Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.782.284ON80980939620.0
YIL095W (PRK1)2.284ON81081230510.0
Suva_9.1042.284ON80581230170.0
Smik_9.842.284ON80881030110.0
KAFR0J013702.284ON78084116640.0
NCAS0B062602.284ON72382516460.0
Kwal_27.115422.284ON79172715480.0
NDAI0B035602.284ON75682715380.0
SAKL0E07722g2.284ON79184815310.0
KLTH0G10318g2.284ON79084815200.0
KLLA0E08405g2.284ON77759014320.0
TDEL0G021502.284ON66131613920.0
KAFR0H033302.284ON36933913201e-176
NCAS0G038102.284ON66132413451e-176
ZYRO0A01848g2.284ON70448413231e-172
NDAI0G006402.284ON62131513051e-170
CAGL0G02607g2.284ON68832413041e-169
TPHA0C033802.284ON69732312841e-166
Kpol_1003.352.284ON71331512851e-166
TBLA0B059302.284ON71731312761e-165
YNL020C (ARK1)2.284ON63841612671e-164
ADL217W2.284ON75056412531e-161
Suva_14.3272.284ON63230912421e-161
Skud_14.3092.284ON63931512421e-160
Smik_14.3112.284ON63731512401e-160
Ecym_33232.284ON74831412441e-159
KNAG0H020202.284ON59231211831e-152
Kpol_1039.332.284ON70131511571e-147
KNAG0A054302.284ON78832211371e-143
TBLA0B069402.284ON144332211641e-141
CAGL0J03432g2.284ON62231211041e-140
TPHA0D015402.284ON70736410481e-131
KAFR0A010403.273ON9123237946e-92
Kpol_251.43.273ON8383157811e-90
KNAG0H012203.273ON9133287851e-90
SAKL0D03234g3.273ON8583157802e-90
TBLA0E025903.273ON10613187877e-90
CAGL0H10208g3.273ON10273227858e-90
KLTH0C07260g3.273ON9013087735e-89
KNAG0J008203.273ON10913267772e-88
Suva_4.2973.273ON11073197747e-88
Smik_2.1913.273ON11083197747e-88
Kpol_1052.223.273ON11012987712e-87
Skud_2.1793.273ON10903197677e-87
ZYRO0E06864g3.273ON11153187678e-87
NCAS0A105903.273ON10953177651e-86
YBR059C (AKL1)3.273ON11083197624e-86
KLLA0F18612g3.273ON8143197467e-86
NDAI0A057003.273ON11573267564e-85
TPHA0M011203.273ON7883167386e-85
Ecym_26503.273ON8943107412e-84
TPHA0A040303.273ON10543297463e-84
Kwal_27.109453.273ON9353107395e-84
KAFR0C004303.273ON9493267405e-84
TDEL0D035203.273ON10493167375e-83
CAGL0K11990g3.273ON9913207321e-82
AGR027C3.273ON9613137292e-82
TBLA0I019303.273ON13613227376e-82
Suva_16.706.262ON3643522452e-21
Kwal_56.242746.262ON3463382334e-20
TDEL0A067506.262ON3723002354e-20
Skud_16.426.262ON3643322344e-20
CAGL0I07513g3.92ON10763312301e-18
KAFR0A050906.31ON6682712272e-18
YPL236C (ENV7)6.262ON3643282184e-18
KLTH0H03080g6.262ON3463362175e-18
KLTH0F16676g5.406ON8782692238e-18
NDAI0C026806.31ON7502732211e-17
SAKL0A03344g6.262ON3641512123e-17
TPHA0E038501.24ON4821932153e-17
Smik_6.4416.262ON3643382096e-17
Kpol_2002.241.24ON4872622127e-17
SAKL0H06754g8.668ON8841952148e-17
Kpol_1072.198.668ON8962852121e-16
Kpol_1023.266.31ON7392702112e-16
NDAI0F045201.24ON4892152082e-16
TBLA0A047207.86ON12622332112e-16
Kwal_26.87518.668ON8483642103e-16
Kwal_55.215455.406ON8652692103e-16
KAFR0G012001.24ON5072662055e-16
ZYRO0D05500g7.86ON12621792085e-16
NCAS0D021006.31ON7262742066e-16
KAFR0C014403.92ON10952272077e-16
KNAG0F001701.24ON5431952057e-16
KNAG0D048107.86ON14401802078e-16
TPHA0F024306.31ON7982702059e-16
NDAI0G042903.92ON11131962069e-16
Kpol_1037.206.31ON7042742051e-15
KNAG0E008506.31ON7112742051e-15
NCAS0C049403.92ON11162572041e-15
ZYRO0E07876g6.262ON3693381982e-15
ZYRO0F07194g8.668ON9382802032e-15
CAGL0J11638g6.31ON7463401994e-15
NCAS0C041208.140ON9153312004e-15
Ecym_21536.262ON3633461944e-15
TBLA0H016605.406ON9962362004e-15
Kpol_1044.37.86ON9321791995e-15
Kwal_26.71547.86ON12131802005e-15
CAGL0F00913g7.86ON12061831995e-15
KLTH0C09548g3.92ON9932911996e-15
NDAI0H024707.86ON14111831996e-15
TBLA0A074601.24ON5161871967e-15
CAGL0K08514g2.479ON14892611988e-15
KLLA0E21693g5.406ON10162241988e-15
TPHA0J004206.31ON7072741978e-15
TDEL0D053203.92ON10572271979e-15
KLTH0D02486g7.86ON12231801979e-15
Suva_15.653.92ON10802261961e-14
CAGL0K02167g8.140ON11622471961e-14
TBLA0B085203.60ON9342431951e-14
CAGL0M02299g8.668ON8931961952e-14
Smik_1.793.177ON9742671952e-14
KNAG0D008306.262ON3873361902e-14
ABL034W2.479ON14251991952e-14
ACL006W6.31ON7082901932e-14
TPHA0H026307.86ON13671831942e-14
Skud_8.392.496ON9232561942e-14
Kwal_56.226933.92ON9841901942e-14
YAR019C (CDC15)3.177ON9742671933e-14
SAKL0G01848g5.406ON8852211933e-14
TBLA0B082503.92ON13472111933e-14
KLLA0F07623g7.86ON12291901933e-14
SAKL0E01584g6.31ON6952741923e-14
TDEL0A027202.496ON9152301923e-14
ZYRO0B01166g2.496ON9632421923e-14
KLTH0D11044g8.668ON8492011923e-14
Smik_4.7673.92ON7582441924e-14
NDAI0K021002.496ON9092301924e-14
Ecym_73922.479ON14342011934e-14
KLLA0C12485g3.92ON9252271924e-14
SAKL0C00946g1.24ON5642741904e-14
TDEL0G043806.31ON7222741914e-14
Suva_2.6663.92ON7641971914e-14
TBLA0B004906.31ON7872741914e-14
Smik_13.1596.31ON7052741914e-14
Sklu_YGOB_Anc_2.4962.496ON6192271905e-14
Suva_16.1608.668ON9182921915e-14
TDEL0A061408.668ON8612831915e-14
NCAS0A002801.24ON5352821895e-14
CAGL0K02673g2.496ON9152241915e-14
KLTH0D06006g2.496ON9542291915e-14
ZYRO0F18062g1.24ON4711931885e-14
Suva_6.1691.271ON14842181916e-14
Kpol_431.92.479ON15521991916e-14
NDAI0A038702.496ON8952301906e-14
Smik_8.422.496ON9392561906e-14
KAFR0A083603.60ON8292431907e-14
KNAG0B053502.496ON8362291897e-14
TDEL0C067801.24ON4682411877e-14
Skud_1.723.177ON9742651907e-14
KLTH0F00946g1.24ON5121941877e-14
YHL007C (STE20)2.496ON9392291898e-14
Kwal_26.78612.496ON9552291899e-14
KAFR0D049505.406ON10082471899e-14
Kpol_1055.242.496ON9372811899e-14
NCAS0C041008.141ON9053281899e-14
Suva_8.472.496ON9802561891e-13
NCAS0C016708.668ON8962091881e-13
Ecym_30356.31ON7402941881e-13
TDEL0H036407.86ON12372351891e-13
Skud_13.1546.31ON7052741871e-13
Kpol_1054.23.92ON10962271881e-13
KAFR0G026906.31ON7132741871e-13
Skud_15.1127.86ON11012331881e-13
Smik_10.1471.271ON14783031881e-13
KLLA0C06138g6.31ON7082741871e-13
Kwal_33.131121.24ON5051961851e-13
Skud_10.1191.271ON14812351881e-13
YPL150W8.668ON9012861871e-13
KAFR0D012207.86ON10551911871e-13
Ecym_35863.92ON10771901872e-13
TBLA0E022907.86ON13001851872e-13
YMR001C (CDC5)6.31ON7052741862e-13
ZYRO0C07480g6.31ON7742741862e-13
KLTH0G05214g5.591ON6532511852e-13
Skud_4.7643.92ON7561981852e-13
YOL100W (PKH2)3.92ON10812291862e-13
Smik_15.1227.86ON11011851862e-13
TPHA0P010503.92ON11211971862e-13
Ecym_55055.406ON10032301862e-13
Suva_13.1636.31ON7052741852e-13
ACR133C8.668ON8511931852e-13
Skud_16.1328.668ON9242861852e-13
Smik_15.573.92ON10812941852e-13
Skud_8.1635.406ON10762301853e-13
YDR490C (PKH1)3.92ON7661971853e-13
Ecym_24342.496ON11221751853e-13
KLLA0A07403g3.60ON8792371853e-13
ZYRO0G19052g8.140ON11312161853e-13
ACL104C5.406ON9472311853e-13
NCAS0F015807.86ON13822401853e-13
Smik_6.3478.668ON9172921843e-13
CAGL0G04609g3.92ON9652911843e-13
KAFR0K007007.86ON13811821853e-13
KLLA0B13607g2.496ON9892291843e-13
ABR014W2.496ON9711751844e-13
CAGL0H00979g6.262ON3991521804e-13
Suva_1.507.86ON13601771844e-13
KAFR0B021408.140ON8963471834e-13
Ecym_24058.668ON8551961834e-13
Suva_15.2975.406ON10742301834e-13
Kpol_1031.105.406ON11272301835e-13
Skud_4.7971.24ON4851921815e-13
KNAG0J016708.668ON10091991835e-13
NDAI0F013406.262ON4061531795e-13
YJL095W (BCK1)1.271ON14783201835e-13
ZYRO0A06446g5.406ON9432281825e-13
KLLA0F13552g2.479ON12672011835e-13
KLLA0F14190g1.271ON13382521836e-13
Kpol_1040.207.86ON12971801836e-13
SAKL0B09856g7.86ON12741901826e-13
ZYRO0B06512g3.92ON11111951827e-13
CAGL0H06259g7.86ON13361811827e-13
KAFR0H025108.668ON8792901817e-13
AFR335C3.92ON10331951817e-13
Ecym_10301.24ON4402761788e-13
Ecym_26407.86ON13251831818e-13
Smik_8.1805.406ON10732301818e-13
Skud_15.393.60ON6551691809e-13
YDR523C (SPS1)1.24ON4901961789e-13
Kpol_463.81.271ON14472781811e-12
YCR073C (SSK22)6.341ON13312901801e-12
KLTH0C10912g6.31ON6972741791e-12
NDAI0E023908.668ON8831931801e-12
KLLA0E03587g5.591ON6472691791e-12
YAL017W (PSK1)7.86ON13561801801e-12
Skud_15.543.92ON10822291801e-12
CAGL0L11550g5.406ON10721961801e-12
TPHA0G032902.496ON9731751801e-12
KLLA0C08525g6.341ON15513111801e-12
NDAI0G034508.141ON9483211791e-12
TPHA0G016308.668ON8711991791e-12
TPHA0H016305.406ON10362211791e-12
NCAS0B044906.222ON3492031741e-12
YOL045W (PSK2)7.86ON11011851791e-12
Smik_15.393.60ON6601501781e-12
SAKL0C01716g1.52ON12152991791e-12
NCAS0A099603.60ON7902441782e-12
NDAI0A061303.60ON8191671782e-12
AER264C6.341ON14832791792e-12
AFR724C1.24ON4402761762e-12
TPHA0P012703.60ON8852391782e-12
TBLA0B039708.654ON12082021782e-12
TDEL0E021805.406ON9872381782e-12
AFR696C1.52ON11422311782e-12
Suva_2.7031.24ON4851921762e-12
Kpol_1065.36.222ON3762881742e-12
NCAS0H019405.406ON10152301782e-12
KNAG0F029006.31ON6492031772e-12
Suva_16.3823.338ON3982271742e-12
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.78
         (809 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...  1530   0.0  
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...  1179   0.0  
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...  1166   0.0  
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...  1164   0.0  
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   645   0.0  
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   638   0.0  
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   600   0.0  
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   597   0.0  
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   594   0.0  
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   590   0.0  
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   556   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   540   0.0  
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   513   e-176
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   522   e-176
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   514   e-172
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    507   e-170
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   506   e-169
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   499   e-166
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   499   e-166
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   496   e-165
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   492   e-164
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   487   e-161
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   483   e-161
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   483   e-160
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   482   e-160
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   483   e-159
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   460   e-152
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   450   e-147
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   442   e-143
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   452   e-141
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   429   e-140
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   408   e-131
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   310   6e-92
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   305   1e-90
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   306   1e-90
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   305   2e-90
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   307   7e-90
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   306   8e-90
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   302   5e-89
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   303   2e-88
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   302   7e-88
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   302   7e-88
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   301   2e-87
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   300   7e-87
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   300   8e-87
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   299   1e-86
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   298   4e-86
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   291   7e-86
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   295   4e-85
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   288   6e-85
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   290   2e-84
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   291   3e-84
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   289   5e-84
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   289   5e-84
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   288   5e-83
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   286   1e-82
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   285   2e-82
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   288   6e-82
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    99   2e-21
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    94   4e-20
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    95   4e-20
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    95   4e-20
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    93   1e-18
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             92   2e-18
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    89   4e-18
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    88   5e-18
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    91   8e-18
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    90   1e-17
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    86   3e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    87   3e-17
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    85   6e-17
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    86   7e-17
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    87   8e-17
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    86   1e-16
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    86   2e-16
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    85   2e-16
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    86   2e-16
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    86   3e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    86   3e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    84   5e-16
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    85   5e-16
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      84   6e-16
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    84   7e-16
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    84   7e-16
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    84   8e-16
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    84   9e-16
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    84   9e-16
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    84   1e-15
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    84   1e-15
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    83   1e-15
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    81   2e-15
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    83   2e-15
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    81   4e-15
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    82   4e-15
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    79   4e-15
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    82   4e-15
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    81   5e-15
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    82   5e-15
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    81   5e-15
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    81   6e-15
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    81   6e-15
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    80   7e-15
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    81   8e-15
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    81   8e-15
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    80   8e-15
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    80   9e-15
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    80   9e-15
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    80   1e-14
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    80   1e-14
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    80   1e-14
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    80   2e-14
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    80   2e-14
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    78   2e-14
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    80   2e-14
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    79   2e-14
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    79   2e-14
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    79   2e-14
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    79   2e-14
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    79   3e-14
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    79   3e-14
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    79   3e-14
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    79   3e-14
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    79   3e-14
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    79   3e-14
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    79   3e-14
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    79   3e-14
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    79   4e-14
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    79   4e-14
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    79   4e-14
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    79   4e-14
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    78   4e-14
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    78   4e-14
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    78   4e-14
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    78   4e-14
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    78   4e-14
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    78   5e-14
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    78   5e-14
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    78   5e-14
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        77   5e-14
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    78   5e-14
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    78   5e-14
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    77   5e-14
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    78   6e-14
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    78   6e-14
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     78   6e-14
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    78   6e-14
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    78   7e-14
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    77   7e-14
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    77   7e-14
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    78   7e-14
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    77   7e-14
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    77   8e-14
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    77   9e-14
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    77   9e-14
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    77   9e-14
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     77   9e-14
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    77   1e-13
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    77   1e-13
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    77   1e-13
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    77   1e-13
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    77   1e-13
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    77   1e-13
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    77   1e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    77   1e-13
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    77   1e-13
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    77   1e-13
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    76   1e-13
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    77   1e-13
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    77   1e-13
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    77   1e-13
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    77   2e-13
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    77   2e-13
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    76   2e-13
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    76   2e-13
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    76   2e-13
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    76   2e-13
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    76   2e-13
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    76   2e-13
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    76   2e-13
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    76   2e-13
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    76   2e-13
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    76   2e-13
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    76   2e-13
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    76   2e-13
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    76   3e-13
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    76   3e-13
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    76   3e-13
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    76   3e-13
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    76   3e-13
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    76   3e-13
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    76   3e-13
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    75   3e-13
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    75   3e-13
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    76   3e-13
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    75   3e-13
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    75   4e-13
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    74   4e-13
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    75   4e-13
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    75   4e-13
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    75   4e-13
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    75   4e-13
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    75   5e-13
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    74   5e-13
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    75   5e-13
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    74   5e-13
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    75   5e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    75   5e-13
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    75   5e-13
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    75   6e-13
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    75   6e-13
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    75   6e-13
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    75   7e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    75   7e-13
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    74   7e-13
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    74   7e-13
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    73   8e-13
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    74   8e-13
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    74   8e-13
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    74   9e-13
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    73   9e-13
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    74   1e-12
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    74   1e-12
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    74   1e-12
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    74   1e-12
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    74   1e-12
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    74   1e-12
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    74   1e-12
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    74   1e-12
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    74   1e-12
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    74   1e-12
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     74   1e-12
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    74   1e-12
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    74   1e-12
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     72   1e-12
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    74   1e-12
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    73   1e-12
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    74   1e-12
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    73   2e-12
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    73   2e-12
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    74   2e-12
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    72   2e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    73   2e-12
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    73   2e-12
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    73   2e-12
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    73   2e-12
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    72   2e-12
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    72   2e-12
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    73   2e-12
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               73   2e-12
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    72   2e-12
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    73   2e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    73   2e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    72   2e-12
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    73   2e-12
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    72   2e-12
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    73   2e-12
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    73   2e-12
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    73   3e-12
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    72   3e-12
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    73   3e-12
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    73   3e-12
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    72   3e-12
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    73   3e-12
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    72   3e-12
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    73   3e-12
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    72   3e-12
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    72   3e-12
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    72   3e-12
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    72   4e-12
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    72   4e-12
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    71   4e-12
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    72   4e-12
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    72   4e-12
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    72   4e-12
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    72   4e-12
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    72   4e-12
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    70   4e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    71   4e-12
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    72   4e-12
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    72   5e-12
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    72   5e-12
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    72   5e-12
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    72   5e-12
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    72   5e-12
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    72   5e-12
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    71   6e-12
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    72   6e-12
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    72   6e-12
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    72   6e-12
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    72   6e-12
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    71   6e-12
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    72   6e-12
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    70   7e-12
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    71   7e-12
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    71   7e-12
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    71   7e-12
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    71   7e-12
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    71   7e-12
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    71   7e-12
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     71   7e-12
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    71   8e-12
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    71   9e-12
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    71   1e-11
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    71   1e-11
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    71   1e-11
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    71   1e-11
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    70   1e-11
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    71   1e-11
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    70   1e-11
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    70   1e-11
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    70   1e-11
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    70   1e-11
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      70   1e-11
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    70   1e-11
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    70   2e-11
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    70   2e-11
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    70   2e-11
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    70   2e-11
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    70   2e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    70   2e-11
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    70   2e-11
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    70   2e-11
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    70   2e-11
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    69   2e-11
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    70   2e-11
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    69   2e-11
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    68   3e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    69   3e-11
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    69   3e-11
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    69   3e-11
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    69   3e-11
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    68   3e-11
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    69   3e-11
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    69   4e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    69   4e-11
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    69   4e-11
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    69   4e-11
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    69   4e-11
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    69   4e-11
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    68   4e-11
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    68   4e-11
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    69   4e-11
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    69   4e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    69   4e-11
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    69   5e-11
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    69   5e-11
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    69   5e-11
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    69   5e-11
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    68   5e-11
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    68   5e-11
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    69   5e-11
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    68   6e-11
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    67   6e-11
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    69   6e-11
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    67   6e-11
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     68   6e-11
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    68   6e-11
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    67   7e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    67   7e-11
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    67   7e-11
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    68   7e-11
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    68   7e-11
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    68   8e-11
