNNQRLQDNPDTE 312
           ++LVDPMFQYKD+L               LY+LH LNH+YKTRDRILKNNQ+LQ+N D E
Sbjct: 236 KELVDPMFQYKDMLYEYDDYADEDQYRD-LYSLHALNHVYKTRDRILKNNQKLQENNDEE 294

Query: 313 HLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPRS 372
            LDQGFTRPKVLIVVPTRD A+++V KI+ KSG+DQ DKK KF DQF +DSLPP SKP+S
Sbjct: 295 LLDQGFTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKS 354

Query: 373 FQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFL 432
           FQHIF+GNTNDFFV+GLKFTRK++K+YSNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFL
Sbjct: 355 FQHIFQGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFL 414

Query: 433 SSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFRQTM 492
           SSIE+M+IDQLHSIEYQN  H+ TIF H+NKIP+QQ EADFSRIRMWYINEQAKFFRQT+
Sbjct: 415 SSIEVMIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTI 474

Query: 493 VFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIV 552
           VFTKYISP  NS++NG+CRN+AGRWKNHR I PE SSIGQLGLK+RQIFQRFD  G + +
Sbjct: 475 VFTKYISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTAL 534

Query: 553 EEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYS 612
           +EPDYRFKFFTSV++PSIVKSTGYEDGIL+YIPDYTDFIR+RNY+KEKTTI+FG+INEYS
Sbjct: 535 DEPDYRFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYS 594

Query: 613 SQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIG 672
           +Q+QL +NR+ FQ G++KV+LYTERLHH+RRY+IK VKSVIFYKPP NPEFYSE VR IG
Sbjct: 595 NQKQLTSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIG 654

Query: 673 KNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722
           KN F GN D+NISTVRCIYSK+DG+SLER+VG+KRAAVL+H Q EVYEFK
Sbjct: 655 KNVFLGNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/715 (60%), Positives = 523/715 (73%), Gaps = 14/715 (1%)

Query: 9   NEDHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAXXXXXXXXXX 68
           +E    G  KRGR+ELR I+R    +  + + + ++  +E  V  + N            
Sbjct: 9   DEARRNGTLKRGRKELRSIRRPQRNKAHE-EPEHLNESSEGEVKNHHNGMQHNEEIANVE 67

Query: 69  XXXXXXXXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQLE 128
                       Y ALLTIL SEHP+PK      +E + ++ + D   + E +  D+  +
Sbjct: 68  EDEENKRRKV--YGALLTILNSEHPKPK----PKQEVTVQSRKEDSESDVEEDERDEVEQ 121

Query: 129 IENGLLGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIR 188
           +E+ L                      S+DEQD F+SHFNQVPE  VD L  AFK + ++
Sbjct: 122 LEDNL---ARVDENPSEDDLSEDADEESDDEQDTFDSHFNQVPENVVDKLDAAFKERQLK 178

Query: 189 YKSVKAPLNGDESYIYAQPXXXXXXXXXXXXXXXXXXXXXFL-KQRLKIQNGLQDKKIDP 247
           YKS K P+  +ES +Y++P                     ++ KQRLKIQN L+ +    
Sbjct: 179 YKSAKVPIGENESMVYSKPLLLEDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEHEN--- 235

Query: 248 LNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILKNNQRLQD 307
           L + QR LVDPM QY D+L               LY LHVLNH+YKTRD+ILKNNQR+ D
Sbjct: 236 LTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISD 295

Query: 308 NPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPK 367
           NPD ++LDQGFTRPKVLIVVPTRD AY+V++KII KSGIDQ+DKKGKF DQF ++SLPP 
Sbjct: 296 NPDADYLDQGFTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPPS 355

Query: 368 SKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKR 427
           SKP+SFQH+FKGNTNDFFV+G+KFTRKAIKLYSNFYQSDII+CSPLGIQ+ILENTDKKKR
Sbjct: 356 SKPKSFQHVFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKR 415

Query: 428 QDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKF 487
           QDDFLSSIEI + DQLHSIEYQN+SH++TIFDHLN IP +QH+ DF R+R+WYINEQAK 
Sbjct: 416 QDDFLSSIEISIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKL 475

Query: 488 FRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTI 547
           FRQTM+FTKY+SPT N+LIN +C+NM GRWKNH  I P  SSIG+LGLK+RQIFQR D  
Sbjct: 476 FRQTMIFTKYVSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLG 535

Query: 548 GNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGD 607
             SI+EE D+RFKFFTSV+IPSI+KSTGYEDGIL+YIPDY DFIR+RNYMKEKTTI+FGD
Sbjct: 536 AASILEESDFRFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGD 595

Query: 608 INEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSET 667
           INEYS+Q+QLN+NR+LFQQGR KV+LYTERLHH+RRY+IKGVKSV+FY+PP NPEFYSE 
Sbjct: 596 INEYSNQKQLNSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEV 655

Query: 668 VRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722
           VRFI K+A  G TDLNISTVR IYSKLDGISLERIVGTKRAA+L+H Q EVYEFK
Sbjct: 656 VRFIAKSAALGTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/714 (58%), Positives = 524/714 (73%), Gaps = 5/714 (0%)

Query: 11  DHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAXXXXXXXXXXXX 70
           ++  G+ KRGR + R IK+SSG +    +  +I  V E     + ++             
Sbjct: 9   NYSEGYGKRGRSQKRSIKKSSGAKRFKTEDTRI--VKETIEDESSDEDVSNTSIDKEAEV 66

Query: 71  XXXXXXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQLEIE 130
                     YDAL+TILKSEH EPK M+    E+S     +D + + + +   ++ EIE
Sbjct: 67  TEDLEKKKQVYDALVTILKSEHKEPK-MRDNLNETSKEEHLTDEDLDEDEKFETEEQEIE 125

Query: 131 NGLLGXXXXXXXXXXXXXXX-XXXXXSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRY 189
           N LL                      S+++ DPF+SHFNQ  E+  +  ++AFK+K I+Y
Sbjct: 126 NNLLSIKDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKNKQIKY 185

Query: 190 KSVKAPLNGDESYIYAQPXXXXXXXXXXXXXXXXXXXXXF-LKQRLKIQNGLQDKKIDPL 248
           +S+K  +N  ES IY++P                     + LK+RLKI N L D  ++ L
Sbjct: 186 RSIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDPAVNNL 245

Query: 249 NALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILKNNQRLQDN 308
             +Q++LVDPMFQYKDIL               LY LHVLNHIYKTRDRILKNN ++QDN
Sbjct: 246 TTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQDN 305

