Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.81na 1ON64864828930.0
Suva_9.107na 1ON65766312001e-156
Smik_9.87na 1ON63264610791e-138
YIL092Wna 1ON6336529321e-116
CAGL0J04950g1.331ON81269752.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.81
         (648 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.81 Chr9 (165744..167690) [1947 bp, 648 aa] {ON}  YIL092W ...  1118   0.0  
Suva_9.107 Chr9 (183200..185173) [1974 bp, 657 aa] {ON}  YIL092W...   466   e-156
Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W (...   420   e-138
YIL092W Chr9 (189066..190967) [1902 bp, 633 aa] {ON} Putative pr...   363   e-116
CAGL0J04950g Chr10 complement(472406..474844) [2439 bp, 812 aa] ...    33   2.2  

>Skud_9.81 Chr9 (165744..167690) [1947 bp, 648 aa] {ON}  YIL092W
           (REAL)
          Length = 648

 Score = 1118 bits (2893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/648 (85%), Positives = 553/648 (85%)

Query: 1   MVNKSKTNGGNDTITNGKTLPLRINKGTXXXXXXXXXXXXXXXXNFGLAKPADDEEQVSK 60
           MVNKSKTNGGNDTITNGKTLPLRINKGT                NFGLAKPADDEEQVSK
Sbjct: 1   MVNKSKTNGGNDTITNGKTLPLRINKGTCRSRRKKSVVSSIKCKNFGLAKPADDEEQVSK 60

Query: 61  ILDKMNHLKKFSADEGDDESLFVQWIDDISNTLSGLWCTGTFLKLLISSALSGRAKKWFD 120
           ILDKMNHLKKFSADEGDDESLFVQWIDDISNTLSGLWCTGTFLKLLISSALSGRAKKWFD
Sbjct: 61  ILDKMNHLKKFSADEGDDESLFVQWIDDISNTLSGLWCTGTFLKLLISSALSGRAKKWFD 120

Query: 121 LTTEGIDDHLMKTYTLENFLALLSGEFDGAXXXXXXXXXXXXXXPIDSETSLEKFANISG 180
           LTTEGIDDHLMKTYTLENFLALLSGEFDGA              PIDSETSLEKFANISG
Sbjct: 121 LTTEGIDDHLMKTYTLENFLALLSGEFDGARFLRRERFSELLNLPIDSETSLEKFANISG 180

Query: 181 LLTPYYXXXXXXXXXXXXXXGPCLQKQLKSSAFPMTLDVALLMAACEFAKGASIERNDIN 240
           LLTPYY              GPCLQKQLKSSAFPMTLDVALLMAACEFAKGASIERNDIN
Sbjct: 181 LLTPYYLSSSATLDLLLTKLGPCLQKQLKSSAFPMTLDVALLMAACEFAKGASIERNDIN 240

Query: 241 DNIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDFEKDVRKGYNNEMEPQIPSCKRRK 300
           DNII                              IDFEKDVRKGYNNEMEPQIPSCKRRK
Sbjct: 241 DNIISSGATSSKKKKSTFKDSKKYKAKTTKGTTDIDFEKDVRKGYNNEMEPQIPSCKRRK 300

Query: 301 QSEHCTQLSLAMTKNAETLPSENALANTYAPRKVRSSSNNSLDSFAPLKSNKHQSYVVNA 360
           QSEHCTQLSLAMTKNAETLPSENALANTYAPRKVRSSSNNSLDSFAPLKSNKHQSYVVNA
Sbjct: 301 QSEHCTQLSLAMTKNAETLPSENALANTYAPRKVRSSSNNSLDSFAPLKSNKHQSYVVNA 360

Query: 361 IAXXXXXXXXXXXXXXXXXXXXXEYTRDKTIFYDKPTDEPSLSSSGGNYAARRDTLHSMT 420
           IA                     EYTRDKTIFYDKPTDEPSLSSSGGNYAARRDTLHSMT
Sbjct: 361 IATLDSDRTFTSTTSTALADDKSEYTRDKTIFYDKPTDEPSLSSSGGNYAARRDTLHSMT 420

Query: 421 STPFKDSVQVPNPRLKDISGGDVSNRHTTRPYQAMHIFSRSALVVNDQTVKKTQFIKSNQ 480
           STPFKDSVQVPNPRLKDISGGDVSNRHTTRPYQAMHIFSRSALVVNDQTVKKTQFIKSNQ
Sbjct: 421 STPFKDSVQVPNPRLKDISGGDVSNRHTTRPYQAMHIFSRSALVVNDQTVKKTQFIKSNQ 480