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    68   8e-11
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    67   9e-11
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    67   1e-10
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    68   1e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    67   1e-10
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    68   1e-10
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    67   1e-10
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    67   1e-10
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    67   1e-10
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    67   1e-10
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    67   1e-10
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    66   1e-10
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    67   1e-10
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    66   1e-10
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    66   1e-10
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    67   1e-10
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    67   1e-10
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    67   1e-10
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    67   1e-10
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    67   1e-10
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    67   2e-10
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    67   2e-10
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    66   2e-10
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    66   2e-10
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    67   2e-10
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    67   2e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    67   2e-10
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    67   2e-10
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    67   2e-10
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    67   2e-10
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    67   2e-10
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    67   2e-10
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    67   2e-10
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    66   2e-10
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    67   2e-10
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    67   2e-10
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    67   2e-10
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    67   2e-10
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    67   2e-10
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       66   2e-10
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    66   2e-10
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    66   3e-10
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    66   3e-10
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    66   3e-10
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    66   3e-10
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    66   3e-10
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    66   3e-10
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    66   3e-10
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    66   3e-10
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    65   3e-10
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    66   3e-10
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    66   3e-10
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    66   3e-10
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    65   3e-10
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    65   4e-10
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    65   4e-10
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    65   4e-10
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    66   4e-10
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    65   4e-10
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              65   4e-10
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    65   4e-10
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    65   4e-10
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    65   4e-10
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    65   4e-10
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    65   4e-10
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    65   4e-10
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    65   4e-10
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    65   5e-10
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    65   5e-10
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    65   5e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    65   5e-10
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    65   5e-10
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    65   6e-10
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    64   6e-10
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    64   6e-10
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    65   6e-10
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    65   6e-10
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    65   6e-10
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    65   7e-10
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    64   7e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    64   7e-10
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    65   7e-10
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    64   7e-10
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              65   7e-10
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    65   8e-10
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    65   8e-10
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    64   8e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    64   8e-10
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    64   8e-10
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    64   8e-10
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    64   9e-10
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    64   9e-10
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    64   9e-10
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    64   9e-10
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    64   9e-10
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    64   9e-10
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    64   9e-10
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    64   1e-09
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    64   1e-09
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    64   1e-09
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    64   1e-09
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    63   1e-09
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    63   1e-09
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    63   1e-09
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    64   1e-09
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    64   1e-09
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    64   1e-09
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    64   1e-09
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    64   1e-09
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    64   1e-09
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    64   1e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    63   1e-09
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               64   1e-09
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    63   1e-09
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    64   2e-09
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    63   2e-09
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    64   2e-09
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    64   2e-09
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    63   2e-09
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    64   2e-09
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    64   2e-09
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    64   2e-09
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    64   2e-09
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    63   2e-09
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    64   2e-09
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    63   2e-09
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    64   2e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    62   2e-09
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    63   2e-09
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    64   2e-09
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    63   2e-09
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    63   2e-09
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    63   2e-09
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    63   2e-09
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    63   2e-09
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    63   2e-09
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    63   2e-09
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    63   3e-09
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    63   3e-09
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    62   3e-09
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    63   3e-09
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    62   3e-09
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    63   3e-09
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    63   3e-09
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    62   3e-09
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    62   3e-09
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    63   3e-09
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    62   3e-09
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    62   3e-09
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    61   4e-09
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    62   4e-09
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    62   4e-09
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    62   4e-09
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    62   4e-09
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    62   4e-09
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    62   4e-09
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    62   4e-09
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    62   4e-09
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    61   5e-09
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    61   5e-09
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    62   5e-09
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    62   5e-09
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    61   5e-09
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    62   5e-09
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    62   5e-09
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    61   5e-09
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    61   5e-09
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    62   5e-09
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    62   5e-09
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    62   5e-09
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    61   5e-09
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    62   5e-09
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    62   6e-09
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    61   6e-09
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    62   6e-09
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    62   6e-09
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    62   6e-09
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    62   6e-09
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    62   6e-09
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    62   6e-09
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    62   6e-09
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    62   6e-09
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    62   6e-09
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    62   6e-09
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    62   6e-09
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    62   7e-09
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    62   7e-09
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    62   7e-09
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    61   7e-09
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    61   7e-09
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    61   7e-09
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    61   8e-09
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    61   8e-09
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    62   8e-09
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    61   8e-09
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     61   8e-09
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    61   8e-09
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    61   8e-09
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    61   8e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    61   9e-09
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     61   9e-09
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    61   1e-08
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    61   1e-08
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              61   1e-08
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    61   1e-08
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    61   1e-08
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    61   1e-08
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    61   1e-08
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    60   1e-08
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    60   1e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    61   1e-08
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    60   1e-08
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    60   1e-08
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    61   1e-08
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    60   1e-08
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    60   1e-08
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    60   1e-08
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    60   1e-08
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    60   1e-08
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    61   1e-08
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     60   1e-08
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    61   1e-08
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    61   1e-08
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    60   1e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              61   1e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    60   1e-08
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    60   1e-08
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    60   1e-08
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    60   1e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    60   1e-08
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    60   1e-08
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    60   1e-08
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    60   1e-08
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    60   1e-08
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    60   2e-08
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    60   2e-08
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    60   2e-08
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    60   2e-08
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               60   2e-08
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    60   2e-08
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    60   2e-08
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    60   2e-08
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    60   2e-08
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    60   2e-08
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    60   2e-08
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               60   2e-08
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    60   2e-08
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    59   2e-08
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    60   2e-08
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    59   2e-08
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    60   2e-08
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    59   2e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    60   2e-08
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    60   2e-08
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    60   2e-08
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    60   2e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    59   2e-08
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    60   2e-08
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    60   2e-08
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    60   2e-08
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    59   2e-08
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    60   2e-08
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    60   2e-08
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    60   2e-08
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    60   2e-08
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     60   2e-08
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    60   3e-08
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    59   3e-08
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    59   3e-08
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    59   3e-08
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               59   3e-08
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    59   3e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    59   3e-08
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    59   3e-08
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    59   3e-08
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    59   3e-08
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    59   3e-08
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    60   3e-08
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    59   3e-08
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    59   3e-08
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    59   3e-08
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    59   3e-08
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    59   3e-08
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    59   3e-08
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    59   4e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    59   4e-08
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    59   4e-08
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    59   4e-08
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    59   4e-08
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    59   4e-08
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     59   4e-08
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    59   4e-08
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     58   4e-08
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    59   4e-08
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    59   4e-08
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    59   4e-08
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    59   4e-08
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    59   4e-08
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    59   4e-08
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    59   4e-08
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    59   4e-08
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    59   4e-08
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    59   4e-08
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    59   4e-08
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    59   4e-08
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    59   5e-08
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    59   5e-08
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    58   5e-08
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    58   5e-08
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     58   5e-08
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    59   5e-08
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    59   5e-08
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    59   5e-08
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    58   5e-08
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    59   5e-08
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    59   5e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    59   5e-08
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    58   5e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    58   5e-08
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    59   5e-08
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    59   5e-08
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    59   5e-08
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    59   5e-08
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    59   6e-08
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    59   6e-08
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    58   6e-08
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    58   6e-08
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    59   6e-08
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    59   6e-08
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    58   6e-08
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    59   6e-08
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    59   6e-08
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    59   6e-08
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    59   6e-08
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    58   6e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    58   6e-08
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    58   6e-08
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              58   6e-08
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    58   6e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    58   6e-08
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    58   7e-08
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    57   7e-08
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    59   7e-08
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    57   7e-08
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    58   7e-08
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    58   7e-08
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    58   7e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    57   7e-08
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    58   7e-08
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    57   7e-08
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    58   7e-08
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    57   7e-08
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    58   8e-08
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    57   8e-08
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    58   8e-08
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    58   8e-08
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    58   8e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    58   8e-08
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    58   8e-08
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    58   8e-08
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    58   8e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    58   8e-08
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    58   8e-08
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    58   8e-08
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    58   8e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    57   9e-08
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    57   9e-08
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    57   9e-08
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    58   9e-08
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    58   9e-08
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    57   9e-08
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    57   9e-08
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    57   9e-08
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               57   1e-07
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    56   1e-07
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       58   1e-07
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    57   1e-07
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    57   1e-07
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    58   1e-07
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    57   1e-07
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    58   1e-07
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    58   1e-07
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    58   1e-07
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    58   1e-07
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    58   1e-07
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              58   1e-07
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    58   1e-07
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    56   1e-07
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    57   1e-07
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    57   1e-07
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    57   1e-07
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    57   1e-07
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    57   1e-07
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    57   1e-07
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    57   1e-07
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    57   1e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    57   1e-07
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    56   1e-07
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    57   1e-07
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    57   1e-07
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    57   1e-07
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    57   1e-07
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    57   1e-07
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    57   1e-07
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    57   1e-07
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    57   1e-07
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    57   1e-07
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    55   1e-07
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    57   1e-07
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    57   1e-07
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    57   1e-07
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    57   1e-07
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    57   1e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    57   1e-07
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    57   1e-07
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    57   1e-07
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    57   1e-07
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    57   1e-07
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    57   1e-07
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    57   1e-07
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    56   1e-07
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    57   1e-07
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    57   1e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    57   1e-07
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    57   1e-07
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    57   1e-07
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    57   1e-07
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    57   2e-07
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    57   2e-07
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    57   2e-07
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    57   2e-07
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    56   2e-07
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    57   2e-07
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    57   2e-07
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    57   2e-07
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    57   2e-07
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    57   2e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    56   2e-07
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    56   2e-07
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    56   2e-07
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              57   2e-07
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    57   2e-07
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    57   2e-07
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             57   2e-07
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    56   2e-07
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    57   2e-07
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    54   2e-07
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    57   2e-07
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    57   2e-07
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    57   2e-07
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    57   2e-07
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    55   2e-07
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     56   2e-07
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    56   2e-07
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    56   2e-07
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    55   2e-07
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    57   2e-07
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    56   2e-07
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    56   2e-07
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    57   2e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    55   2e-07
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    55   2e-07
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    55   2e-07
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    55   2e-07
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    56   2e-07
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    56   2e-07
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    56   2e-07
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    57   2e-07
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    56   2e-07
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    56   2e-07
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       56   2e-07
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    56   2e-07
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    56   2e-07
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    56   3e-07
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    55   3e-07
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    55   3e-07
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    56   3e-07
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    56   3e-07
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    56   3e-07
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    56   3e-07
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    56   3e-07
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    56   3e-07
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    56   3e-07
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    56   3e-07
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    56   3e-07