Query: 309 PDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKS 368
           PD E LDQGFTRPKVLIV PTRD  Y +V++II KSGIDQ+DKK KF DQF ++SL P S
Sbjct: 306 PDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPAS 365

Query: 369 KPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQ 428
           KP+SFQ +FKGN+ND+FV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+ MILENTDKKKRQ
Sbjct: 366 KPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTDKKKRQ 425

Query: 429 DDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFF 488
           DDFLSSIE+M+IDQLHS+E+QNISH+ +IF+H+NKIP +QH+ DFSRI+MWYIN+QAK F
Sbjct: 426 DDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYINDQAKLF 485

Query: 489 RQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIG 548
           RQTM+FTKYISP+ N  +NG+C+N +GRWKNH+ I P  SSIGQLGL+++Q+F RFD IG
Sbjct: 486 RQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHRFDIIG 545

Query: 549 NSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDI 608
            SIV+EPDYRFK+FTSV++ SI KST YEDG+LIYI DYTD++R+RNY+KEKTTILFGDI
Sbjct: 546 GSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTILFGDI 605

Query: 609 NEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETV 668
           NEYS Q+Q+N+NR+LFQQ R+KV+LYTERLHH+RRY+IKGVK+++FYK P NPEFY+E V
Sbjct: 606 NEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVV 665

Query: 669 RFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722
           R+IGKNAF+GNTD+NIS VR IYSKLDG++LERI+GTKRAAVL+H Q E YEFK
Sbjct: 666 RYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/709 (58%), Positives = 514/709 (72%), Gaps = 15/709 (2%)

Query: 15  GHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAXXXXXXXXXXXXXXXX 74
           G +KRGR ELR I+R +  R++    D+   V  E    +  ++                
Sbjct: 10  GPKKRGRTELRSIRRPN--RSQHSKHDQ--QVVHESENEDSLESSSDDDEDIAQAEAENS 65

Query: 75  XXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQLEIENGLL 134
                 Y ALLTIL SEHPE K+ K+ + +      + +  E            + +   
Sbjct: 66  DRKEKVYGALLTILNSEHPERKKHKSHSTDFVKEIDEQEEIEQG----------MASESE 115

Query: 135 GXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSVKA 194
                                  D+ D FESHFN V +  VDD+S  FK K I+YKS+K 
Sbjct: 116 EEDEENDEEESNEGDEEEEEEPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKY 175

Query: 195 PLNGDESYIYAQPXXXXXXXXXXXX-XXXXXXXXXFLKQRLKIQNGLQDKKIDPLNALQR 253
            L+  ES I+ +P                      F+KQRLKIQN L D   + L  L++
Sbjct: 176 SLDKKESAIFGKPLLLTQQDETIDNPVLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKK 235

Query: 254 KLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILKNNQRLQDNPDTEH 313
           KL+DPMFQYKD+L               LY+LHVLNHIYKTRD+ILK+NQRLQ+N D E 
Sbjct: 236 KLLDPMFQYKDVLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLEC 295

Query: 314 LDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPRSF 373
           LDQGFTRPKVLIVVPTRD AY+VV+ II KSG+DQ+DKKGKF DQF DDSLPP SKP+SF
Sbjct: 296 LDQGFTRPKVLIVVPTRDTAYQVVETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSF 355

Query: 374 QHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLS 433
           +H+FKGNTNDFFV+G+KFTRKAIKLYSNFYQSDII+CSPLGIQMILENTDKKKRQDDFLS
Sbjct: 356 RHVFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLS 415

Query: 434 SIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFRQTMV 493
           SIE+M++DQLHSIEYQNISH+ TI +H+NKIP QQ EADFSRIRMWYIN+QAKF RQTM+
Sbjct: 416 SIEVMIVDQLHSIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTML 475

Query: 494 FTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVE 553
           FT+YISPT N++ING+C NMAGRWKN++ I  E SSIGQLG+KI+QIFQRFD +G ++V+
Sbjct: 476 FTRYISPTANAIINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVD 535

Query: 554 EPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSS 613
           E DYRFK+FTSV++ +IVKSTGYEDGIL+YIP+YTD++R+RNYMKEKTTILF +INEYS+
Sbjct: 536 ESDYRFKYFTSVVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYST 595

Query: 614 QRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGK 673
           Q+QL++NRS+FQQGR KV+LYTERLHHYRRY++KG+KSVIFYKPP NPEFY+E +RF  K
Sbjct: 596 QKQLDSNRSMFQQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAK 655

Query: 674 NAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722
           NAF G +D+NIST+R +YSKLDG++L+RIVG+KRAA+L H Q E Y+FK
Sbjct: 656 NAFLGKSDINISTIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/713 (58%), Positives = 513/713 (71%), Gaps = 16/713 (2%)

Query: 18  KRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDND--AXXXXXXXXXXXXXXXXX 75
           KRGR++LRKI R    R+ED    K +  A E  G ND D  A                 
Sbjct: 4   KRGRKQLRKITRIGRNRSED----KANGSALEKRGNNDGDEYAEIAMGEHEKAADDDQEE 59

Query: 76  XXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQS--DGNENAESEPVDDQLEIENGL 133
                Y ALL+IL S HPE +R + K E+++D   +   +G+ N E++ V     I   L
Sbjct: 60  RTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEV---ATISASL 116

Query: 134 LGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSVK 193
                                 SEDE+DPFE HFNQ+ E D + L  AFK K ++Y+S K
Sbjct: 117 DDSVDKDEEVEEDDGVYSDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYESTK 176

Query: 194 AP-LNGDESYIYAQPXXXXXXXXXXXXXXXXXX---XXXFLKQRLKIQNGLQDKKIDPLN 249
            P ++ +E +I+++P                        F+K++LK+ NGL D K  PL 
Sbjct: 177 LPYMHDNEGFIFSKPVIEGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLT 236

Query: 250 ALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILKNNQRLQDNP 309
            L + LVDP+FQY+D+L               LYTLH+LNHIYKTRDRILKNN +LQ+N 
Sbjct: 237 PLSKTLVDPIFQYRDLLFEYEDFSQETEYRD-LYTLHILNHIYKTRDRILKNNHKLQEND 295

Query: 310 DTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSK 369
           D E LDQGFTRPKVL+V PTR+ AY +++KII KSG+DQVDKK KF DQF +DSLPP SK
Sbjct: 296 DQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSK 355