Query: 481 IEDIINSNPFTSNKNEKKVKALKGLETPIASVQVNELSCFVDLEKPRSANIENKRSELLT 540
           IEDIINSNPFTSNKNEKKVKALKGLETPIASVQVNELSCFVDLEKPRSANIENKRSELLT
Sbjct: 481 IEDIINSNPFTSNKNEKKVKALKGLETPIASVQVNELSCFVDLEKPRSANIENKRSELLT 540

Query: 541 QKFYPLHNFAVRTRNAQFSERPSNYTSAHGIKGNIRPLSTNIQKIQSFSRSGSRKADTNT 600
           QKFYPLHNFAVRTRNAQFSERPSNYTSAHGIKGNIRPLSTNIQKIQSFSRSGSRKADTNT
Sbjct: 541 QKFYPLHNFAVRTRNAQFSERPSNYTSAHGIKGNIRPLSTNIQKIQSFSRSGSRKADTNT 600

Query: 601 EVISSHMLVQHKRSVNSENREGNRTFNDVTNPFLANTMSGRKQSNYYM 648
           EVISSHMLVQHKRSVNSENREGNRTFNDVTNPFLANTMSGRKQSNYYM
Sbjct: 601 EVISSHMLVQHKRSVNSENREGNRTFNDVTNPFLANTMSGRKQSNYYM 648

>Suva_9.107 Chr9 (183200..185173) [1974 bp, 657 aa] {ON}  YIL092W
           (REAL)
          Length = 657

 Score =  466 bits (1200), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 295/663 (44%), Positives = 367/663 (55%), Gaps = 21/663 (3%)

Query: 1   MVNKSKTNGGNDTITNGKTLPLRINKGTXXXXXXXXXXXXXXXXNFGLAKPADDEEQVSK 60
           MVNKSK NGGN     G     R NK                  NFG+A+  DDE+QVS 
Sbjct: 1   MVNKSKFNGGN-----GNAPSSRNNKKKYNNYRKKSVASSVRCENFGIARTDDDEKQVSM 55

Query: 61  ILDKMNHLKKFSADEGDDESLFVQWIDDISNTLSGLWCTGTFLKLLISSALSGRAKKWFD 120
           I DKMNHLKKFSA+E DD++LFVQW DDI++TLSGLW TGTFLKLLISSAL+GRAKKWFD
Sbjct: 56  IFDKMNHLKKFSAEEDDDKNLFVQWSDDITDTLSGLWWTGTFLKLLISSALTGRAKKWFD 115

Query: 121 LTTEGIDDHLMKTYTLENFLALLSGEFDGAXXXXXXXXXXXXXXPIDSETSLEKFANISG 180
            TTEGIDDH ++TYTLE FLALLSGEFDG                I+SETSLEKFA IS 
Sbjct: 116 STTEGIDDHSIRTYTLEKFLALLSGEFDGVRVLRRESFAELLKLSINSETSLEKFAKISE 175

Query: 181 LLTPYYXXXXXXXXXXXXXXGPCLQKQLKSSAFPMTLDVALLMAACEFAKGASIERNDIN 240
            LTPYY               PCLQKQL  +AFPMTLD+ALL+AACEFAKG S ER D N
Sbjct: 176 FLTPYYLSSSAALDLFLTKLKPCLQKQLGDAAFPMTLDIALLVAACEFAKGTSEERKDKN 235

Query: 241 DNIIXXXXXXX------XXXXXXXXXXXXXXXXXXXXXXXID--FEKDVRKGYNNEMEPQ 292
                                                   ID   +K   K   NE E Q
Sbjct: 236 AENNNNNNDSNPIDLDPSTRKKRDTVKTNKKCKRKSIHENIDNAIKKSNGKKNVNEEELQ 295

Query: 293 IPSCKRRKQSEHCTQLSLAMTKNAETLPSENALANTYAPRKVRSSSNNSLDSFAPLKSNK 352
           +   KRR+Q+E   Q+SL     A+ LP    ++N  A  K  ++S +SLDS+  LKSN 
Sbjct: 296 VLHPKRRRQNESGKQISLPTAALADILPLNQNISNINASNKQFNAS-SSLDSYTSLKSNS 354