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    56   3e-07
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    55   3e-07
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    56   3e-07
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               56   3e-07
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    56   3e-07
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    55   3e-07
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    55   3e-07
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    55   3e-07
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    56   3e-07
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    55   3e-07
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    55   3e-07
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    55   3e-07
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    55   4e-07
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    56   4e-07
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    56   4e-07
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    56   4e-07
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    55   4e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    56   4e-07
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    55   4e-07
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    55   4e-07
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    55   4e-07
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    56   4e-07
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    55   4e-07
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    54   4e-07
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    56   4e-07
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    55   4e-07
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    55   4e-07
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    56   4e-07
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              54   5e-07
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    55   5e-07
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    55   5e-07
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    55   5e-07
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    55   5e-07
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               55   5e-07
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    55   5e-07
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               55   5e-07
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    55   5e-07
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    55   5e-07
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    55   5e-07
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    55   5e-07
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    55   5e-07
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    55   5e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    55   5e-07
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    55   5e-07
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    55   5e-07
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    54   5e-07
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    55   5e-07
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    54   5e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    55   5e-07
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    55   6e-07
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    55   6e-07
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    55   6e-07
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    54   6e-07
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    55   6e-07
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    55   6e-07
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    55   6e-07
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    55   6e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    55   6e-07
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    54   6e-07
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    55   6e-07
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    54   6e-07
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    55   6e-07
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    55   6e-07
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    55   7e-07
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    55   7e-07
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    55   7e-07
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    55   7e-07
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    55   7e-07
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    54   7e-07
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     55   7e-07
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    54   7e-07
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    54   8e-07
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              55   8e-07
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    55   8e-07
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    55   8e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    55   8e-07
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    54   8e-07
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     55   8e-07
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    54   8e-07
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    54   8e-07
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    55   8e-07
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    55   8e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    55   8e-07
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    55   8e-07
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    54   8e-07
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    54   9e-07
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    54   9e-07
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    55   9e-07
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    54   9e-07
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     54   9e-07
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    54   9e-07
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    54   9e-07
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    54   9e-07
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    54   9e-07
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    54   9e-07
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    53   9e-07
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    55   9e-07
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    54   1e-06
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    54   1e-06
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    55   1e-06
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    54   1e-06
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    54   1e-06
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    54   1e-06
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    54   1e-06
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    54   1e-06
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    54   1e-06
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    54   1e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    54   1e-06
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    54   1e-06
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    54   1e-06
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    54   1e-06
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    54   1e-06
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    54   1e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    54   1e-06
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    53   1e-06
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    54   1e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    54   1e-06
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    54   1e-06
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    54   1e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    54   1e-06
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    54   1e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    54   1e-06
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    54   1e-06
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    54   1e-06
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    54   1e-06
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    54   1e-06
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    54   1e-06
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    54   1e-06
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    54   1e-06
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    54   1e-06
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    54   1e-06
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    53   1e-06
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    54   1e-06
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    54   1e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    54   1e-06
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    53   1e-06
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    54   1e-06
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    54   1e-06
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    54   1e-06
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    54   1e-06
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    54   1e-06
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    54   1e-06
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    54   1e-06
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    54   1e-06
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    53   1e-06
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    54   1e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    54   2e-06
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    54   2e-06
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    52   2e-06
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    54   2e-06
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    53   2e-06
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    54   2e-06
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    54   2e-06
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    54   2e-06
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    54   2e-06
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    54   2e-06
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    53   2e-06
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    53   2e-06
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    53   2e-06
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    53   2e-06
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    53   2e-06
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    54   2e-06
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    53   2e-06
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    53   2e-06
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    53   2e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    53   2e-06
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    53   2e-06
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    52   2e-06
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    53   2e-06
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    53   2e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    53   2e-06
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    53   2e-06
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    54   2e-06
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    53   2e-06
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    53   2e-06
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    53   2e-06
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     53   2e-06
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      53   2e-06
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     52   2e-06
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    53   3e-06
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    52   3e-06
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    53   3e-06
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    53   3e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    53   3e-06
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    53   3e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    53   3e-06
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    52   3e-06
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    53   3e-06
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    53   3e-06
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     53   3e-06
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    52   3e-06
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    53   3e-06
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    53   3e-06
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    52   3e-06
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    52   3e-06
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    53   3e-06
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    53   3e-06
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    53   3e-06
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    52   3e-06
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    52   3e-06
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    53   3e-06
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    53   3e-06
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    52   4e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    52   4e-06
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     52   4e-06
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    53   4e-06
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    52   4e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    52   4e-06
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    52   4e-06
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    52   4e-06
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    52   4e-06
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    52   4e-06
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    52   4e-06
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    52   4e-06
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    52   4e-06
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    52   4e-06
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    52   4e-06
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    52   4e-06
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    52   4e-06
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    51   4e-06
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    52   4e-06
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    52   5e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    52   5e-06
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    52   5e-06
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    52   5e-06
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    52   5e-06
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    52   5e-06
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    51   5e-06
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    51   5e-06
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    52   5e-06
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    52   5e-06
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    52   5e-06
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    52   5e-06
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    52   5e-06
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    52   5e-06
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    52   5e-06
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    52   5e-06
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    52   5e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    52   5e-06
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    52   5e-06
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    51   5e-06
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    52   5e-06
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    52   6e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    52   6e-06
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    52   6e-06
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              52   6e-06
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    52   6e-06
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    52   6e-06
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    52   6e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    52   6e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    52   6e-06
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    51   6e-06
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    52   6e-06
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    52   6e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    51   6e-06
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    52   6e-06
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    51   6e-06
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    51   6e-06
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    51   7e-06
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    51   7e-06
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    49   7e-06
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    52   7e-06
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    52   7e-06
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    52   7e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    52   7e-06
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    51   7e-06
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    52   7e-06
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    51   7e-06
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    51   7e-06
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    51   7e-06
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    52   7e-06
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    52   7e-06
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    51   7e-06
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    50   7e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    52   7e-06
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    52   8e-06
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    50   8e-06
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    51   8e-06
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    51   8e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     51   8e-06
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               51   8e-06
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    52   8e-06
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    51   8e-06
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    50   8e-06
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    51   9e-06
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    52   9e-06
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    51   9e-06
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    52   9e-06
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              51   9e-06
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    51   9e-06
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    50   9e-06
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    52   9e-06
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    50   1e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    51   1e-05
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     51   1e-05
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    51   1e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    51   1e-05
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    51   1e-05
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     51   1e-05
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    51   1e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    51   1e-05
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    51   1e-05
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    51   1e-05
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    51   1e-05
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    51   1e-05
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    50   1e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    51   1e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    50   1e-05
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    51   1e-05
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    50   1e-05
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    51   1e-05
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    51   1e-05
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    50   1e-05
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    51   1e-05
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    50   1e-05
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    50   1e-05
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    51   1e-05
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    50   1e-05
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               50   1e-05
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    50   1e-05
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    50   1e-05
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    51   1e-05
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     50   1e-05
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    50   1e-05
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    50   1e-05
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    50   1e-05
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    50   1e-05
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    50   2e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    50   2e-05
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    50   2e-05
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    50   2e-05
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    50   2e-05
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    50   2e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    50   2e-05
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    50   2e-05
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    50   2e-05
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    50   2e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    50   2e-05
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    50   2e-05
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    50   2e-05
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    50   2e-05
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    50   2e-05
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    49   2e-05
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    50   2e-05
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    50   2e-05
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    50   2e-05
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    50   2e-05
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    50   2e-05
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    50   2e-05
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    50   2e-05
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    49   2e-05
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    50   2e-05
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    50   2e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    49   2e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    50   2e-05
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    50   2e-05
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    50   2e-05
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    50   2e-05
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    49   2e-05
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    49   2e-05
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    49   2e-05
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    50   2e-05
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    50   3e-05
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    50   3e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    49   3e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    49   3e-05
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    50   3e-05
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    49   3e-05
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    50   3e-05
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    49   3e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    50   3e-05
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    50   3e-05
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    49   3e-05
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    50   3e-05
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    50   3e-05
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    49   3e-05
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    49   3e-05
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    49   3e-05
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    50   3e-05
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    49   3e-05
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    49   3e-05
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    49   3e-05
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    49   3e-05
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    49   3e-05
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    50   3e-05
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    49   3e-05
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    49   3e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    50   3e-05
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    49   3e-05
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    49   3e-05
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    50   3e-05
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    49   3e-05
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    49   3e-05
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    49   3e-05
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    49   3e-05
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    49   3e-05
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    49   3e-05
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    49   4e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    49   4e-05
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    49   4e-05
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    49   4e-05
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    49   4e-05
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    49   4e-05
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    49   4e-05
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    49   4e-05
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    49   4e-05
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    49   4e-05
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    49   4e-05
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    49   4e-05
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    49   4e-05
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    49   4e-05
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    49   4e-05
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    48   4e-05
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    49   4e-05
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    49   4e-05
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    49   4e-05
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    49   4e-05
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    49   4e-05
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    49   4e-05
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    49   4e-05
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    49   4e-05
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    49   4e-05
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    49   4e-05
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    49   4e-05
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    49   4e-05
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    49   4e-05
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    49   4e-05
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    49   4e-05
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    49   4e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    49   5e-05
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    49   5e-05
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    49   5e-05
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    49   5e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    49   5e-05
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    49   5e-05
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    49   5e-05
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    48   5e-05
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    49   5e-05
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    49   5e-05
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    49   5e-05
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    49   5e-05
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    48   5e-05
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    49   5e-05
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    49   5e-05
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    48   5e-05
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    49   5e-05
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    49   5e-05
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               49   6e-05
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    49   6e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    49   6e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    49   6e-05
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    48   6e-05
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    48   6e-05
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    48   6e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    49   6e-05
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    48   6e-05
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    48   7e-05
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    49   7e-05
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    49   7e-05
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    49   7e-05
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    48   7e-05
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    48   7e-05
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    49   7e-05
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    48   7e-05
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    48   7e-05
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    48   7e-05
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    49   7e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    49   7e-05
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    48   7e-05
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    48   7e-05
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    48   7e-05
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    48   8e-05
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    48   8e-05
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    48   8e-05
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    48   8e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    48   8e-05
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    48   9e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    47   9e-05
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    48   9e-05
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    48   9e-05
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    48   1e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    48   1e-04
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    48   1e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    47   1e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    47   1e-04
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    47   1e-04
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    48   1e-04