Query: 370 PRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQD 429
           P+SFQH+FKGNTNDFFV+G+KFTRK +KLYSNFYQSD+IVCSPLGIQ+ILENTDKKKRQD
Sbjct: 356 PKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKKRQD 415

Query: 430 DFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFR 489
           DFLSSIE++V+DQLHS+E+QN +H+L+IF H+NKIP +QH++DFSRIRMWYIN+QA+ FR
Sbjct: 416 DFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQARLFR 475

Query: 490 QTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGN 549
           QT++FTKY+SP  NSLING+C N +GR+KN R I PE S+I QLGLK+RQ+F RFD    
Sbjct: 476 QTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDLFTG 535

Query: 550 SIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDIN 609
           S V+EPDYRFKFFTSV +P I KSTGYEDGIL+YIPDYTDF+R+RNY K++T ILFG+I 
Sbjct: 536 SSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFGEIT 595

Query: 610 EYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVR 669
           EYS QRQ+ +NR+LFQQG++KV+LYTERLHH+RRY IKGVKSVIFYKPP+NPEFY E +R
Sbjct: 596 EYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIR 655

Query: 670 FIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722
            IGKNAF GN DLNISTVRC Y KLD +SLERIVG+KRAAVL+ +Q E+YEFK
Sbjct: 656 CIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/757 (55%), Positives = 522/757 (68%), Gaps = 52/757 (6%)

Query: 2   SSNSVRENEDHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDN----D 57
           SS++++ + ++     K GR++LR I+++SG R           +AEE     +N    +
Sbjct: 7   SSSAIKGSNEYRSS--KSGRKQLRTIRKASGPRRG---------LAEESANEENNGSETE 55

Query: 58  AXXXXXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNEN 117
           A                      Y ALLT+LK+EH  P R KTK +   D+ T +D   N
Sbjct: 56  AEDKLAAPELNEPAQDQRAGGEAYAALLTLLKAEHGGPARRKTKTD---DKKTSADPTSN 112

Query: 118 A----ESEPVDDQ---------LEIENGLLGXXXXXXXXXXX------------------ 146
                ESE  D++           IEN L+                              
Sbjct: 113 VKDEEESESRDNEDEEEDEDEEAAIENALMDEHTSGDEDDEGDDGSHQDDINGVTREGGD 172

Query: 147 XXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSVKAPLNGDESYIYAQ 206
                     ED+ D  E HFN V EKD + L  AFK+K +RY+S K  ++ ++ +IY++
Sbjct: 173 ATELAAGFEEEDKPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSR 232

Query: 207 PXXXXXXXXXXXX-XXXXXXXXXFLKQRLKIQNGLQDKKIDPLNALQRKLVDPMFQYKDI 265
           P                      F+KQRLKIQN L D + D L  LQ+++VDPMFQY+D+
Sbjct: 233 PTLVNEPASAVSAPDGSQSLNSYFIKQRLKIQNDLLDSQ-DKLTPLQKQIVDPMFQYQDL 291

Query: 266 LXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLI 325
           L               LY LHVLNHIYKTRDRILKNNQRLQ+NPD E LDQGFTRPKVLI
Sbjct: 292 LYEYEDYDKETEYRD-LYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLI 350

Query: 326 VVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPRSFQHIFKGNTNDFF 385
           V PTRD AY ++ KII KSG+DQVDKK KF DQF  ++LPP  KP+SFQ +FKGNTNDFF
Sbjct: 351 VAPTRDAAYDILSKIIQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFF 410

Query: 386 VVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIEIMVIDQLHS 445
           V+G KFTRK IKLYSNFYQSDII+CSPLGIQ+ILENTDKKKRQDDFLSSIE++V+DQLHS
Sbjct: 411 VLGAKFTRKTIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHS 470

Query: 446 IEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFRQTMVFTKYISPTVNSL 505
           IE+QN+ H+ +IF+H+NKIP QQH+ADFSRI+MWYIN+QAK FRQT++FTK+ SP  NSL
Sbjct: 471 IEFQNMLHLTSIFEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSL 530

Query: 506 INGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRFKFFTSV 565
           ING+CRN AGRWKNHR I PE SS+GQLG++ R IFQRFD +G S+ EEPD RFK F SV
Sbjct: 531 INGKCRNYAGRWKNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSV 590

Query: 566 MIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQ 625
           ++P+IVKSTGYEDGIL+YIPDYTDF+R+RNY++EKTTILFGDINEYS QRQL +NR++FQ
Sbjct: 591 IVPNIVKSTGYEDGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQ 650

Query: 626 QGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLNIS 685
           QGR+KV+LYTERLHH+RRY+IKGVK+VIFYKPP NPEF+ E  R++GK+AF G  DLNIS
Sbjct: 651 QGRVKVLLYTERLHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNIS 710

Query: 686 TVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722
            VRC++SKLDG+SLERIVGT+RAAVL+H   E YEFK
Sbjct: 711 VVRCLFSKLDGLSLERIVGTERAAVLTHGPNETYEFK 747

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/737 (57%), Positives = 523/737 (70%), Gaps = 25/737 (3%)

Query: 1   MSSNSVR-ENEDHHRGHR--KRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDND 57
           MSS+  R  + D H G +  K GR++LR I+++S   ++  + + ++   EE     D  
Sbjct: 1   MSSSKRRYTDHDRHDGEKFTKGGRKQLRSIRKASRYDSKKPEDEPVETPEEEINEVED-- 58

Query: 58  AXXXXXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNE- 116
                                  Y ALLT+LK+EH   K+ K KA    + + +S  +E 
Sbjct: 59  -----VHEERTEVSRKQESNGEAYAALLTLLKAEHGTGKK-KVKAGPQGEGSGESQISEI 112

Query: 117 -------NAESEPVDDQLEIENGL---LGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESH 166
                    E E  +++  IENGL   L                      E+  DP E+H
Sbjct: 113 SPEAEQDEEEEEEEEEETAIENGLAEHLDSDGDEAAEIGDEEDDNNGDQDENASDPLEAH 172

Query: 167 FNQVPEKDVDDLSNAFKSKNIRYKSVKAPLNGDESYIYAQPXXXXXXXXXXXXXXXXXXX 226
           FN VPEKD D L  AFK+K +RY+S K  ++ +E +IY++P                   
Sbjct: 173 FNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQVPQGTQSL 232