Query: 353 HQSYVVNA--IAXXXXXXXXXXXXXXXXXXXXXEYTRDKTIFYDKPTDEPSLSSSGGNYA 410
            Q ++ N   I                      E  +++T  +D+  ++  LS +  N  
Sbjct: 355 FQHHLTNETPILDGNRSFPITTPAVASLAYDKVENIKNETNIHDEAINDIPLSLASSNDF 414

Query: 411 ARRDTLHSMTSTPFKDSVQVPNPRLKDISGGDVSNRHTTRPYQAMHIFSRSALVVNDQTV 470
            ++    SM+    + +V VPN  +K    GD SN    R   A H+ S S +    QT 
Sbjct: 415 VKKSVAESMSWKSIRGNVGVPNSNVKSFLRGDESNHQMARRSHATHVSSHSNIFKPAQTA 474

Query: 471 ----KKTQFIKSNQIEDIINSNPFTSNKNEKKVKALKGLETPIASVQVNELSCFVDLEKP 526
                KT F ++N+I +I   NPFT N+N  K    KG + P+ SV+VN+ S F+DLEKP
Sbjct: 475 CYDSNKTNFTENNKIGEINKLNPFTKNENTIKSDKSKGPKNPVTSVKVNKPSYFIDLEKP 534

Query: 527 RSANIENKRSELLTQKFYPLHNFAVRTRNAQFSERPSNYTSAHGIKGNIRPLSTNIQKIQ 586
           +S + EN+   LL QK YPLHNFAVRTRNA+F++RPSNYTSAHG    I PLS  I  IQ
Sbjct: 535 QSMHNENRSVGLLAQKSYPLHNFAVRTRNARFNDRPSNYTSAHGNLNAIHPLSLKINNIQ 594

Query: 587 SFSRSGSRKADTNTEVISSHMLVQHKRSVNS-ENREGNRTFNDVTNPFLANTMSGRKQSN 645
             S+ G R+ADTN EV    M VQ K +VNS   ++ +   N V NPFL NT++  K ++
Sbjct: 595 CLSKPGKREADTNKEVNVPKMTVQEKGTVNSIIAKDNDGRSNSVENPFLGNTLNETKLNS 654

Query: 646 YYM 648
           YY+
Sbjct: 655 YYI 657

>Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W
           (REAL)
          Length = 632

 Score =  420 bits (1079), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 266/646 (41%), Positives = 353/646 (54%), Gaps = 18/646 (2%)

Query: 1   MVNKSKTNGGNDTITNGKTLPLRINKGTXXXXXXXXXXXXXXXXNFGLAKPADDEEQVSK 60
           M +KS TN G+  +TNG  L  R +K                  NFG+A+ ADDE+Q S 
Sbjct: 1   MADKSSTNDGDSLVTNGHILSQRGSKKAYNKCKKKNVAPSIRWKNFGVARQADDEQQASL 60

Query: 61  ILDKMNHLKKFSADEGDDESLFVQWIDDISNTLSGLWCTGTFLKLLISSALSGRAKKWFD 120
           ILDKM+HLKKFS++EGDDE+LFVQW DDI++TLSGLWCTG FLKLLISSALSGRAK+WFD
Sbjct: 61  ILDKMSHLKKFSSNEGDDENLFVQWADDITDTLSGLWCTGIFLKLLISSALSGRAKEWFD 120

Query: 121 LTTEGIDDHLMKTYTLENFLALLSGEFDGAXXXXXXXXXXXXXXPIDSETSLEKFANISG 180
            T EGIDD+++  YTLE FLALLS EFDGA              PIDSE SLE F+ IS 
Sbjct: 121 STLEGIDDNVVNAYTLEKFLALLSEEFDGAKLLRRERFTKLLRLPIDSEKSLETFSYISE 180

Query: 181 LLTPYYXXXXXXXXXXXXXXGPCLQKQLKSSAFPMTLDVALLMAACEFAKGASIERNDIN 240
            LTPYY               P  QK+L++S FPMTLD+ALLM ACEFAK AS  R D  
Sbjct: 181 HLTPYYLSTSAALDLFLTKLEPQFQKELENSVFPMTLDMALLMTACEFAKRASSHRKDRK 240