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    48   1e-04
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    48   1e-04
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    47   1e-04
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    47   1e-04
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    47   1e-04
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    47   1e-04
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    47   1e-04
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    47   1e-04
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               47   1e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    47   1e-04
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    47   1e-04
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    47   1e-04
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    47   1e-04
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    47   1e-04
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    47   1e-04
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    47   1e-04
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    47   1e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    47   1e-04
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    48   1e-04
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    47   1e-04
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    47   1e-04
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    47   1e-04
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    47   1e-04
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    47   1e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    47   1e-04
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    47   1e-04
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    47   1e-04
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    47   1e-04
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    47   1e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    47   1e-04
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    47   1e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    47   1e-04
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    47   1e-04
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    47   1e-04
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    47   1e-04
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    47   1e-04
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    47   1e-04
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    47   1e-04
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    47   1e-04
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    47   1e-04
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    47   1e-04
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    47   2e-04
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    47   2e-04
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    47   2e-04
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    47   2e-04
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    47   2e-04
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    47   2e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    47   2e-04
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    47   2e-04
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    46   2e-04
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    47   2e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    47   2e-04
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    47   2e-04
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    47   2e-04
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    47   2e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    47   2e-04
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    47   2e-04
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    47   2e-04
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    46   2e-04
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    47   2e-04
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    47   2e-04
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    47   2e-04
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    47   2e-04
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    47   2e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     47   2e-04
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    46   2e-04
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    46   2e-04
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    46   2e-04
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    46   2e-04
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    46   2e-04
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    47   2e-04
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    46   3e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    47   3e-04
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    46   3e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    46   3e-04
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    46   3e-04
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    46   3e-04
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    46   3e-04
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    46   3e-04
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    46   3e-04
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    46   3e-04
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    46   3e-04
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    47   3e-04
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    46   3e-04
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     46   3e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    47   3e-04
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    46   3e-04
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    46   3e-04
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    46   3e-04
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    46   3e-04
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    46   3e-04
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    46   3e-04
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    45   3e-04
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    46   4e-04
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    46   4e-04
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    46   4e-04
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    46   4e-04
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    46   4e-04
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    45   4e-04
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    46   4e-04
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    46   4e-04
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    46   4e-04
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    45   4e-04
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    45   4e-04
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    45   4e-04
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    46   4e-04
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    45   4e-04
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    46   4e-04
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    46   5e-04
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    45   5e-04
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    45   5e-04
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    46   5e-04
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    45   5e-04
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    46   5e-04
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    45   5e-04
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    45   5e-04
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    45   5e-04
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    45   5e-04
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    45   5e-04
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    45   5e-04
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               45   5e-04
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    45   5e-04
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    45   5e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    45   6e-04
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    45   6e-04
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    45   6e-04
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    45   6e-04
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    45   6e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      45   6e-04
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    45   6e-04
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    45   6e-04
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    45   6e-04
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    45   7e-04
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    44   7e-04
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    45   7e-04
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    45   7e-04
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    45   7e-04
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    45   7e-04
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    45   7e-04
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    45   7e-04
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    45   7e-04
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    44   7e-04
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    45   8e-04
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    44   8e-04
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    45   8e-04
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    45   9e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    45   9e-04
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       45   9e-04
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    45   0.001
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    45   0.001
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    45   0.001
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    44   0.001
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    45   0.001
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    44   0.001
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    45   0.001
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    44   0.001
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    44   0.001
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    44   0.001
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    44   0.001
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    44   0.001
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    44   0.001
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    44   0.001
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    44   0.001
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    44   0.001
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    44   0.001
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    44   0.001
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    44   0.001
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    44   0.001
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    44   0.001
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    44   0.001
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     44   0.001
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    44   0.001
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    44   0.001
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    44   0.001
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    44   0.001
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    44   0.001
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    44   0.002
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    44   0.002
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    44   0.002
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    43   0.002
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    44   0.002
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    44   0.002
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    44   0.002
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    44   0.002
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    44   0.002
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      44   0.002
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    44   0.002
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    44   0.002
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    44   0.002
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    44   0.002
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    43   0.002
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    44   0.002
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    43   0.002
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    43   0.002
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    43   0.002
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    43   0.002
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    43   0.002
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    43   0.002
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    43   0.002
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    43   0.003
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    43   0.003
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    43   0.003
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    43   0.003
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    43   0.003
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    43   0.003
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    43   0.003
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    43   0.003
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    43   0.003
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    43   0.003
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    43   0.003
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    43   0.003
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    43   0.003
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    43   0.003
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    43   0.004
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    43   0.004
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    42   0.004
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    43   0.004
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    43   0.004
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    43   0.004
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    42   0.004
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    42   0.004
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    43   0.004
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    42   0.004
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    42   0.004
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    42   0.004
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    42   0.005
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    42   0.005
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    42   0.005
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    42   0.005
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    42   0.005
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    42   0.006
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               42   0.006
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    42   0.006
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    42   0.006
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    42   0.006
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    42   0.006
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    42   0.006
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    42   0.006
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    42   0.006
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    42   0.006
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    42   0.006
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    41   0.007
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    42   0.007
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    42   0.007
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    42   0.007
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    41   0.007
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    42   0.007
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    42   0.007
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    42   0.007
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    42   0.007
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    41   0.008
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    42   0.008
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    42   0.008
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    41   0.008
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    41   0.009
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    41   0.010
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    41   0.010
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    41   0.010
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    41   0.010
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     41   0.011
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    41   0.011
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    41   0.011
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    41   0.012
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    41   0.012
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    41   0.013
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    40   0.015
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    40   0.015
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    40   0.015
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    41   0.015
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    40   0.015
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    40   0.016
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    40   0.018
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    40   0.018
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    40   0.018
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    40   0.019
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    40   0.019
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    40   0.020
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    40   0.020
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    40   0.021
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    40   0.021
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    40   0.021
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    40   0.022
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    40   0.023
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    40   0.023
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    40   0.025
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    40   0.025
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    40   0.027
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    40   0.029
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    40   0.030
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    39   0.030
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    40   0.030
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    39   0.033
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    39   0.035
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    40   0.036
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    39   0.036
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    39   0.036
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    39   0.037
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    39   0.037
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    39   0.038
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    39   0.038
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    40   0.040
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    39   0.041
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    39   0.042
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    39   0.043
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    39   0.043
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    39   0.044
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    39   0.045
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    39   0.045
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    39   0.045
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    39   0.046
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    39   0.047
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    39   0.048
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    39   0.050
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    39   0.061
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    39   0.066
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    38   0.069
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    39   0.069
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    38   0.069
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    38   0.069
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    39   0.070
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    39   0.071
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    39   0.071
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    39   0.074
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    39   0.075
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    38   0.079
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    39   0.081
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    38   0.085
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    38   0.091
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    38   0.094
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    38   0.095
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    38   0.096
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    38   0.099
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    38   0.10 
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    38   0.11 
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    38   0.11 
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    38   0.11 
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    38   0.11 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    38   0.11 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    38   0.11 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    38   0.12 
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    38   0.12 
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    38   0.12 
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               38   0.12 
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               38   0.12 
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    38   0.12 
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    38   0.12 
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    37   0.12 
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    38   0.13 
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    37   0.14 
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    37   0.14 
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    37   0.16 
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    38   0.16 
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    37   0.16 
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    37   0.17 
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    37   0.17 
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    37   0.17 
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    37   0.19 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    37   0.19 
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    37   0.21 
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    37   0.21 
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    37   0.22 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    37   0.22 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    37   0.23 
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    37   0.24 
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    37   0.25 
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    37   0.27 
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    37   0.28 
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    37   0.29 
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    36   0.29 
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    36   0.30 
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    37   0.30 
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    37   0.31 
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    37   0.31 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    36   0.33 
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    36   0.33 
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    37   0.34 
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    36   0.34 
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    36   0.35 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    36   0.36 
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    36   0.36 
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 36   0.36 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    36   0.36 
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               36   0.37 
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    36   0.37 
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    36   0.38 
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    36   0.38 
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    36   0.38 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    36   0.39 
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    36   0.39 
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    36   0.39 
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    36   0.40 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    36   0.40 
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    36   0.42 
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    36   0.42 
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    36   0.42 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    36   0.43 
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    36   0.44 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    35   0.47 
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    36   0.48 
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             35   0.50 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    36   0.50 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    35   0.52 
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    36   0.52 
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    35   0.53 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    36   0.53 
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    35   0.55 
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    35   0.55 
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    36   0.57 
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    35   0.60 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    35   0.61 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    36   0.62 
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    35   0.62 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    35   0.63 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    35   0.64 
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    35   0.71 
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    35   0.72 
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    35   0.74 
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    35   0.76 
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    35   0.77 
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      35   0.77 
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    35   0.79 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    35   0.79 
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    35   0.81 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    35   0.82 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    35   0.82 
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    35   0.82 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    35   0.83 
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    35   0.84 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    35   0.87 
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    35   0.92 
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    35   0.93 
KNAG0C01830 Chr3 complement(357489..362675) [5187 bp, 1728 aa] {...    35   0.93 
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    35   0.96 
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    35   0.96 
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    35   0.98 
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    35   1.0  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    35   1.1  
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    35   1.1  
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    34   1.1  
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    35   1.1  
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    35   1.1  
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    34   1.2  
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    34   1.2  
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    35   1.3  
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    34   1.5  
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    34   1.5  
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    34   1.7  
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    34   1.7  
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    34   1.8  
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    34   1.8  
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    34   1.9  
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    33   1.9  
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    34   1.9  
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    33   2.0  
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    34   2.1  
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    33   2.1  
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    33   2.1  
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    34   2.2  
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    33   2.3  
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    33   2.4  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    33   2.6  
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    33   2.6  
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    33   2.6  
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    33   2.7  
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    33   2.7  
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    33   2.9  
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    33   3.0  
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    33   3.1  
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    33   3.3  
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    33   3.5  
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    33   3.5  
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    33   3.8  
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    33   4.2  
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    33   4.5  
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    32   4.9  
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    32   5.0  
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    32   5.0  
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    33   5.1  
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    32   5.3  
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    32   6.2  
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    32   6.4  
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    32   6.6  
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    32   6.8  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    32   7.3  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    32   7.8  
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    32   8.7  