Query: 227 X-XFLKQRLKIQNGLQDKKIDPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTL 285
              F+KQRLKIQN L D K + L  LQ+K+VDP+FQY+D+L               LY L
Sbjct: 233 SPYFIKQRLKIQNDLLDSK-NNLTPLQKKIVDPIFQYQDLLYEYENYDQETEYRD-LYAL 290

Query: 286 HVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSG 345
           H L+HIYKTRDRILKNNQRLQDNPD E LDQGFTRPKVLIVVPTRDVAY V+ KII KSG
Sbjct: 291 HALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLSKIIEKSG 350

Query: 346 IDQVDKKGKFYDQFRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQS 405
           +DQVDKK KF DQF  DSLPPK KP+SFQ +FKGNTNDFFV+G KFTRK IKLYSNFYQS
Sbjct: 351 LDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKLYSNFYQS 410

Query: 406 DIIVCSPLGIQMILENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIP 465
           DIIVCSPLGIQ+ILENTDKKKRQDDFLSSIE++VIDQLHSIE+QN+ H+ +IF+H+NKIP
Sbjct: 411 DIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIFEHINKIP 470

Query: 466 DQQHEADFSRIRMWYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGP 525
            QQH+ADFSRI+MWYIN+QAK FRQT++FT++ +P  NSLING+CRN AGRWKNH  +G 
Sbjct: 471 QQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWKNHTIVGA 530

Query: 526 ETSSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIP 585
           E SS+ QLG++ R +FQRFD  G +  +EPD+RFK F SV++P+IV+STGYEDGIL+YIP
Sbjct: 531 EKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYEDGILLYIP 590

Query: 586 DYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYD 645
           DYTDFIR+RNY++EKTTILFGDI+EYS QRQL ANR+LFQQGR+KV+LYTERLHH+RRY+
Sbjct: 591 DYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERLHHFRRYE 650

Query: 646 IKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGT 705
           IKGVK+VIFYKPP NPEF+ ETVR++ K+AF G  DLNIS VRC+YSKLDG++LERIVGT
Sbjct: 651 IKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLALERIVGT 710

Query: 706 KRAAVLSHAQKEVYEFK 722
           +RAA+L+H   E YEFK
Sbjct: 711 ERAAILTHGPNETYEFK 727

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/708 (58%), Positives = 514/708 (72%), Gaps = 12/708 (1%)

Query: 15  GHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAXXXXXXXXXXXXXXXX 74
           G RKRGR++LR I+R+   + E V+  +I   +EE     D +                 
Sbjct: 14  GSRKRGRKDLRSIRRARNDK-EPVEEPEIPVASEE-----DGELSEDSEEDATNEVQEQE 67

Query: 75  XXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQLEIENGLL 134
                 Y ALLTILKSEHPE ++ + + ++   +   S  +E +E    D++ E+E  L+
Sbjct: 68  DSKEKAYGALLTILKSEHPEDRQRERRKKKQDLQDPSSSDDELSE----DEKGEVEANLV 123

Query: 135 GXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSVKA 194
                                SEDE+DPFESHFN   E  +D L  A+K K I  KS K 
Sbjct: 124 DTPGEEEPQSEEELSEGDEDESEDERDPFESHFNMQSES-IDSLDEAWKQKKIVNKSGKI 182

Query: 195 PLNGDESYIYAQPXXXXXXXXXXXXXXXXXXXXXFLKQRLKIQNGLQDKKIDPLNALQRK 254
            ++ DES IY +                       LK++LKIQN L + + D L  LQRK
Sbjct: 183 RVDDDESLIYTKTLAGKGQEFELPSHKGHLSSYP-LKRKLKIQNNLLESQDDVLTPLQRK 241

Query: 255 LVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRILKNNQRLQDNPDTEHL 314
           +VDP+FQY+D+L               LY LHVLNHIYKTRDRILK+NQRL  NPD E L
Sbjct: 242 IVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRILKDNQRLATNPDGEFL 301

Query: 315 DQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPRSFQ 374
           DQGFTRPKVLIV PTRD AY++V K+I KSG+DQVDKK K  DQF +D LPP SKP+SF+
Sbjct: 302 DQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFR 361

Query: 375 HIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSS 434
           H FKGNTNDFFV+G+KFTRKAI+LYSNFYQSD+IVCSPLG+Q+ILENTD+KKRQDDFLSS
Sbjct: 362 HTFKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSS 421

Query: 435 IEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFRQTMVF 494
           IE+M+IDQL+SIE+QN+SH+ TIF H+NKIP +QH+ DF R+RMWYINEQAK  RQT++F
Sbjct: 422 IELMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIF 481

Query: 495 TKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVEE 554
           T+Y++PT N L+NG+CRN+ GRWKNH  I  E SS+ +LG ++RQIFQR D  G S+V+E
Sbjct: 482 TRYVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDE 541

Query: 555 PDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQ 614
           PDYRF+FFTSV++PSI KSTGYEDGIL+YIPDY DFIR+RNY+K+KTTILFGDINEYS  
Sbjct: 542 PDYRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDV 601

Query: 615 RQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKN 674
           RQL + RSLFQQGR+KV+LYTERLHH+RRY+IKGVKSVIFY+PP+NPEFY+E VR+IGK+
Sbjct: 602 RQLTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKS 661

Query: 675 AFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722
           AF G+TDLNISTVRC+YSKLDG++LERIV +KRAAVL+H Q E+YEFK
Sbjct: 662 AFLGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/737 (58%), Positives = 522/737 (70%), Gaps = 59/737 (8%)

Query: 17  RKRGRQELRKIKRS-------SGRR-------------------TEDVDADKIDYVAEEP 50
           +KRGR +LR I+RS       SGR                     E+ +++  D   EE 
Sbjct: 8   KKRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGEEAESESDDAKDEED 67

Query: 51  VGRNDNDAXXXXXXXXXXXXXXXXXXXXXXYDALLTILKSEHPEPKRMKTKAEES-SDRT 109
           VG+  N                        Y ALLTILKSEHPE K+ K K  +   D  
Sbjct: 68  VGKKRNQV----------------------YGALLTILKSEHPEKKKQKKKFNQEKEDAY 105

Query: 110 TQSDGNENAESEPVDDQLEIENGLLGXXXXXXXXXXXXXXXXXXXXSEDEQDP-FESHFN 168
             SD   N     V D+ EIENGL                        D+    F+ HFN
Sbjct: 106 NASDDEYN-----VSDKQEIENGLEDQQDDNEDENENDMENMENDDESDDDTDLFDIHFN 160

