Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.802.290ON26426414150.0
Suva_9.1062.290ON26426412791e-180
Smik_9.862.290ON26426412641e-178
YIL093C (RSM25)2.290ON26426412581e-177
SAKL0E07590g2.290ON2602398191e-110
KLTH0G10450g2.290ON2612588041e-108
ZYRO0A01958g2.290ON2632668021e-107
TBLA0B059602.290ON2662557901e-106
Kwal_27.115092.290ON2612387901e-106
Ecym_33292.290ON2582577851e-105
NDAI0B035402.290ON2612537821e-104
KLLA0E08273g2.290ON2612467791e-104
TDEL0G022002.290ON2612427711e-103
KAFR0J013502.290ON2642497691e-102
Kpol_1003.402.290ON2612457681e-102
NCAS0B062402.290ON2602427651e-102
CAGL0D04158g2.290ON2722747591e-101
TPHA0C034202.290ON2682447257e-96
KNAG0A054102.290ON2662426892e-90
ADL211C2.290ON2251926402e-83
KAFR0B065106.8ON50850760.44
Suva_4.5311.323ON54557702.5
KAFR0C042301.323ON63557702.5
AGL189C8.315ON179109663.8
Suva_13.4688.845ON141881675.7
TPHA0C048708.865ON139590675.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.80
         (264 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   549   0.0  
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   497   e-180
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   491   e-178
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   489   e-177
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   320   e-110
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   314   e-108
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   313   e-107
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   308   e-106
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   308   e-106
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   306   e-105
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   305   e-104
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   304   e-104
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   301   e-103
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   300   e-102
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   300   e-102
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   299   e-102
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   296   e-101
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   283   7e-96
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   270   2e-90
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   251   2e-83
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...    34   0.44 
Suva_4.531 Chr4 complement(914403..916040) [1638 bp, 545 aa] {ON...    32   2.5  
KAFR0C04230 Chr3 complement(840166..842073) [1908 bp, 635 aa] {O...    32   2.5  
AGL189C Chr7 complement(342535..343074) [540 bp, 179 aa] {ON} Sy...    30   3.8  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...    30   5.7  
TPHA0C04870 Chr3 (1052610..1056797) [4188 bp, 1395 aa] {ON} Anc_...    30   5.9  

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/264 (100%), Positives = 264/264 (100%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
           DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240

Query: 241 SWKDDTTLDTAQDEEPTTAENLHF 264
           SWKDDTTLDTAQDEEPTTAENLHF
Sbjct: 241 SWKDDTTLDTAQDEEPTTAENLHF 264

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  497 bits (1279), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 236/264 (89%), Positives = 248/264 (93%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQTNAVNVLQRTSAYLKSGLLK+TPAWYNVVASIPPSTKFTREPRF NPSNG  IG+L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            DVT+RQ AN NGLYKTRPN ND+RV VKKLYKPPKLTYVEDRLR LFYKQHPWELSRPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           ILVENE+GDE+YDW  MLQLGK LDGESV+QRTMHLLKT+QY+DMVEAYD ARYEFYALR
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           M+EETQQQVALEEAEMFGSIFGVS+IEHGIQKEQEVLDVWEKKVIEETELMAA+SSNPAG
Sbjct: 181 MEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSNPAG 240

Query: 241 SWKDDTTLDTAQDEEPTTAENLHF 264
           SWKDD TLDTAQDEEP T ENLHF
Sbjct: 241 SWKDDATLDTAQDEEPVTTENLHF 264

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  491 bits (1264), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 234/264 (88%), Positives = 245/264 (92%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQTNAVNVLQRTSAYLKSGLLK+TPAWYNVVASIPPSTKFTREP F NPSNG TIG L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            DV + QH N NGLYKTRPNTNDKR+ VKKLYKPPKLTYVEDRLR LFYKQHPWELSRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           ILVENEIGDEDYDW  MLQLGKPLDGESV+QRTM+LLKTKQYE+ VEAYD ARYEFYALR
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           MQEETQQQVALEEAEMFGSIFG SAIEHGIQKEQEVL++WEKKVIEETELMAA+SSNPAG
Sbjct: 181 MQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNPAG 240