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score = 1530 bits (3962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 750/809 (92%), Positives = 750/809 (92%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFM 120
           PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFM
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFM 120

Query: 121 NTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSV 180
           NTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSV
Sbjct: 121 NTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSV 180

Query: 181 SGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICY 240
           SGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICY
Sbjct: 181 SGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICY 240

Query: 241 YTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQN 300
           YTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQN
Sbjct: 241 YTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQN 300

Query: 301 EPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTTP 360
           EPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTTP
Sbjct: 301 EPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTTP 360

Query: 361 NLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPLSDDFASLYYRELHPFQK 420
           NLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPLSDDFASLYYRELHPFQK
Sbjct: 361 NLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPLSDDFASLYYRELHPFQK 420

Query: 421 SQTFKSVESFQXXXXXXXXXXXXXXXXXKNNDRASTSTVDRPNNYVDSVTQTIDNMAALN 480
           SQTFKSVESFQ                 KNNDRASTSTVDRPNNYVDSVTQTIDNMAALN
Sbjct: 421 SQTFKSVESFQSPQRKLSTPSSSSPVNSKNNDRASTSTVDRPNNYVDSVTQTIDNMAALN 480

Query: 481 LNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTGDS 540
           LNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTGDS
Sbjct: 481 LNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTGDS 540

Query: 541 IRSAFGMLRHGLTGSSVSNNRTISFDSXXXXXXXXSVNRRLAXXXXXXXNFNFDTKRXXX 600
           IRSAFGMLRHGLTGSSVSNNRTISFDS        SVNRRLA       NFNFDTKR   
Sbjct: 541 IRSAFGMLRHGLTGSSVSNNRTISFDSNNGNGNGNSVNRRLASSSSSSSNFNFDTKRQDD 600

Query: 601 XXXXXXXENRRSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKTASRTTLKS 660
                  ENRRSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKTASRTTLKS
Sbjct: 601 LDKKQKLENRRSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKTASRTTLKS 660

Query: 661 DSSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASNRHSSVRITPI 720
           DSSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASNRHSSVRITPI
Sbjct: 661 DSSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASNRHSSVRITPI 720

Query: 721 TEGKFNKYYNSGTLKGETSRNDXXXXXXXXXXXXXXXXXTEIQNTRNFSRLQSRQPQMER 780
           TEGKFNKYYNSGTLKGETSRND                 TEIQNTRNFSRLQSRQPQMER
Sbjct: 721 TEGKFNKYYNSGTLKGETSRNDKHKSRPPRPPPKPLHLRTEIQNTRNFSRLQSRQPQMER 780

Query: 781 ISSEATETIVDVNVDDLEADFRKRFPSKV 809
           ISSEATETIVDVNVDDLEADFRKRFPSKV
Sbjct: 781 ISSEATETIVDVNVDDLEADFRKRFPSKV 809

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score = 1179 bits (3051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 592/812 (72%), Positives = 641/812 (78%), Gaps = 5/812 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN PQISLY+PGT+LTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNAN ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFM 120
           P KQGLNTLRAEVDAMKLL+NNKHVVSYIDSHAA+SVNGIAYEVFVLMEFCERGGLIDFM
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSVNGIAYEVFVLMEFCERGGLIDFM 120

Query: 121 NTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSV 180
           NTRLQ+RL+ESEILEIMSQTVQGI AMH LQPPLIHRDIKIENVLISHDGLYKVCDFGSV
Sbjct: 121 NTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGSV 180

Query: 181 SGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICY 240
           SGVIRPPRN+QEFNYVQHDILTNTTAQYRSPEMIDLYR  PIDEKSDIWALGVFLYKICY
Sbjct: 181 SGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICY 240

Query: 241 YTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQN 300
           YTTPFEKSGEA ILH+RYQYPSFPQYSDRLK LI LMLME PSQRPNICQVLEEVSRLQN
Sbjct: 241 YTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQN 300

Query: 301 EPCPIRNFYLLRAMGQNA--QLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRT 358
           +PCPIRNFYLLRAM QNA  QLA EP S TYV  Q+ +P Q+LQ I    +M+PVTHV T
Sbjct: 301 KPCPIRNFYLLRAMNQNANTQLAGEPSSTTYVPTQKFIPVQSLQSINQPPNMMPVTHVST 360

Query: 359 TPNLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPLSDDFASLYYRELHPF 418
           TPNLGT   +I +NN+TE       Q  S  NL +PLMKTKSVPLSD+FASLYY+ELHPF
Sbjct: 361 TPNLGTFPISINDNNKTEVTAHAGLQVGSHSNLTSPLMKTKSVPLSDEFASLYYKELHPF 420

Query: 419 QKSQTFKSVESFQXXXXXXXXXXXXXXXXXKNNDRASTSTVDRPNNYVDSVTQTIDNMAA 478
           QKSQTFKSVESFQ                    DR   S ++RPNNYVDS TQTIDNMA 
Sbjct: 421 QKSQTFKSVESFQSPQRKSMPPLSLTPVNNDIFDRV--SAINRPNNYVDSETQTIDNMAV 478

Query: 479 LNLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTG 538
            NL  S    +K     KE   P+N+ G  IVRSLSSKLKKVITGESR +SPIKSRQNTG
Sbjct: 479 PNLKLSPTITSKSLSSTKEIAAPDNINGSKIVRSLSSKLKKVITGESRGNSPIKSRQNTG 538

Query: 539 DSIRSAFGMLRHGLTGSSVSNNRTISFDSXXXXXXXXSVNRRLAXXXXXXX-NFNFDTKR 597
           DSIRSAFG LRHG TG+SV+N+R+ SFD+        + NRRL          FN DTKR
Sbjct: 539 DSIRSAFGKLRHGFTGNSVNNSRSASFDNNNVNGNGNNTNRRLVSSSTSSFPKFNSDTKR 598

Query: 598 XXXXXXXXXXENRRSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKTASRTT 657
                     E RRSMPPSILSDFD+HERNNSRTGSRDYYRSHSPVKK Q + KT S+ T
Sbjct: 599 KEESDKNQRLEKRRSMPPSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQASAKTTSKPT 658

Query: 658 LKSDSSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASNRHSSVRI 717
           L  D+ ++++ Q  KESIQRRVHNLL +S+DP+ +KSASGYGKYTD+  E SNRHSSVRI
Sbjct: 659 LIPDNGNVNINQEKKESIQRRVHNLLKSSDDPVTYKSASGYGKYTDIGTETSNRHSSVRI 718