Query: 169 QVPEKDVDDLSNAFKSKNIRY--KSVKAPLNGDESYIYAQPXXXXXXXXXXXX-XXXXXX 225
           QVPE  VD +SN F +K I+Y  K ++ P +  + +IY++P                   
Sbjct: 161 QVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESPIKKSSL 220

Query: 226 XXXFLKQRLKIQNGLQDKKIDPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTL 285
              F+K+RL+I N L D K D L  LQ+ LVDPMFQY DIL               LYTL
Sbjct: 221 DSYFIKKRLEITNNLLDGK-DNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEYRELYTL 279

Query: 286 HVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSG 345
           H+LNH+YKTRD++LK+NQRLQ+N ++E LDQGFTRPKVLIVVPTRD AY VV+ II KSG
Sbjct: 280 HILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVETIIRKSG 339

Query: 346 IDQVDKKGKFYDQFRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQS 405
           +DQV+KKGKF  QF +DSLPP SKP+SFQ IFKGNTNDFFV+GLKFTRKA+KLYSNFYQS
Sbjct: 340 LDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLYSNFYQS 399

Query: 406 DIIVCSPLGIQMILENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIP 465
           D+I+CSPLG+ MI ENTDKKK+QDDFLSSIEI ++DQLHS+EYQNISHI+ IF+HLNKIP
Sbjct: 400 DVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFEHLNKIP 459

Query: 466 DQQHEADFSRIRMWYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGP 525
            +QH+ADFSRIRMWYIN+QA+ FRQTM+FTKY+SPT N++ING+CRN+AGRW+N   +  
Sbjct: 460 REQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRNKIQLTS 519

Query: 526 ETSSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIP 585
           E SS+G+LGLKIRQIFQRFD +G ++ +EPD+RFKFF SV++ SI+KSTGYEDGIL+YIP
Sbjct: 520 EESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDGILVYIP 579

Query: 586 DYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYD 645
           +Y+D++R+RNYMKEKTT+LFGDINEYS QR+LN+NRSLFQQGR+KV+LYTERLHHYRRY+
Sbjct: 580 NYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLHHYRRYE 639

Query: 646 IKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGT 705
           IKGVKSVIFY PP NPEFY+E VRFIGKNAF GN D+NI+TVR +YSKLD +SLERIVGT
Sbjct: 640 IKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSLERIVGT 699

Query: 706 KRAAVLSHAQKEVYEFK 722
           +RAAVLS A+ EVYEFK
Sbjct: 700 QRAAVLSRAENEVYEFK 716

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/724 (57%), Positives = 503/724 (69%), Gaps = 45/724 (6%)

Query: 18  KRGRQELRKIKRSSGRRTE-DVDAD--------KIDYVAEEPV---GRNDNDAXXXXXXX 65
           KRGR+ELR I+R+   + E + DA         +     EE V   G  ++D        
Sbjct: 3   KRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAVEEKVQDDGEKEDDKEQV---- 58

Query: 66  XXXXXXXXXXXXXXXYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDD 125
                          Y+ALLTILKSEH E K    K     D        E    +  +D
Sbjct: 59  ---------------YNALLTILKSEHKEDK---VKTHRDHDEEESEAEEEEQAEDQYND 100

Query: 126 QLEIENGLLGXXXXXXXXXXXXXXXXXXXXSEDEQDPFESHFN-QVPEKDVDDLSNAFKS 184
                                          ++E+DPF++HFN +   K  + L NA K 
Sbjct: 101 AF----ADGESDDEDDDEDEQAQEQEEIESDDEEKDPFDTHFNGEEAAKHGEALGNALKD 156

Query: 185 KNIRYKSVKAPLNG------DESYIYAQPXXXXXXXXXXXXXXXXXXXXXFLKQRLKIQN 238
             +RYKS+K  +         E  I++ P                     FLK+RL+IQN
Sbjct: 157 NKLRYKSIKLKVGSADEDQVQEDAIFSVPYIEGETPKIEDPKLKCSLSSYFLKKRLRIQN 216

Query: 239 GLQDKKIDPLNALQRKLVDPMFQYKDILXXXXXXXXXXXXXXXLYTLHVLNHIYKTRDRI 298
            L D + + L  LQRK+VDPM QYKDIL               LYTLHVLNH+YKTRD+I
Sbjct: 217 NLLDTESNALTDLQRKIVDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKI 276

Query: 299 LKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQ 358
           +KNNQ+LQDNPD+E LDQGFTRPKVLI+ PTRD AY++V K+I KSG+DQVDKKGKF DQ
Sbjct: 277 IKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQ 336

Query: 359 FRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMI 418
           F D S PP SKP+SFQHIFKGNTND+FV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+QMI
Sbjct: 337 FYDPSFPPSSKPKSFQHIFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMI 396

Query: 419 LENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRM 478
           +ENTDKKKRQDDFLSS+E+ +IDQ HSIEYQN +H+ TIFDHLNKIP +QH+ADFSRIRM
Sbjct: 397 VENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRM 456

Query: 479 WYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIR 538
           WYIN+QAKFFRQTM+FTKYISP  NSL+N +CRN+ GRWKNH+ +  E SS+G +GLK+R
Sbjct: 457 WYINDQAKFFRQTMIFTKYISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVR 516

Query: 539 QIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMK 598
           QIFQRF+ +GNS+ +EPDYRFKFFTSV+I +I KSTGY+DG LIYIP+Y+D++R+RNYMK
Sbjct: 517 QIFQRFNVLGNSVADEPDYRFKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMK 576

Query: 599 EKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPP 658
           EKT+ILFGDINEYS QR L +NR+LF QGRLKV+LYTERLHH+RRY++KGVK+V+FYKPP
Sbjct: 577 EKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPP 636

Query: 659 NNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEV 718
           ++PEFY E VR+IGK  F G+ DLNISTVRC YSKLDG++LE+IVGTKR  VL+H Q E 
Sbjct: 637 SDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNET 696

Query: 719 YEFK 722
           YEFK
Sbjct: 697 YEFK 700

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/568 (65%), Positives = 451/568 (79%), Gaps = 3/568 (0%)

Query: 156 SEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSVKAPLNGDESYIYAQPXXXXXXXX 215
           S++EQD F+ HFN+V   DV  L  AFK+   +Y+ V+    G+E  +Y++P        
Sbjct: 139 SDEEQDHFDVHFNRVSAADVAQLDAAFKNGRAQYR-VQKEARGEEEILYSKPVASSEGTE 197