Query: 241 DNIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDFEKDVRKGYNNEMEPQIPSCKRRK 300
            N                                    K  RK   +E E  IP  KRRK
Sbjct: 241 KNTSDFDIGTSKKRATNLNKKCKTKIIRENNTN----RKSNRKKCFSEKELLIPDLKRRK 296

Query: 301 QSEHCTQLSLAMTKNAETLPSENALA-NTYAPRKVRSSSNNSLDSFAPLKSNKHQSYVVN 359
           QSE   Q  L + ++ E  PSE  ++ N    +  +S+ +N  D  A LK  K Q Y  +
Sbjct: 297 QSECGIQFPLVVPEHKE-FPSERKVSVNVCISKNGQSNLSNPPDFHAYLKDTKSQQYADS 355

Query: 360 AIAXXXXXXXXXXXXXXXXXXXXXEYTRDKTIFYDKPTDEPSLSSSGGNYAARRDTLHSM 419
           A +                        +++   Y++PTD    S    N A + +TL  M
Sbjct: 356 ATSNLINNRLISCTATDKLIGGKVVTMKNENTAYNEPTDGRPSSLENRNRAVKENTLQFM 415

Query: 420 TSTPFKDSVQVPNPRLKDISGGDVSNRHTTRPYQAMHIFSRSALVVNDQTVKKTQFIKSN 479
           +S  FK+  ++ + R + ISGG++    T    Q MH+FSR   +  D   +  +   SN
Sbjct: 416 SSNSFKECGKIHDSRTRSISGGNM----TISSSQTMHMFSRPGSLAIDHQARNNEVSMSN 471

Query: 480 QIEDIINSNPFTSNKNEKKVKALKGLETPIASVQVNELSCFVDLEKP-RSANIENKRSEL 538
           +I+ + N NPFT+N     +K  K  +   AS+++++LS  V L+   R+   EN+  +L
Sbjct: 472 RIKVVDNYNPFTAN-----LKVSKSSKNVPASMRMDDLSGTVGLKNALRTTYEENESYQL 526

Query: 539 LTQKFYPLHNFAVRTRNAQFSERPSNYTSAHGIKGNIRPLSTNIQKIQSFSRSGSRKADT 598
            ++K YPL+NFAVRTRNA F++RPSNYTSAH I     P S++I  IQ F+R  S++   
Sbjct: 527 SSKKSYPLNNFAVRTRNAHFNDRPSNYTSAHAITSVTYPSSSSISTIQCFTRPNSKEPSP 586

Query: 599 NTEVISSHMLVQHKRSVNSENREG-NR-TFNDVTNPFLANTMSGRK 642
              +ISS M+ Q K   N++++E  NR +FN+VTNPFL N +   K
Sbjct: 587 KKVIISSCMVAQKKELANTKSKEAKNRSSFNEVTNPFLVNVIEKNK 632

>YIL092W Chr9 (189066..190967) [1902 bp, 633 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm and to
           the nucleus
          Length = 633

 Score =  363 bits (932), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 250/652 (38%), Positives = 340/652 (52%), Gaps = 34/652 (5%)

Query: 1   MVNKSKTNGGNDTITNGKTLPLRINKGTXXXXXXXXXXXXXXXXNFGLAKPADDEEQVSK 60
           M  +S TN  +DTI NG TLP R  KG                 NF + +  DD+EQ  K
Sbjct: 9   MAYESGTNNYSDTIANGNTLPPRSKKG-HSGRRKRSETLPIACNNFCVTRQIDDDEQAFK 67

Query: 61  ILDKMNHLKKFSADEGDDESLFVQWIDDISNTLSGLWCTGTFLKLLISSALSGRAKKWFD 120
           +LDK++HLKKFSA++GDD ++FVQW DDI++ L GL CTGTFLKLLISSALSGRAK WFD
Sbjct: 68  MLDKVSHLKKFSAEDGDDNNIFVQWADDITDILFGLCCTGTFLKLLISSALSGRAKTWFD 127

Query: 121 LTTEGIDDHLMKTYTLENFLALLSGEFDGAXXXXXXXXXXXXXXPIDSETSLEKFANISG 180
            TTEGIDDH++K Y+ E FLALLS EFDGA               IDSE SLE FA+ SG
Sbjct: 128 STTEGIDDHVIKAYSFEKFLALLSEEFDGARSLRREIFTELLTLSIDSEKSLEAFAHKSG 187