Query: 718 TPITEGKFNKYYNSGTLKGETSRNDXXXXXXXXXXXXXXXXXTEIQNTRNFSRLQSRQPQ 777
           TPITE KF K    G L  +T  N                  TEIQ  RNFSRLQS++  
Sbjct: 719 TPITEEKFKKTLKDGVLDIKTKSNGKDKSRPPRPPPKPLHLRTEIQKIRNFSRLQSKKLP 778

Query: 778 MERISSEATETIVDVNVDDLEADFRKRFPSKV 809
           +ERISSEATETIVDVNVDDLEADFRKRFPSKV
Sbjct: 779 IERISSEATETIVDVNVDDLEADFRKRFPSKV 810

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score = 1166 bits (3017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/812 (72%), Positives = 657/812 (80%), Gaps = 10/812 (1%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN PQISLY+PGT+LTVGSHHAKIIKYLTSGGFAQVY+AEISPPDPYS+AN ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFM 120
           PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG+AYEVFVLME+CERGGLIDFM
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEYCERGGLIDFM 120

Query: 121 NTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSV 180
           NTRL++RL+ESEIL+IM QTVQGIAAMH LQPPLIHRDIKIENVLISH+GLYKVCDFGSV
Sbjct: 121 NTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGSV 180

Query: 181 SGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICY 240
           SGVIRPP+N QEFNYVQHDILTNTTAQYRSPEMIDLYR  PIDEKSDIWALGVFLYKICY
Sbjct: 181 SGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICY 240

Query: 241 YTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQN 300
           YTTPFEK+GEAAILH+RYQYPSFPQYSDRLK LI LMLME PSQRPNICQVLEEVSRLQN
Sbjct: 241 YTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQN 300

Query: 301 EPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTTP 360
            PCPIRNFYLLRAM QNAQ  SE  S+TY  AQQL+  Q+ Q I+ + ++VP+++++TTP
Sbjct: 301 RPCPIRNFYLLRAMNQNAQFGSESTSMTYTPAQQLVSPQSFQNIQAMPNIVPLSNIKTTP 360

Query: 361 NLGTLTKAITNNNQTESILPVRTQP-ESDLNLGNPLMKTKSVPLSDDFASLYYRELHPFQ 419
           NL + +  + NNN+ E++L +RTQ  E+  N   PL KTKSVPLSDDF SLYY+ELHPFQ
Sbjct: 361 NLDSASNFVNNNNKMEAMLQLRTQKLETGPNFSIPLTKTKSVPLSDDFTSLYYKELHPFQ 420

Query: 420 KSQTFKSVESFQXXXXXXXXXXXXXXXXXKNNDRASTSTVDRPNNYVDSVTQTIDNMAAL 479
           K  TFKSVE  Q                  N DR   ST++RPNNYVDS TQT+D++A L
Sbjct: 421 KPHTFKSVEGSQ-SPQRKSIPFSPTPVNSNNYDRV--STINRPNNYVDSETQTLDSIATL 477

Query: 480 NLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTGD 539
            L  S    NK +G  KES VPENVTGG IVRSLSSKLK+VITGESR+ SPIKSRQNTGD
Sbjct: 478 KLKPSPTISNKTTGFSKESTVPENVTGGKIVRSLSSKLKRVITGESRNGSPIKSRQNTGD 537

Query: 540 SIRSAFGMLRHGLTGSSVSNNRTISFDSXXXXXXXXSVNRRLA--XXXXXXXNFNFDTKR 597
           SIRSAFGMLRHG TGSS++N+R+ SFD+        SVNRRL          N N DTKR
Sbjct: 538 SIRSAFGMLRHGFTGSSINNSRSTSFDN----NNANSVNRRLTSSSSNPSSSNLNSDTKR 593

Query: 598 XXXXXXXXXXENRRSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKTASRTT 657
                     E+RRSMPPSILSDFD+HERNNSRTGSRDYYRSHSPVKK QTTP T +R +
Sbjct: 594 KEELDKKRKLEHRRSMPPSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQTTPTTTTRPS 653

Query: 658 LKSDSSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASNRHSSVRI 717
           LKS +SDI++ Q  KESIQRRVHNLLNNSED L++KSASGYGKYTD  AE++NR SSVRI
Sbjct: 654 LKSSNSDINIDQEKKESIQRRVHNLLNNSEDSLSYKSASGYGKYTDTEAESTNRQSSVRI 713

Query: 718 TPITEGKFNKYYNSGTLKGETSRNDXXXXXXXXXXXXXXXXXTEIQNTRNFSRLQSRQPQ 777
           TPITE +FN Y++S T+   TS  D                 T+I NTR  S LQSR+P 
Sbjct: 714 TPITEERFNNYHSSNTMNDHTSSKDKPKSRPPRPPPKPLHLRTKIHNTRCSSNLQSRKPP 773

Query: 778 MERISSEATETIVDVNVDDLEADFRKRFPSKV 809
           MERISSEATETIVDVNVD+LEADFRKRFPSKV
Sbjct: 774 MERISSEATETIVDVNVDELEADFRKRFPSKV 805

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score = 1164 bits (3011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/810 (72%), Positives = 639/810 (78%), Gaps = 3/810 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MNAPQISLY+PGT+LTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPY+NAN ACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFM 120
           PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG+AYEVFVLMEFCERGGLIDFM
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGVAYEVFVLMEFCERGGLIDFM 120

Query: 121 NTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSV 180
           NTRLQ+RLRESEILEIMSQTVQGIAAMH LQPPLIHRDIKIENVLISH+GLYKVCDFGSV
Sbjct: 121 NTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSV 180

Query: 181 SGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICY 240
           SGVIRPPRN+QEFNYVQHDILTNTTAQYRSPEMIDLYR  PIDEKSDIWALG+FLYKICY
Sbjct: 181 SGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICY 240

Query: 241 YTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQN 300
           YTTPFEKSGEA ILH+RYQYP FPQYSDRLK LI LMLME PS+RPNICQVLEEVSRLQ 
Sbjct: 241 YTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQI 300

Query: 301 EPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTTP 360
           +PCPIRNFYLLRAM Q AQLASEPPS+ YV  Q+ LPAQ LQ +K + +M+PV+HVRTTP
Sbjct: 301 KPCPIRNFYLLRAMSQTAQLASEPPSMKYVPTQKFLPAQGLQSMKPISNMIPVSHVRTTP 360

Query: 361 NLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPLSDDFASLYYRELHPFQK 420
           NL TL ++I +NN T+    +  Q   D N+  PL KTKSVPLSDDFASLYYRELHPFQK
Sbjct: 361 NLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVPLSDDFASLYYRELHPFQK 420

Query: 421 SQTFKSVESFQXXXXXXXXXXXXXXXXXKNNDRASTSTVDRPNNYVDSVTQTIDNMAALN 480
           SQTFKSVE+FQ                    D+  T T++RPNNYVDS TQT D +    
Sbjct: 421 SQTFKSVENFQSPQRRSMPPSSLPPANSIILDK--TPTMNRPNNYVDSETQTTDIITMSG 478

Query: 481 LNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTGDS 540
              S    NKP    KE I PENV+GG+IVRSLSSKLKKVITGESR SSPIKSRQNTGDS
Sbjct: 479 SKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVITGESRGSSPIKSRQNTGDS 538

Query: 541 IRSAFGMLRHGLTGSSVSNNRTISFDSXXXXXXXXSVNRRLAXXXXXXXN-FNFDTKRXX 599
            RSA GMLRHG TGSS++NNR+ SFDS        SVNRRL        + FN DTKR  
Sbjct: 539 TRSALGMLRHGFTGSSMNNNRSASFDSNNGSSNNNSVNRRLGSSSTSSLSVFNPDTKRQE 598

Query: 600 XXXXXXXXENRRSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKTASRTTLK 659
                   ENRRSMP SILSDFD+HER NSRTGSRDYYRSHSPVKK QTT K+A +   K
Sbjct: 599 EIDKKQKLENRRSMPSSILSDFDQHERINSRTGSRDYYRSHSPVKKIQTTSKSAPKPITK 658

Query: 660 SDSSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASNRHSSVRITP 719
               DI++ Q  KESIQRRVHNLL +SEDPL +KSASGYGKYTD + E SNRHSSVRITP
Sbjct: 659 PVIGDININQEKKESIQRRVHNLLKSSEDPLTYKSASGYGKYTDTDTETSNRHSSVRITP 718

Query: 720 ITEGKFNKYYNSGTLKGETSRNDXXXXXXXXXXXXXXXXXTEIQNTRNFSRLQSRQPQME 779
           ITE KF     +G    +T  ND                  EIQ  R+ SRL S +   E
Sbjct: 719 ITEEKFKSRNKNGLSNNKTKDNDRHKSRPPRPPPKPLHLRAEIQKVRSSSRLHSGELSSE 778

Query: 780 RISSEATETIVDVNVDDLEADFRKRFPSKV 809
           RISS+ATETIV+VNVDDLEADFRKRFPSKV
Sbjct: 779 RISSDATETIVEVNVDDLEADFRKRFPSKV 808

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/841 (47%), Positives = 491/841 (58%), Gaps = 94/841 (11%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN PQI  +  G +LTVGSHHAK+IKYLTSGG+AQVY  EISP DPY N+N ACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAMKLLKNN+HVVSYIDSHA+KS   NG AYEVFVLMEFCERGGLID
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNG-AYEVFVLMEFCERGGLID 119

Query: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178
           FMN+RLQ RL E+EIL IMS T QGIAAMH LQP L+HRDIKIENVLIS +  YKVCDFG
Sbjct: 120 FMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFG 179

Query: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238
           SV G++RPP+N QEFN+V HDI+ NTTAQYRSPEM+DL +  PI+EKSDIWALGVFLYK+
Sbjct: 180 SVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKL 239

Query: 239 CYYTTPFEKS-GEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSR 297
           CYYTTPFEK+ GEAAIL +R+QYPS+P YSDRLK LI +ML + PS RPN+CQVLEEVSR
Sbjct: 240 CYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSR 299

Query: 298 LQNEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQ-----------GIKH 346
           LQ  PCPIRNFYLLRAM  N +   +P    Y+      P+  +             +K 
Sbjct: 300 LQGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKF 359

Query: 347 LQSMVPVT--------HVRTTPNLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKT 398
            Q+ +P T        H +T P L T    +  ++  + I P     +S  +LG+     
Sbjct: 360 NQTTIPPTNQHSPHLLHTQTLP-LPTNDHPVAISHVQDKISPHELLKKSSKSLGSTGTSN 418

Query: 399 KSV---PLSDDFASLYYRELHPFQKSQTFKSVESFQXXXXXXXXXXXXXXXXXKN-NDRA 454
           K+V      D F  L +   +     Q      S                   K+ ND  
Sbjct: 419 KNVIDTSAPDHFTKLLHASKNTDLSYQPVTVPTSSSLYNLPRANLSSSPQKSWKSINDNY 478

Query: 455 STSTVDRPNNYVDSVTQTIDNMAALNLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLS 514
             S   RP NYVD  TQT    +   L ++S   +  S   + S V EN TG S+VR LS
Sbjct: 479 DVS--KRPTNYVDEETQTYTGQSTF-LRRTSSNRSNRSISSQYSGVQENTTGSSLVRKLS 535

Query: 515 SKLKKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTGSSVSNNRTISFDSXXXXXXX 574
            KLK V+TGES     IKSRQNTGDSIRSA   +R G TG++ +N R+ S+D+       
Sbjct: 536 VKLKNVLTGES-----IKSRQNTGDSIRSAMNSIRSGFTGNN-NNTRSASYDN---GKRL 586