Query: 216 XXXXXXXXXXXXXFLKQRLKIQNGL-QDKKIDPLNALQRKLVDPMFQYKDILXXXXXXXX 274
                         +KQRL++ NGL  D    PL   Q+ L+DPMFQY+DIL        
Sbjct: 198 GPVRVPARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDILYEYEGYDR 257

Query: 275 XXXXXXXLYTLHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDVAY 334
                  LYTLH+LNH+YKTRDRILKNNQ+LQDNPD E LDQGFTRPK L+VVPTR  AY
Sbjct: 258 EREYRE-LYTLHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAY 316

Query: 335 RVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSKPRSFQHIFKGNTNDFFVVGLKFTRK 394
            VVD ++ +SGI+QVDKK KF DQF D SLPP SKP+SFQH+FKGNTNDFFV+G+KFTRK
Sbjct: 317 DVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRK 376

Query: 395 AIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIEIMVIDQLHSIEYQNISHI 454
           AI+LYSNFYQSD+IVCSPLG+Q+I+ENTDKKKRQDDFLSSIE+MV+DQLHSIE+QNI+H+
Sbjct: 377 AIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHV 436

Query: 455 LTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMA 514
             IF H+NKIP QQ +ADFSRIRMWYI +QAK FRQTMVFT+YISP  N+L+N +C N A
Sbjct: 437 SNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWA 496

Query: 515 GRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKST 574
           GR K+HR +  E S IGQLGLK+RQIFQRF+ +G S V+EPD+RFKFFTSV++P I K+T
Sbjct: 497 GRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTT 556

Query: 575 GYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLY 634
           GY+ GIL+YIP+YTDFIR+RNY+K+KT ILFGDINEYS QRQL +NR+LFQ GR+KV+LY
Sbjct: 557 GYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLY 616

Query: 635 TERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLNISTVRCIYSKL 694
           TERLHH+RR+++KGVKSVI YKPP+NPEFY E +R+IGK+AF G  DLNI+TVRC+YSK+
Sbjct: 617 TERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKM 676

Query: 695 DGISLERIVGTKRAAVLSHAQKEVYEFK 722
           D ++LERIVGTKRAAVL+H Q EVYEFK
Sbjct: 677 DSLALERIVGTKRAAVLTHGQNEVYEFK 704

>Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON}
           YDR243C (REAL)
          Length = 587

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 112/272 (41%), Gaps = 39/272 (14%)

Query: 392 TRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIEIMVIDQL--HSIEYQ 449
           T K  K++S     D  V S +G     E +       D L +    +ID L  H +  +
Sbjct: 273 TEKVTKIWSRENNYDCRVISIVGGHSFEEISFSLSEGCDILVATPGRLIDSLDNHLLVMK 332

Query: 450 NISHILTIFDHLNKIPDQQHEADFSRIRMWY-INEQAKFFRQTMVFTKYISPTVNSLING 508
            +  +  + D  +K+ D   E   + I     +N  +   RQT++FT  ++P +  +  G
Sbjct: 333 QVETL--VLDEADKMIDLGFEDQVTNILTKVDVNVDSATNRQTLMFTATMTPVIEKIAAG 390

Query: 509 RCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRFKFFTSVMIP 568
             R        + TIG +T S       IRQ+ +  D          + +FK   SV+I 
Sbjct: 391 YMRKPV-----YATIGLDTGS----EPLIRQVVEYADN--------EEEKFKKLKSVVIK 433

Query: 569 SIVKSTGYEDGILIYI--PDYTDFI--RIRNYMKEKTTILFGDINEYSSQRQLNANRSLF 624
                  YE  I+I+I      D++  R +     K TIL G      SQ Q   +  LF
Sbjct: 434 -------YESPIIIFINYKQTADWLAERFQTETNMKVTILHGS----KSQEQREHSLQLF 482

Query: 625 QQGRLKVMLYTERLHHYRRYDIKGVKSVIFYK 656
           + G++++M+ T      R  DI  V  V+ ++
Sbjct: 483 RTGKVQIMIATNV--AARGLDIPNVSLVVNFQ 512

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 119/294 (40%), Gaps = 39/294 (13%)

Query: 394 KAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIEIMVIDQL--HSIEYQNI 451
           K  K++S     D  V S +G   + E +       D L +    +ID L  H +  + +
Sbjct: 292 KVTKIWSRESNYDCRVVSIVGGHSLEEISYSLSEGCDILVATPGRLIDSLENHLLVMKQV 351

Query: 452 SHILTIFDHLNKIPDQQHEADFSRIRMWY-INEQAKFFRQTMVFTKYISPTVNSLINGRC 510
             +  + D  +K+ D   E   + I     ++  +   RQT++FT  ++P +  +  G  
Sbjct: 352 ETL--VLDEADKMIDLGFEDQVTTILTKVDVSADSATNRQTLMFTATMTPVIEKIAAGYM 409

Query: 511 RNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSI 570
           R        + TIG +T S       I+QI +  D          + +FK   S++    
Sbjct: 410 RKPV-----YATIGVDTGS----EPLIQQIVEYADN--------EEQKFKKLKSIV---- 448

Query: 571 VKSTGYEDGILIYI--PDYTDFI--RIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQ 626
              T YE  I+I+I      D++  R +     + TIL G      SQ Q   +  LF+ 
Sbjct: 449 ---TKYEPPIIIFINYKQTADWLAERFQKETNMRVTILHGS----KSQEQREHSLQLFRS 501

Query: 627 GRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNT 680
           GR++VM+ T      R  DI  V  V+ ++     + Y   +   G+ A  G  
Sbjct: 502 GRVQVMIATNV--AARGLDIPNVSLVVNFQISKKIDDYIHRIGRTGRAAKKGTA 553

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 91/198 (45%), Gaps = 38/198 (19%)

Query: 489 RQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIG 548
           +QT++FT  +S ++  + NG  RN         TIG   S+      +I+QI +      
Sbjct: 349 KQTLMFTATMSSSIERIANGYLRN-----PGFVTIGGSGSAP-----QIQQIIE------ 392

Query: 549 NSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDY---TDFIRIRNYMKE---KTT 602
              V   + RFK  T  ++P+      Y   ++I+I +Y    D++ +R + +E   + T
Sbjct: 393 --YVATDEQRFKMLTQDILPN------YRPPVIIFI-NYKVTADWL-LRKFQEESKFRVT 442