Query: 241 SWKDDTTLDTAQDEEPTTAENLHF 264
           SWKDDTTL TAQ+EE  TAE+LHF
Sbjct: 241 SWKDDTTLHTAQEEESNTAESLHF 264

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  489 bits (1258), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 229/264 (86%), Positives = 251/264 (95%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRF NPSNG  IG+L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            DVT++ HAN  GLYKTRPN++DKRV VK+LY+PPKLTYVEDRLR+LFYKQHPWELSRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           ILVENEIGDE+YDW  MLQ+G+PLDGESV+QRTM+L+KTKQY DMVEAYD ARYEFYALR
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           MQEET+QQVALEEAEMFGS+FGVSAIEHGIQKEQEVLDVWEKKV+EETELMAA++SNPAG
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG 240

Query: 241 SWKDDTTLDTAQDEEPTTAENLHF 264
           SWKDDTTL+TAQ+EE TT+ENLHF
Sbjct: 241 SWKDDTTLNTAQEEESTTSENLHF 264

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  320 bits (819), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 148/239 (61%), Positives = 191/239 (79%), Gaps = 2/239 (0%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MK+QTNAVN+L+RTSAYL++GLL + PAWYNVVAS+PPS  F REP+  NPSN   I  L
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            + ++     KNG YKTR + +D++VS  KLYK PKL Y ED+LR LFY+QHPWELSRPK
Sbjct: 61  SEYSETVGI-KNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPK 119

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           +L+EN  G+E YDW  + QLGKPLDGESVVQRT++LLK K+   +V AYD AR+EFY +R
Sbjct: 120 VLIEN-TGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVR 178

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPA 239
           +Q+E  +QVA EEAEMFGS+FG S+IE+G++KEQ+V++ W+KK I++TELMAA+SS P+
Sbjct: 179 VQQEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPS 237

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  314 bits (804), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 147/258 (56%), Positives = 202/258 (78%), Gaps = 9/258 (3%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MK+Q NAVNVL+RTS+YLK+GLLK+TPAWY+VVA +PPS +F REPR  NPS      +L
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            +  + Q++ +N  YKTR + ++++VS  KL+  PKL Y ED+LR +FY+QHPWELSRPK
Sbjct: 61  SEFAE-QYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPK 119

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           +LVEN  G  DYDW  + QLGKPLDGESVVQRT++LL+TK +++++ AYD AR+EFY LR
Sbjct: 120 MLVENS-GTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLR 178

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           +QEE Q QVA EEAEMFGS+FG SAI+ G++KEQ+++DVW++K I++TE+M+A++ NP+ 
Sbjct: 179 IQEEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSE 238

Query: 241 SWKDDTTLDTAQDEEPTT 258
           SW       +AQ+ +P +
Sbjct: 239 SW-------SAQESQPQS 249

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  313 bits (802), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 153/266 (57%), Positives = 200/266 (75%), Gaps = 5/266 (1%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MK+QTNAVNVL+RTSAYL+SGLL+ETPAWY VVAS+PP+TKFTRE RF NPS G    + 
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            +  +    N+ G YKTR ++ D++    +LYK PKL ++ED+LR +FY+QHPWE SRPK
Sbjct: 61  KEFDE--GINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPK 118

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           +LVENEI +E++DW  M QLGKPLDGESVVQRT++LL+      +++AYD  R+EFY LR
Sbjct: 119 MLVENEI-NENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLR 177

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           MQEE +QQVA EEAEMFGS+F  SAI++G+++EQ V+DVW++K IEETEL+AA+ ++PA 
Sbjct: 178 MQEEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAE 237

Query: 241 SWKDDTTLD--TAQDEEPTTAENLHF 264
           SW  +         DE+    E LH 
Sbjct: 238 SWGQEKQEGEPNKSDEDGQETEELHL 263