Query: 575 XSVNRRLAXXXXXXXNFN-FDTKRXXXXXXXXXXENRRSMPPSILSDFDKHERNNSRTGS 633
            SVN  +        + + F+  R              S+  + L D ++HER    T S
Sbjct: 587 SSVNLHMHSAILEQDDSDEFEMPRY------------NSVSSNTLKDVEEHERRTVNTSS 634

Query: 634 RDYYRSHSPVKKNQTTPKTASRTTLKSDSSDIDVKQVNKESIQRRVHNLLNNSEDPLAH- 692
           R+YYRS SPV+                    + V +  K SIQ+RV +LL N+E+     
Sbjct: 635 REYYRSQSPVR--------------------MSVNREMKNSIQKRVQDLLKNAEENTTAT 674

Query: 693 -KSASGYGKYTDVNAEASNRHSSVRITPITE--GKFNKYYNS-GTLKGETSRNDXXXXXX 748
            ++ASGYGKYTD N           I+P      +FN+   +  +L G+  +        
Sbjct: 675 VRTASGYGKYTDYNKNKD------EISPTKSRVAQFNQSTAALASLSGKRKKPPVPYKRD 728

Query: 749 XXXXXXXXXXXTEIQNTRNFSRLQSRQPQMERISSEATETIVDVNVDDLEADFRKRFPSK 808
                               + L SR     R+SS AT+ +VD++VDD+E D R+RFPS 
Sbjct: 729 SLKPTPPAKP----------AFLSSRPVASSRVSSNATDMLVDLSVDDIEKDIRRRFPST 778

Query: 809 V 809
           V
Sbjct: 779 V 779

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/825 (47%), Positives = 489/825 (59%), Gaps = 118/825 (14%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P I  Y PGT+LTVGSH+ KIIKYLTSGGFAQ+YT EISP +PY+N+ TACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119
           PDK GLNTLRAEVDAMKLLKNN+HVVSYIDSHAA+S V   AYEVF+LME+C+ GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNTRLQ+RL E EIL I+SQTVQG++AMH LQP LIHRDIKIENVLIS  G +K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           V   IRPPRN QE  YVQHD+L NTTAQYR+PEM+DLYR  PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFEK GEAAILHSRYQYP+FP Y+D+LK LI   LME PS+RPNICQ+LEE+SR+Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 300 NEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTT 359
             PCPI NFYL R +   A L +  P +T      L  +Q+   I      VP+   R++
Sbjct: 301 GIPCPINNFYLSRTINVQASLMN--PIITPTQQTALKHSQSSATISDQSYAVPLASSRSS 358

Query: 360 PNLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPLSDDFASLYYRELHPFQ 419
              G     I      E+ +P       D++ G           SDD     Y  +HPFQ
Sbjct: 359 TTTGNKPILI------ETEIP-------DMSQG-----------SDDV----YSRIHPFQ 390

Query: 420 KSQTFKSVESFQXXXXXXXXXXXXXXXXXKNNDRASTSTVDRPNNYVDSVTQTIDNMAAL 479
           KSQT ++                      + +  ++++T    ++YVDS TQT    +  
Sbjct: 391 KSQTLRT-------PSRSSSPIKYTGTLLQKSTSSNSNTSGNKSHYVDSETQTFSTSSRR 443

Query: 480 NLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTGD 539
               SSV         +   + E+ TGGSI +  +S LK+V+TGESR++SPI+SRQNTG 
Sbjct: 444 LSRSSSVRSASSRSSDQ---LKEHRTGGSITQFFTSTLKRVVTGESRNTSPIRSRQNTGG 500

Query: 540 SIRSAFGMLRHGLTGSSVSNNRTISFDSXXXXXXXXSVNRRLAXXXXXXXNFNFDTKRXX 599
           SIRSAF  LR G+TG+  +N+R  S  S        S + + +             K+  
Sbjct: 501 SIRSAFDALRSGITGN--TNSRVSSLASSVRNVSSSSKHSKHSDADDEPNKIKIRMKKA- 557

Query: 600 XXXXXXXXENRRSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKTASRTTLK 659
                    +RRS+PP++ SDF  +E       +   Y S+SPVK             LK
Sbjct: 558 ---------HRRSVPPNLYSDFYANE------DTPKLYSSNSPVK-------------LK 589

Query: 660 SDSSDIDVKQVNKESIQRRVHNLLNN-SEDPLAHKSASGYGKYTD--------------V 704
           S S+        +ESIQ RV  LL    E+P   K+ASGYGKYTD              +
Sbjct: 590 SLST-------QRESIQNRVKALLETFEEEPSTIKTASGYGKYTDSEFITSPVPERGGRI 642

Query: 705 NAEASNRHSSVRITPITEGKFNKYYNSGTLKGETSRNDXXXXXXXXXXXXXXXXXTEIQN 764
               + R+SSV I P+TE    +       K                          I  
Sbjct: 643 PTPTNKRYSSVIINPVTEPISIRPSPPPKPK----------------------HLRPIPP 680

Query: 765 TRNFSRLQSRQPQMERISSEATETIVDVNVDDLEADFRKRFPSKV 809
            +  +RL    P  ERISS ATE IV+++V+ LE DF++RFPS++
Sbjct: 681 PKP-TRLSKIYPD-ERISSTATERIVNLDVESLEKDFKRRFPSRI 723

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/727 (49%), Positives = 442/727 (60%), Gaps = 71/727 (9%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P   +Y  GT LTVGSH A+IIKYLTSGGFA +Y+AEISP DP S  N ACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119
           PDKQ LN LRAEVDAMKLL+ NKHVVSYIDSHAAKS     +YEVF+LME+C  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNTRLQ+RL E+E+L+IMS   QGIAAMH L PPLIHRDIKIENVLIS D  +KVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           V GVIRPP+N+QEF+YVQ+DIL NTTAQYRSPEMIDLYR  PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFEK G+AAILHSR+Q+P++PQYSDRLK LI +ML E P+QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 300 NEPCPIRNFYLLRAMGQNAQLASEP----PSV-TYVSAQQ----LLPAQTLQGIKHLQSM 350
           N PCP+RNFYLLR+M Q  Q   +     PSV  + S  Q    L     L   KH QS 
Sbjct: 301 NVPCPLRNFYLLRSMQQQQQQHQQQQQTFPSVEVHHSLSQPRMDLKNGPVLTPFKHAQS- 359

Query: 351 VPVTHVRTTPNLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLM----------KTKS 400
              + +RT+          + NN    + P + QP       +P            K   
Sbjct: 360 ---SALRTSKTFDGAAMNGSINNYVPVLKPHQAQPVQQNYRSDPFTSIDRRTVLQEKIPL 416

Query: 401 VPLSDDFASLYYRELHPFQKSQTFKSVESFQXXXXXXXXXXXXXXXXXKNNDRASTSTVD 460
            P S DF  L         ++QTF  V   +                      A+ + VD
Sbjct: 417 QPASADFQRL--------SRAQTFVPVT--KSPKRSSASPSFGGRGDISMIVSANPTNVD 466

Query: 461 RPNNYVDSVTQTIDNMAALNLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKV 520
               Y++S  QT +  + L L++ +  +++ S    ESI  ++ TGGS  R+   +LKKV
Sbjct: 467 PTPIYLNSSVQTDNPGSDLYLSKQNTRLSESSTSSSESIETQS-TGGSFSRTFGRRLKKV 525

Query: 521 ITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTGSSVSNNRTISFDSXXXXXXXXSVN-- 578
            TGE RS SPIKSRQNTG+S++SAF  LR G +  S    +    ++        S N  
Sbjct: 526 FTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGSSSNGY 585

Query: 579 --RRLAXXXXXXXNFNFDTKRXXXXXXXXXXENRRSMPPSILSDFDKHERNNSRTGSRDY 636
             R  +       N  F               +R++   SI+SD D  + ++S T ++ Y
Sbjct: 586 KFRVTSSDSIEEENSGF-----------IYSHSRKASSTSIVSDLDSLQ-DDSGTNAKKY 633

Query: 637 YRSHSPVKKNQTTPKTASRTTLKSDSSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSAS 696
           YRSHSPVK               S SSD       + SIQ+RV NLL +S+D    KSA 
Sbjct: 634 YRSHSPVK--------------LSGSSDA------RSSIQKRVQNLLKSSQDSPVKKSAH 673

Query: 697 GYGKYTD 703
           GYG+ ++
Sbjct: 674 GYGEVSE 680

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/827 (44%), Positives = 476/827 (57%), Gaps = 92/827 (11%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P I LY  GT+LTVG+H A I KYLTSGGFAQ+Y  EI+P D YS +N ACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGIAYEVFVLMEFCERGGLIDF 119
           P K GLNTLRAEVDAMKLLKNN+HVVSYIDS+A KS  N  +YEV +LME+CE GGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MN+RLQ+RL E+EIL I+SQT QG+A MH LQP L+HRDIKIENVL S +G +K+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           V G IRPPRN QE +YVQHDIL NTTAQYR PEM+DLYR  PIDEKSDIWALGVFLYK+C
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFEK+GE AILHS++QYP+FP YSDRLK LI +ML E P++RPNIC++LEE+S +Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 300 NEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTT 359
             PCPI+NFYL+RA     QLA++       +  ++  AQ +Q +      +P+ + +  
Sbjct: 301 GVPCPIQNFYLIRAQ----QLANQIQLQRQTTVPKIATAQPIQQLNARTQTMPIINTKAN 356

Query: 360 PNLGT-LTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPLSDDFASLYYRELHPF 418
            +L T +T  + + N           P  +L++  P     S  L  D     Y +LHPF
Sbjct: 357 TSLVTPITVPVLSENT--------RLPALELDIKVPQF---SPSLDKDM----YMKLHPF 401

Query: 419 QKSQTFKSVESFQXXXXXXXXXXXXXXXXXKNND--RASTSTVDRPNNYVDSVTQTIDNM 476
           QKS T  +                       N D  R  TS  D   N  + + +++   
Sbjct: 402 QKSGTLLTPSKTASVSPIRRYISRSPSRDNTNYDIQRRRTSQYDHDQNQSNYMGRSLSRT 461

Query: 477 AALNLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQN 536
           +++   +S+ A++       E  +  N TG S  +  ++K+K+V+TGESR++SPI+SRQ+
Sbjct: 462 SSI---KSTSALS------FEGNLQGNNTGDSFAQKFTNKIKRVVTGESRNASPIRSRQD 512

Query: 537 TGDSIRSAFGMLRHGLTGSSVSNNRTISFDSXXXXXXXXSVNRRLAXXXXXXXN---FNF 593
           TG S+RSAFG +R   TGS     R  S D+        + N   +       +    N 
Sbjct: 513 TGGSVRSAFGAIRGAFTGSM----RAPSLDNNTNNSMHNNSNNNTSRNSSYGRHNIITNP 568

Query: 594 DTKRXXXXXXXXXXENRRSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKTA 653
             +             R +MPP +L D +  E  N    + +YYRSHSP K         
Sbjct: 569 IKEEDSRNMTKAKLAKRHTMPPGMLYDLENLEIENEGYHASEYYRSHSPTKPF------- 621

Query: 654 SRTTLKSDSSDIDVKQVNKESIQRRVHNLLNNSEDPLA-------HKSASGYG---KYTD 703
                        V +  +++IQ+RV NLL+ SE P+        H +A  +    +  +
Sbjct: 622 -------------VTKTTRDNIQQRVQNLLSESEQPMERNNIDTHHTNAVSHSMIPRNLN 668