Query: 603 ILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPE 662
           IL G  ++   +  L A    F++G++ +M+ T+     R  DI  V  V+ ++ P+  +
Sbjct: 443 ILHGSKSQTQREHSLKA----FREGKVDIMVATDVAG--RGIDIPNVSLVVNFQMPSKLD 496

Query: 663 FYSETVRFIGKNAFSGNT 680
            Y   +   G+    G T
Sbjct: 497 DYIHRIGRTGRANQKGTT 514

>KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243C PRP28 RNA helicase in the DEAD-box family
           involved in RNA isomerization at the 5' splice site
          Length = 539

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 86/199 (43%), Gaps = 44/199 (22%)

Query: 489 RQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIG 548
           RQTM+FT   SPT+  + NG  +       ++ T+G E S       KI+QI +      
Sbjct: 324 RQTMMFTATFSPTIEKVANGYLKK-----PSYVTVGGEESKP-----KIKQIVR------ 367

Query: 549 NSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEK-------T 601
              V + + + K      +P+      Y+  I+I+I    ++ R  +++ +K        
Sbjct: 368 --YVPDEEEKLKILVKDFLPN------YKAPIIIFI----NYKRTADWLFDKLREARFRA 415

Query: 602 TILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNP 661
           T L G      SQ Q   + SL + G++ +++ T+     R  DI  V  V+  + P + 
Sbjct: 416 TTLHGS----KSQEQREHSLSLLRNGKVDILIATDVAG--RGIDIPNVSLVVNLQFPKS- 468

Query: 662 EFYSETVRFIGKNAFSGNT 680
             +   V  +G+   +G T
Sbjct: 469 --FDSFVHRVGRTGRAGKT 485

>YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}
           PRP28RNA helicase in the DEAD-box family, involved in
           RNA isomerization at the 5' splice site
          Length = 588

 Score = 38.9 bits (89), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 124/308 (40%), Gaps = 44/308 (14%)

Query: 390 KFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIEIMVIDQL--HSIE 447
           K T+K  K++S     D  V S +G   + E +       D L +    +ID L  H + 
Sbjct: 272 KETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENHLLV 331

Query: 448 YQNISHILTIFDHLNKIPDQQHEADFSRIRMWY-INEQAKFFRQTMVFTKYISPTVNSLI 506
            + +  +  + D  +K+ D   E   + I     IN  +   RQT++FT  ++P +  + 
Sbjct: 332 MKQVETL--VLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQTLMFTATMTPVIEKIA 389

Query: 507 NGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRFKFFTSVM 566
            G  +        + TIG ET S       I+Q+ +  D          + +FK    ++
Sbjct: 390 AGYMQKPV-----YATIGVETGS----EPLIQQVVEYADN--------DEDKFKKLKPIV 432

Query: 567 IPSIVKSTGYEDGILIYI--PDYTDFIRIRNYMKE---KTTILFGDINEYSSQRQLNANR 621
                    Y+  I+I+I      D++    + KE   K TIL G      SQ Q   + 
Sbjct: 433 -------AKYDPPIIIFINYKQTADWLA-EKFQKETNMKVTILHGS----KSQEQREHSL 480

Query: 622 SLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTD 681
            LF+  ++++M+ T      R  DI  V  V+ ++     + Y   +  IG+   + N  
Sbjct: 481 QLFRTNKVQIMIATNV--AARGLDIPNVSLVVNFQISKKMDDY---IHRIGRTGRAANEG 535

Query: 682 LNISTVRC 689
             +S V  
Sbjct: 536 TAVSFVSA 543

>TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.469
           YDR243C
          Length = 607

 Score = 38.9 bits (89), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 116/278 (41%), Gaps = 33/278 (11%)

Query: 410 CSPLGIQMILENTDKKKRQDDFLSSIEIMVIDQLHS--IEYQNISHILTIFDHLNKIPDQ 467
            S +G   I E T K  +  D L +    +ID L S  I   +I  +  + D  +K+ D 
Sbjct: 295 VSIVGGYSIEELTFKISKGMDILVATPGRLIDCLESKLIVLNDIETL--VLDEADKMIDL 352

Query: 468 QHEADFSRIRMWYINEQAKFFRQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPET 527
             E   S I  +  + ++K   QT++F+  +SP +  L              H+ I  + 
Sbjct: 353 GFEEQLSTILSYVASYKSKDTVQTIMFSATMSPDIEKLTTSYL---------HKPIFAKV 403

Query: 528 SSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDY 587
            S      +I QI +  +T  ++  +  +  + F + ++I    K T   D +   I + 
Sbjct: 404 GSPKSAIERIEQIVRYSETEESTFDKIKELLYGFDSPIIIFINYKRTA--DWLYKKIQEE 461

Query: 588 TDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIK 647
           T F           TIL G      SQ Q   +  L + G+++VM+ T      R  DI 
Sbjct: 462 TSF---------HATILHGS----KSQDQREHSVKLLKSGKVQVMIATNVAA--RGIDIP 506

Query: 648 GVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLNIS 685
            V  VI ++ P++ E Y   +  IG+   +GN+   +S
Sbjct: 507 NVSLVINFQIPSSFEDY---IHRIGRTGRAGNSGTAVS 541

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 51/115 (44%), Gaps = 6/115 (5%)

Query: 571 VKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLK 630
           V S   E  IL++         I  Y++E        I+    QR+ +   + F++GR  
Sbjct: 354 VASQDKESKILVFASTKRTCDEITKYLREDGWPALA-IHGDKDQRERDWVLAEFREGRSP 412

Query: 631 VMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLNIS 685
           +M+ T+     R  D+KG+  VI Y  P N E Y   V  IG+   +G T   IS
Sbjct: 413 IMVATDVAA--RGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGATGTAIS 462

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score = 35.0 bits (79), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 47/109 (43%), Gaps = 6/109 (5%)

Query: 577 EDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLKVMLYTE 636
           E  ILI+         +  Y++E        I+    QR+ +     F+ GR  +M+ T+
Sbjct: 362 ESKILIFASTKRTCDEVTKYLREDGWPALA-IHGDKDQRERDWVLEEFRSGRSPIMVATD 420

Query: 637 RLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLNIS 685
                R  D+KG+  VI Y  P N E Y   V  IG+   +G T   IS
Sbjct: 421 VAA--RGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGATGTAIS 464

>SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} similar
           to uniprot|P23394 Saccharomyces cerevisiae YDR243C PRP28
           RNA helicase in the DEAD-box family involved in RNA
           isomerization at the 5' splice site
          Length = 566