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  308 bits (790), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 150/255 (58%), Positives = 198/255 (77%), Gaps = 5/255 (1%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQ NAVNVL+RTSAYL++G++K+ P WY+VVA+ PPS KFTREP+F NPS      E 
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  DDVTQRQHANKN-GLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRP 119
             +  + + N+  GLYKTR N+ DK+ +V  LYK PKLTY+ED+LR LFY+QHPWEL+RP
Sbjct: 61  KPL--KDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRP 118

Query: 120 KILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYAL 179
           KI++EN  G+  YDW R+LQLGKPLDGESVVQRT+ LLKTK++  +++AY+ AR+EFY L
Sbjct: 119 KIVMENH-GEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRL 177

Query: 180 RMQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPA 239
           RM EE Q+QVA EE+EMFG++FG + IE GI+KEQE++D W+ + I+ETE+  AK S  +
Sbjct: 178 RMAEEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKES 237

Query: 240 GSWKDDTTLDTAQDE 254
            SWK D +L+  +DE
Sbjct: 238 VSWKTD-SLEGKEDE 251

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  308 bits (790), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 145/238 (60%), Positives = 193/238 (81%), Gaps = 4/238 (1%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MK+Q NAVNVL+RTS+YL++G+LK+TPAWY VVA IPPS +F REPR  NPS  D I +L
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  DDVTQRQHAN-KNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRP 119
            +   R+  N +N  YKTR +  DK+VS  KLYK PKL Y ED+LR LF++QHPWELSRP
Sbjct: 61  SEF--RESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRP 118

Query: 120 KILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYAL 179
           K+LVEN  G +DYDW  + QLGKPLDGESVVQRT++LLK+K++++++ AYD AR+EFY L
Sbjct: 119 KMLVENS-GIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRL 177

Query: 180 RMQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSN 237
           R+QEE Q QVA EEAEM GS+FG SAI+ G++KEQ+++DVW++K I+++EL++A+++N
Sbjct: 178 RIQEEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNTN 235

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  306 bits (785), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/257 (55%), Positives = 198/257 (77%), Gaps = 4/257 (1%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQTNA N+L+RTS++L+ GLL  TP WY+V+   PPSTKF R+P+  NPS G    +L
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            + +  ++++ +G YKTR N ++KRVS   +Y+ PKL Y ED+LR+LFYKQHPWELSRPK
Sbjct: 61  REFSDNRNSS-SGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPK 119

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           ILVEN+ GDE +DW R+ QLGKPLDGESVVQRT++LL + ++ ++++AYD AR+EFY LR
Sbjct: 120 ILVENQ-GDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLR 178

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           MQ+E ++QVA EEA M GS+FG SA+E G++KEQEV+D W+KK +++ ELM+AK S+ + 
Sbjct: 179 MQQELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQSA 238

Query: 241 SW--KDDTTLDTAQDEE 255
           +W  ++D   D  + EE
Sbjct: 239 NWGTREDNANDAVEIEE 255

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  305 bits (782), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 191/253 (75%), Gaps = 3/253 (1%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQTNAVN+++RTSAYL SGLL+ TPAWY+VVASIPP+ KFTREP+  NP+ G      
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            D   R   N  GLYKTR N  D++ S   LYKPPKL Y+EDRLR+LF++QHPWELSRPK
Sbjct: 61  KD--DRIRVNNKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPK 118

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           IL+EN + +E++DW  + Q  K LDGESVVQRT++LLK +   +M++AY+ AR+EFY LR
Sbjct: 119 ILIENSL-EENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLR 177

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           +Q++  QQVA EEAEMFGSIF  ++ EHGI+KEQ+V++ W+KK I+ET+LM  +SSNP+ 
Sbjct: 178 IQQDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSD 237

Query: 241 SWKDDTTLDTAQD 253
           SW      D  +D
Sbjct: 238 SWAAPEEQDLEED 250

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  304 bits (779), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 144/246 (58%), Positives = 197/246 (80%), Gaps = 1/246 (0%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MK+Q  AVNVL+RTSAYLKSG+LK+TPAWYNV+A +PP+ KF R P+  +P NG +   L
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            D +  + AN +GLYKTRPN+ +K+    KLY+ PKL Y+ED+LR LF++QHPWELSRPK
Sbjct: 61  PDYSNWK-ANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPK 119