Query: 181 LLTPYYXXXXXXXXXXXXXXGPCLQKQLKSSAFPMTLDVALLMAACEFAKGASIER---- 236
            LTPYY               P LQKQL++ AFPMTL++ALL+ ACEFAK AS  +    
Sbjct: 188 RLTPYYLSSGAALDLFLTKLEPQLQKQLENCAFPMTLNLALLITACEFAKRASNHKKYRY 247

Query: 237 NDINDNIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDFEKDVRKGYNNEMEPQIPSC 296
            +  D+ I                                 EK  +K Y ++    IP  
Sbjct: 248 KNTRDSDICTPKSKNTAIVSKLSNTKTISKNKV-------IEKSDKKNYFDKNSQHIPDP 300

Query: 297 KRRKQSEHCTQLSLAMTKNAETLPSENALANTYAPRKVRSSSNNSLDSFAPLKSNKHQSY 356
           KRRKQ+E   +L L M +    L S N  AN Y     ++   N  D    LK++K Q  
Sbjct: 301 KRRKQNEPGMRLFLVMDEEKNILTSRNVSANAYTS---KNGHTNLSDLHTNLKNSKSQQC 357

Query: 357 VVNAIAXXXXXXXXXXXXXXXXXXXXXEYTRDKTIFYDKPTDEPSLSSSGGNYAARRDTL 416
            V  I+                       T+++T  YD+  D  S S +    A ++++L
Sbjct: 358 AVEPISILNSGSLVTGTINIDLINDEVLGTKEETTTYDERMDGNSRSLNERCCAVKKNSL 417

Query: 417 HSMTSTPFKDSVQVPNPRLKDISGGDVSNRHTTRPYQAMHIFSRSALVVNDQTVKKTQFI 476
             +TS  F+ + ++   ++  +    +SN  ++  Y  M   + SA V N   VKK +  
Sbjct: 418 QPITSNIFQKNAEIQGTKIGSVLDSGISNSFSSTEY--MFPPTSSATVSN--PVKKNEIS 473

Query: 477 KSNQIEDIINSNPFTSNKNEKKVKALKGLETPIASVQVNELSCFVDLEK-PRSANIENKR 535
           KS+Q++DI   NPF +N+ EKK+   +  ++P  S+++N LS    L   P +   ++K 
Sbjct: 474 KSSQVKDIAQFNPFMTNEKEKKLNPSESFKSPGVSMEINRLSRIAGLRNIPGNIYEDSKM 533

Query: 536 SELLTQKFYPLHNFAVRTRNAQFSERPSNYTSAH-GIKGNIRPLSTNIQKIQSFSRSGSR 594
             L T+K YPLHNFAVRTR+A F++RPSNY S H  I   +R  ++    IQ  +RS   
Sbjct: 534 LNLKTRKCYPLHNFAVRTRSAHFNDRPSNYISPHETINATLRSPAS-FDSIQCITRSKRV 592

Query: 595 KADTNTEVISSHMLVQHKRSVNSENRE-GNRTFNDVTNPFLANTMSGRKQSN 645
            A+TN          +   S  SEN E  +R F +V NPFL NT + +K+S+
Sbjct: 593 DAETN----------KATGSAKSENIETKSRKFPEVINPFLVNT-TNKKESD 633

>CAGL0J04950g Chr10 complement(472406..474844) [2439 bp, 812 aa]
           {ON} weakly similar to uniprot|P47046 Saccharomyces
           cerevisiae YJL051w
          Length = 812

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 15/69 (21%)

Query: 391 IFYDKPTDEPSLSSSGGNYAARRDTLHSMTSTPFKDSVQVPNPRLKDISGGDV----SNR 446
           + YD P+++ S SS           +H++ +T F+  V +PNP L+++SGG +    S+ 
Sbjct: 737 VMYDFPSNQNSKSSF---------QVHNINTTRFE--VNIPNPELREVSGGTIETSLSDE 785

Query: 447 HTTRPYQAM 455
               P QAM
Sbjct: 786 TERYPEQAM 794

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,171,497
Number of extensions: 2435366
Number of successful extensions: 7007
Number of sequences better than 10.0: 29
Number of HSP's gapped: 7272
Number of HSP's successfully gapped: 32
Length of query: 648
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 532
Effective length of database: 40,180,143
Effective search space: 21375836076
Effective search space used: 21375836076
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)