 Score = 35.0 bits (79), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 87/202 (43%), Gaps = 39/202 (19%)

Query: 489 RQTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIG 548
           RQTM+FT  +SPT+  + +G     A     + TIG E +       +I QI +   +  
Sbjct: 350 RQTMMFTATMSPTIEKIADGYLNKPA-----YVTIGGEETK-----PQITQILEYLPS-- 397

Query: 549 NSIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDY---TDFI--RIRNYMKEKTTI 603
                  + RF   +  ++P       Y   I+I+I +Y    D++  + ++  K +TT 
Sbjct: 398 ------EEKRFLKLSKDILPH------YPAPIIIFI-NYKRTADWLAKKFQDETKYRTTT 444

Query: 604 LFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEF 663
           L G      SQ Q   + +L + G+  +M+ T      R  DI  V  V+ ++     E 
Sbjct: 445 LHGS----KSQEQRENSLNLLRSGKADIMIATNVAG--RGIDIPNVSLVVNFQMATKLED 498

Query: 664 YSETVRFIGKNAFSGNTDLNIS 685
           Y   +  IG+   +G    +I+
Sbjct: 499 Y---IHRIGRTGRAGKEGYSIT 517

>KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129)
           [1665 bp, 554 aa] {ON} similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112W DBP2 Essential
           ATP-dependent RNA helicase of the DEAD-box protein
           family involved in nonsense-mediated mRNA decay and rRNA
           processing
          Length = 554

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 624 FQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLN 683
           F+ GR  +M+ T+     R  D+KG+  VI Y  P N E Y   V  IG+   +G+T   
Sbjct: 406 FRSGRSPIMVATDVA--ARGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGSTGTA 460

Query: 684 IS 685
           IS
Sbjct: 461 IS 462

>TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 aa]
           {ON} Anc_2.164 YNL112W
          Length = 549

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 6/115 (5%)

Query: 571 VKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLK 630
           + S   E  IL++         I  Y+++        I+    QR+ +   + F+ GR  
Sbjct: 350 IASQDKESKILVFASTKRTCDEITKYLRDDGWPALA-IHGDKDQRERDWVLNEFRTGRSP 408

Query: 631 VMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLNIS 685
           +M+ T+     R  D+KG+  VI Y  P N E Y   V  IG+   +G T   IS
Sbjct: 409 IMVATDVAA--RGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGATGTAIS 458

>YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa]
           {ON}  DBP2Essential ATP-dependent RNA helicase of the
           DEAD-box protein family, involved in nonsense-mediated
           mRNA decay and rRNA processing
          Length = 546

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query: 624 FQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLN 683
           F+ GR  +M+ T+     R  D+KG+  VI Y  P N E Y   V  IG+   +G T   
Sbjct: 406 FRNGRSPIMVATDVAA--RGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGATGTA 460

Query: 684 IS 685
           IS
Sbjct: 461 IS 462

>Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 bp,
           560 aa] {ON} similar to Ashbya gossypii AFL221C
          Length = 560

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query: 624 FQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLN 683
           F+ GR  +M+ T+     R  D+KG+  VI Y  P N E Y   V  IG+   +G T   
Sbjct: 416 FRCGRSPIMVATDVA--ARGIDVKGINFVINYDMPGNIEDY---VHRIGRTGRAGATGTA 470

Query: 684 IS 685
           IS
Sbjct: 471 IS 472

>Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 aa]
           {ON} YNL112W (REAL)
          Length = 547

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query: 624 FQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLN 683
           F+ GR  +M+ T+     R  D+KG+  VI Y  P N E Y   V  IG+   +G T   
Sbjct: 406 FRNGRSPIMVATDVAA--RGIDVKGINYVINYDMPGNIEDY---VHRIGRTGRAGATGTA 460

Query: 684 IS 685
           IS
Sbjct: 461 IS 462

>SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [1725
           bp, 574 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 574

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 6/115 (5%)

Query: 571 VKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQRQLNANRSLFQQGRLK 630
           V S   E  IL++         I  Y++E        I+    Q++ +     F+ GR  
Sbjct: 379 VASQDAESKILVFASTKRMCDEITKYLREDGWPALA-IHGDKQQQERDWVLEEFRSGRSP 437

Query: 631 VMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDLNIS 685
           +M+ T+     R  D+KG+  VI Y  P N E Y   V  IG+   +G T   IS
Sbjct: 438 IMVATDVAA--RGIDVKGINFVINYDMPGNIEDY---VHRIGRTGRAGATGTAIS 487

>KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {ON}
           Anc_8.469 YDR243C
          Length = 568

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 97/243 (39%), Gaps = 42/243 (17%)

Query: 452 SHILT-------IFDHLNKIPDQQHEADFSRIRMWYINEQAKFFRQTMVFTKYISPTVNS 504
           SHILT       + D  +K+ D   E   + I      E++    QTM+FT  +S ++  
Sbjct: 310 SHILTLNQVDTLVMDEADKMIDLGFEDQITAILARLSMERSSL--QTMMFTATLSQSIEK 367

Query: 505 LINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGNSIVEEPDYRFKFFTS 564
           + N    +            P    IG    ++ +I Q  +       E  + RFK    
Sbjct: 368 ISNNYLNS------------PIIVKIGSEEDQVPKIQQTVE-----YSENEENRFK---- 406

Query: 565 VMIPSIVKSTGYEDGILIYIPDYTDFI--RIRNYMKEKTTILFGDINEYSSQRQLNANRS 622
             I   +K+      I I      D++  + RN    K TIL G  N+   +  +N    
Sbjct: 407 -QIIKTLKNCSPPIIIFINYKSTADYLTKKFRNETNFKFTILHGSKNQEQREHSIN---- 461

Query: 623 LFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVRFIGKNAFSGNTDL 682
           L + G ++V++ T      R  DI  V  VI ++ P + E Y   +  IG+   +GN   
Sbjct: 462 LLRTGAVQVLIATNV--AARGIDIPNVSLVINFQMPKHFEDY---IHRIGRTGRAGNLGA 516

Query: 683 NIS 685
           +++
Sbjct: 517 SVT 519

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,054,226
Number of extensions: 3221819
Number of successful extensions: 10899
Number of sequences better than 10.0: 46
Number of HSP's gapped: 11112
Number of HSP's successfully gapped: 47
Length of query: 722
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 605
Effective length of database: 40,065,477
Effective search space: 24239613585
Effective search space used: 24239613585
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)