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           ILVEN +  ++YDW  + QLGKPLDGESVVQRT+ LLK+ + +++++AYD AR+EFY LR
Sbjct: 120 ILVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLR 179

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           +Q+E Q QVA EEAEMFGS+F  ++IE+GI KEQ+V+D W++K +++ ELMAA++S+P+ 
Sbjct: 180 IQQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSA 239

Query: 241 SWKDDT 246
           SW ++T
Sbjct: 240 SWTNET 245

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  301 bits (771), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 149/242 (61%), Positives = 193/242 (79%), Gaps = 3/242 (1%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQTNAVNVL+RTSAYL+SGLL+ TPAWY+VVASIPP TKFTREPR  NPSN   +  L
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            D       N  G +KTR +T DK+++  KLY+ PKL +VED+LR +FYKQHPWELSRPK
Sbjct: 61  KD--HADEPNAKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPK 118

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           +LVEN+  +E++DW  + QL KPLDGESV+QRT+ LLK  + + + EAYD AR+EFY LR
Sbjct: 119 VLVEND-AEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLR 177

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           MQ+E +QQVA EE+EMFGSI+G SAI+ G+Q+EQ+ +D+W++K IEET+L+AA+ +NP+ 
Sbjct: 178 MQQEVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSE 237

Query: 241 SW 242
           +W
Sbjct: 238 AW 239

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  300 bits (769), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 188/249 (75%), Gaps = 2/249 (0%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQTNA N+L+RTSAYL++GLL+  PA+Y+V+A +PPSTKFTREP+  NPS G      
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            ++T +   N  GLYKTR   +D+  SV +LYK  +L Y+ED LR LFY QHPWELSRPK
Sbjct: 61  RELTDK--VNWRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPK 118

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           I++EN I +   DW  + QLGKP+DGESVVQRT+ L+K K+++++ + YD AR+EFY +R
Sbjct: 119 IVIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVR 178

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           MQ ++++Q+A EEA MFGSIFG +A+E+GIQ+EQ+V+  W+++ I ETEL+ AK +NP+ 
Sbjct: 179 MQRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSD 238

Query: 241 SWKDDTTLD 249
           SW  + + D
Sbjct: 239 SWAQEESSD 247

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  300 bits (768), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 151/245 (61%), Positives = 187/245 (76%), Gaps = 3/245 (1%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQ NAVNVL+RTSAYL++GLL + PAWYNVVAS+PP  KF R P+  NPSN    G+L
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
             +     A  NG++KTR    D+  + K+LY   KLTY+ED+LR +FYKQHPWELSRPK
Sbjct: 61  HSLDS--SAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPK 118

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           IL+EN  GDE YDW  M Q+GKPLDGESVVQRT++L+K K+   +V AYD ARYEFY LR
Sbjct: 119 ILIENN-GDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLR 177

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           MQ+  ++QVA EEAEMFGS+FG SAIE+GIQKEQ+V+D W++K I +TE+MAA+  NP+ 
Sbjct: 178 MQQHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSE 237

Query: 241 SWKDD 245
           SW  D
Sbjct: 238 SWATD 242

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  299 bits (765), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 152/242 (62%), Positives = 191/242 (78%), Gaps = 4/242 (1%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           M++QTNA+N+++RTSAYLKSGLLK TPAWY VVA IPP+ KFTREPR  NPS  + +  L
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            D   R+  NK G YKTRPN  D++V+  KLYKPPKL YVED+LR LF+ QHPWELSRPK
Sbjct: 61  RD--NREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPK 118

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           ILVEN + +E +DW  + QLGKPLDGESVVQRTM+LLKT +  DM+ AY+ AR+EFY  R
Sbjct: 119 ILVENSL-EERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKM-DMITAYNQARFEFYRFR 176

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           +Q+E ++QVA EEAEMFGS+F  S I+ GI+KEQ+V+  W+KK  +ETEL+AA+ +NP+ 
Sbjct: 177 IQQEVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSD 236

Query: 241 SW 242
           SW
Sbjct: 237 SW 238

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  296 bits (759), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 205/274 (74%), Gaps = 12/274 (4%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQTNAVNVL+RTSAYL++G++KETPAWYNVVASIPP TKFTREP   NPS    + EL
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
            D    +  N+NGLYKTR N  +++V+ K++YKPPKL Y+ED++R LFYKQHPWEL+RPK
Sbjct: 61  KD-PDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPK 119

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           I+ ENEI + + DW  MLQLG+PLDGE+VVQRT++LLKTK+  ++ +AYD AR EFY LR
Sbjct: 120 IVSENEI-NTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLR 178

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           MQ+E ++QVA EEAEMFGS+FG S IEHG+ KEQ+V++ W++    ++EL++AK  N + 
Sbjct: 179 MQQELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENASK 238

Query: 241 SWKDDTTL--------DTAQDEEPTTA--ENLHF 264
           +  D + +        D    +E T A  E LHF
Sbjct: 239 AAGDASAVSSEKQVEDDVVNFDESTDADQEVLHF 272

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  283 bits (725), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 146/244 (59%), Positives = 184/244 (75%), Gaps = 3/244 (1%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQ NAVNVL+RTS+YL+SGLL + PAWYNVVA IPPS KF R P+F NPSN   + EL
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  DDVTQRQHANKNG--LYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSR 118
             + +R  +++NG  L+K+R N  DK+ S K +YKP KL+Y+ED+LR +FY QHPWELSR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 119 PKILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYA 178
           PKI+VEN  GDE YDW  + QLGK LDGE+VVQR M+L+K K      +    ARYEFY 
Sbjct: 121 PKIVVENN-GDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYR 179

Query: 179 LRMQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNP 238
           +RMQ E ++QVA EEAEMFGS+FG S IE G+ +EQ+V+DVW++K I ETELM AK +NP
Sbjct: 180 VRMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKRTNP 239

Query: 239 AGSW 242
           + +W
Sbjct: 240 SETW 243

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  270 bits (689), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 128/242 (52%), Positives = 178/242 (73%), Gaps = 2/242 (0%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQTNAVN+L+RTSA+L+SG++++ PAWYNVVA+ PP  KF R+P F NPS G     L
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
                 +  N + +YKTR +  DK+VS   LY+PPKL Y+ED+LR LFY QHPWE SRP 
Sbjct: 61  KSFLDSKR-NAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPM 119

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           IL+EN +  + +DW R+ QLGK LDGESVVQR + LL+    + +  AYD AR+EFY +R
Sbjct: 120 ILIENNVTPK-FDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIR 178

Query: 181 MQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPAG 240
           MQ+E ++Q++ EEA M+GS++  SAIE G++KE +V++ W+++VI+ETE M A+ ++P+ 
Sbjct: 179 MQQELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSE 238

Query: 241 SW 242
           SW
Sbjct: 239 SW 240

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  251 bits (640), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 119/192 (61%), Positives = 155/192 (80%), Gaps = 4/192 (2%)

Query: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60
           MKIQTNAVNVL RTS YL++GLLK+TPAWYNVVA IPP TKF REP+ ++P +G   GEL
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120
           D +T R + N    YKTR  ++D++ +   ++KP KL ++ED+LR+LF++QHPWELSRPK
Sbjct: 61  DIMTDRLNRNTET-YKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPK 117

Query: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180
           +LVEN +G+E YDW RMLQLGKPLDGESVVQRT++LLK+  + +M+ AYD AR+EFY LR
Sbjct: 118 VLVEN-MGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLR 176

Query: 181 MQEETQQQVALE 192
           MQ+E ++Q+A E
Sbjct: 177 MQQELEEQIAYE 188

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 7/50 (14%)

Query: 217 LDVWEKKVIEET-------ELMAAKSSNPAGSWKDDTTLDTAQDEEPTTA 259
           L  +E+K+++ET        +  A  S  +  W DDTTL T +D  PT A
Sbjct: 6   LSSYERKILDETIRRERNGVIFTASYSASSEEWGDDTTLLTLKDSRPTIA 55

>Suva_4.531 Chr4 complement(914403..916040) [1638 bp, 545 aa] {ON}
           YBR270C (REAL)
          Length = 545

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 24/57 (42%)

Query: 162 YEDMVEAYDSARYEFYALRMQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLD 218
           YE  +   D AR  F      EE Q  V  E+       FG+ +   G  K Q+++D
Sbjct: 479 YESFLHTNDGARKSFQKYIFNEEEQNGVTEEDKLTMLQCFGILSTIKGNSKNQKIID 535

>KAFR0C04230 Chr3 complement(840166..842073) [1908 bp, 635 aa] {ON}
           Anc_1.323 YBR270C
          Length = 635

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/57 (21%), Positives = 28/57 (49%)

Query: 162 YEDMVEAYDSARYEFYALRMQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLD 218
           Y++ + ++D A   F    + EE +  V  ++       FG+ +  HG  + Q++++
Sbjct: 569 YQNFIHSHDGASKSFQMYILSEEEENDVTEQDKMTLLQCFGILSTIHGDDRNQQIME 625

>AGL189C Chr7 complement(342535..343074) [540 bp, 179 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR119W
           (SRN2)
          Length = 179

 Score = 30.0 bits (66), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 1/109 (0%)

Query: 152 RTMHLLKTKQYEDMVEAYDSARYEFYALRMQEETQQQVALEEAEMFGSIFGVSAIEHGIQ 211
           R  HLL T + +++++A D  +     L   EETQ++V  +  ++       + +E   Q
Sbjct: 25  RKAHLLSTAELQELLKAQDKLQLYVAGLCESEETQKRVEQQRKQLAEIRETFAGLEGERQ 84

Query: 212 KEQEVLDVWEKKVIEETELMAAKSSNPAGSWKDDTTLDTAQDEEPTTAE 260
           + QE LD +++ V    E   A        + DD  L     +E   AE
Sbjct: 85  RVQERLDGYQRLVFRYHEAWQAVDGACRARY-DDGVLRARLQQEMRAAE 132

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score = 30.4 bits (67), Expect = 5.7,   Method: Composition-based stats.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 11/81 (13%)

Query: 22  LLKETPAWYNVVASIPPSTKFTREPRFNNPS-NGDTIGELDDVTQRQHANKNGLY----- 75
            L++   +YN +  +PP+T  + EP F++ S N    G    + +R++     LY     
Sbjct: 905 FLEKKLNYYNRLMGLPPTTTTSSEPLFSSQSKNTPANGSRSSIVKRENPENEYLYGDGIN 964

Query: 76  -----KTRPNTNDKRVSVKKL 91
                  +P+T D R   K+L
Sbjct: 965 NGNTDMDKPSTEDARNVNKRL 985

>TPHA0C04870 Chr3 (1052610..1056797) [4188 bp, 1395 aa] {ON}
           Anc_8.865 YML091C
          Length = 1395

 Score = 30.4 bits (67), Expect = 5.9,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 1/90 (1%)

Query: 4   QTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGELDDV 63
           QTN V V +R    L S L      ++N   +  P+T         N +N +    L D 
Sbjct: 160 QTNLV-VKRRQKYLLSSNLKNNILRFHNNNYTTIPTTNTLIGNSIINYNNLNGQFSLKDY 218

Query: 64  TQRQHANKNGLYKTRPNTNDKRVSVKKLYK 93
            + QH  K   Y T+ N ++  +S  +L+K
Sbjct: 219 KKNQHYKKKAFYSTKTNYSNDNISNDELFK 248

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,665,616
Number of extensions: 1340481
Number of successful extensions: 3541
Number of sequences better than 10.0: 46
Number of HSP's gapped: 3608
Number of HSP's successfully gapped: 46
Length of query: 264
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 157
Effective length of database: 41,212,137
Effective search space: 6470305509
Effective search space used: 6470305509
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)