Query: 704 VNAEASNRHSSVRITPITE-GKFNKYYNSGTLKGETSRNDXXXXXXXXXXXXXXXXXTEI 762
              + S R+SSV I P+ + G   K       K    R                      
Sbjct: 669 SREKDSLRYSSVVINPLEDIGSSPKKAPPLPFKPHHLRPKPPPKPTYL------------ 716

Query: 763 QNTRNFSRLQSRQPQMERISSEATETIVDVNVDDLEADFRKRFPSKV 809
             ++ FS+        ERISS ATE +V ++VD LE DFRKRFPS +
Sbjct: 717 --SKMFSK--------ERISSTATEQLVTLDVDTLERDFRKRFPSTL 753

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/848 (43%), Positives = 484/848 (57%), Gaps = 96/848 (11%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           M+ P +  Y  GTVLTVGSH A+IIKYLTSGGFA +Y+AEISPPDP S++  ACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSS-IACLKRVLV 59

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119
           PDK  LN+LRAEVDAMKLLK +K VVSYIDSHAAKS +N  +YEVF+LME+C RGGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNTRLQ+RL+E E+L+IMSQ  QG+AAMH LQPPLIHRDIKIENVLIS DG +KVCDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           V GVIRPP+N QE NYVQHDIL NTTAQYRSPEMIDLYR  P+DEKSDIWALGVFLYK+C
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFEK+GE AILHS++Q+P++PQYSD+LK LI  +L E P QRPNICQ+L EVSR+Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 300 NEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTT 359
             PCP++NFYL R M    Q   +                        Q + P+ H  + 
Sbjct: 300 GVPCPVKNFYLERKMLLQQQQQQQ------------------------QQLQPLRHSVSQ 335

Query: 360 PNLGTLTKAITNNNQTESILPVRTQPESDLNL-GNP-----LMKTKSVPL---SDDFASL 410
           P +  +T  IT     + +L       ++  L  +P     L+ ++S PL   +D F +L
Sbjct: 336 PQMEAITLPITLQPHPQKVLASAQVSYANTGLTASPTAQQKLLYSRSQPLPARNDPFLNL 395

Query: 411 YYRELHPFQKSQTFKSV----ESFQXXXXXXXXXXXXXXXXXKNNDRASTS--------T 458
               L P +    F  +    E                      N R   S        +
Sbjct: 396 DKSNLLPPKTKLEFPELKYNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTS 455

Query: 459 VDRPNNYVDSVTQTIDNMAAL-NLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKL 517
           VDR ++YVDS TQT + +  L      SV+    S    +  V E  TGGS  R +  KL
Sbjct: 456 VDRLSSYVDSETQTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKL 515

Query: 518 KKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTGSSVSNNR----TISFDSXXXXXX 573
           K++I+ E R++SPI+SRQNTG S RSAF  LR G T S+ S++R    ++ F        
Sbjct: 516 KRIISNEPRNTSPIRSRQNTGGSTRSAFSTLRRG-TSSNFSSDRSKRNSVDFSVRRLGSG 574

Query: 574 XXSVNRRLAXXXXXXXNFN-FDTKRXXXXXXXXXXENRRSMPPSILSDFDKHERNNSRTG 632
              V    +       N N F+ K            NR     SI SD +K+E   + + 
Sbjct: 575 GNKVRVSSSKSIEEKGNTNKFENK----------GHNRSVSTSSITSDLNKYE-GKAGSV 623

Query: 633 SRDYYRSHSPVKKNQTTPKTASRTTLKSDSSDIDVKQVNKESIQRRVHNLLNNSEDPLAH 692
           SR Y ++HSP+K                    +   + ++ SIQ+RVH+LL NS+D    
Sbjct: 624 SRGYNQAHSPIK--------------------MSANRESRNSIQKRVHDLLKNSQDSPVR 663

Query: 693 KSASGYGKYTDVNAEASNRHS---------SVRITPITE-GKFNKYYNSGTLKGETSRND 742
           K+A  +G+++    + +  H+         +V  +P+ +    +  + S T+   T ++ 
Sbjct: 664 KTAPDFGEFSSFPQDHAADHTISDKVIDVHNVTSSPVVQKATLDTTHQSNTVVSPTRKHF 723

Query: 743 XXXXXXXXXXXXXXXXXTEIQNTRNFSRLQSRQ-PQMERISSEATETIVDVNVDDLEADF 801
                             +        ++++   P+  R S+ A     +V++DDLE DF
Sbjct: 724 TRTREKPVPPPKPVRLRPKPPPKPFHLKVKNLVIPKKGRYSNRANTLSDEVDIDDLEEDF 783

Query: 802 RKRFPSKV 809
           +KR+PS +
Sbjct: 784 KKRYPSAI 791

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/848 (44%), Positives = 469/848 (55%), Gaps = 97/848 (11%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN     +Y PGT LTVGSH A+IIKYLTSGGFA +YTAEI P D  S A  ACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119
           PDK  LN LRAEVDAMKLL+ N+HVVSYIDSHAAKS V+  +YEVF+LME+C  GGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNTRLQ+RL+E E+L+I S   QGIAAMH LQPPLIHRDIKIENVLIS D  +KVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           V GVIRPP+N QEFNYVQHDIL NTTAQYR+PEMIDLYR  PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFEK GEAAILHSR+Q+PS+PQYSD LK LI  ML E P+QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 300 NEPCPIRNFYLLRAMGQNAQLASEPPSVTY---VSAQQLLPAQTLQGIKHLQSMVPVTHV 356
             PCP+RNFY+ RAM Q  Q     P + +    S  +L  A  +  +     M     +
Sbjct: 301 GTPCPLRNFYVTRAMQQQQQHQQ--PKIKFDHSASQPKLDSANNIINVPF--KMSHNQPL 356

Query: 357 RTTPNLGTLTKAITNNNQTESILPVRTQPESD--------LNLGNPLMKTKSV-----PL 403
           R+T           +N    ++ P+  QP S            GN  +++K       P+
Sbjct: 357 RSTQTFAGAPVNAASNGYLPALKPLPIQPVSSSFTNGPFKFIEGNKALQSKQTPHFQPPI 416

Query: 404 SDDFASLYYRELHPFQKSQTFKSVESFQXXXXXXXXXXXXXXXXXKNNDRASTSTVDRPN 463
           S DF  L         +SQTF    +                     +  A+ + V+   
Sbjct: 417 SHDFNRL--------GRSQTFTPTSTLASRSSVSPPLAGRGDISKIIS--ANPTNVEPSP 466

Query: 464 NYVDSVTQTIDNMA---ALNLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKV 520
            Y+ S TQT D  A   AL L ++    +  S       V    TGGS  R    KL KV
Sbjct: 467 IYLSSGTQTDDGFASSHALKLERTKSIASLSS----SESVESQHTGGSATRRFGQKL-KV 521

Query: 521 ITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTGSSVSN---NRTISFDSXXXXXXXXSV 577
            TGE RS SPIKSRQNTGDS+RSAF  LR G +G S  +   N+  S D           
Sbjct: 522 FTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLD----------- 570

Query: 578 NRRLAXXXXXXXNFNFDTKRXXXXXXXXX----XENRRSMPPSILSDFDKHERNNSRTGS 633
              ++        F F                   +R S   SI+SD D+ ++++  TG+
Sbjct: 571 ---ISSTSSHSNGFKFRVSSSESIEEENVYPRFSHSRSSSSASIVSDLDQLQQDD--TGA 625

Query: 634 RDYYRSHSPVKKNQTTPKTASRTTLKSDSSDIDVKQVNKESIQRRVHNLLNNSEDPLAHK 693
           ++YY+SHSPVK                    +   Q ++ SIQ+RV +LL NS+D    K
Sbjct: 626 KNYYKSHSPVK--------------------VSATQGSRSSIQKRVQDLLKNSQDSPVKK 665

Query: 694 SASGYGKYT--DVNAEAS----------NRHSSVRITPITEGKFNKYYNSGTLKGETSRN 741
           +A GYG  +  D  AE +          N H S   TP       +  +     G+    
Sbjct: 666 TAHGYGMLSPGDEAAELASQLTNETMLQNVHQSTASTPKVLSPAKRNSSVVIKAGQQVSK 725

Query: 742 DXXXXXXXXXXXXXXXXXTEIQNTRNFSRLQSRQPQMERISSEATETIVDVNVDDLEADF 801
           D                  +  +     ++     + E  + E +  I D+ +D+LE DF
Sbjct: 726 DAEEVPSSRKPAPPKPKRPKKPSHLKADKIIK---EAETSAYEHSVDISDIEIDELEKDF 782

Query: 802 RKRFPSKV 809
           ++RFPS V
Sbjct: 783 KRRFPSAV 790

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/590 (51%), Positives = 376/590 (63%), Gaps = 58/590 (9%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN PQI  Y  GT+L VGSH  K++KYL SGGFA VY+ EISPPDP    N ACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119
           PDK  LNTLRAEVD+MK L+ NK +VSYIDSHA KS VN   YEV++LME+C  GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNTRLQ+RL+E EIL IMSQ  QG+AAMH LQPPLIHRDIKIENVL+S +  +K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           VSGVIR PRN++EFNYVQ+DI+ NTTAQYR PEMIDLYR  PIDEKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFEK+GE+AIL S++++P++P+YSDR+K LI +ML   P +RPNICQV+EEVSR+Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 300 NEPCPIRNFYLLRAMGQNAQ-LASEPPSV----------TYVSAQQLLP-----AQTLQG 343
             PCPI+NFYLLR M +  Q   S PP V          T VS Q L P      QT   
Sbjct: 301 GIPCPIKNFYLLRMMDKQEQPRVSPPPHVPQMTVPATVPTSVSTQHLPPQVVSNVQTPSK 360

Query: 344 IKHLQSMVPVTHVRTTPNLGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMK------ 397
              +Q + P  HV  +  + T    ++        +P   Q  S+    +P  K      
Sbjct: 361 TASIQHL-PYLHVSKSQPMVTQQDLLSQKQPAGKTVP---QTVSNYTSSDPFSKIDRSAL 416

Query: 398 ------TKSVPLSDDFASLYYRELHPFQKSQTFKSVESFQXXXXXXXXXXXXXXXXXKNN 451
                  +S+P +     L Y++ H   +SQ+     S                     N
Sbjct: 417 LSTSATMESLPRAMRIPQLEYQQPHLLTRSQSVVPRASVSPV----------------RN 460

Query: 452 DRASTSTV--------DRPNNYVDSVTQTIDNMAALNLNQSSVAINKPSGPPKESIVPEN 503
            R + S++        DRP  YVDS TQT D+ + L L++S    +  S       +   
Sbjct: 461 GRGAISSILASNRTSLDRP-KYVDSETQTSDHPSELGLSRSLSRKSVASSLSSAESLEAT 519

Query: 504 VTGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLT 553
            TGGS+ R + SK+KKVITGE R  S I+S QNTG+S++SAF  LR G++
Sbjct: 520 STGGSLTRKIGSKMKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGIS 569

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/316 (79%), Positives = 275/316 (87%), Gaps = 3/316 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P+I  Y+PGTVLTVGSHHAK+I YLTSGGFAQVY+AEI P D + ++N ACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAMKLL+NNKHVVSYIDSHAAKS   NG +YEVF+LME+C  GGLID
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNG-SYEVFLLMEYCAGGGLID 119

Query: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178
           FMNTRLQ+RL+E EIL IMSQ  QGIAAMH LQPPLIHRDIKIENVLISH G YKVCDFG
Sbjct: 120 FMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFG 179

Query: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238
           SV GVIRPP+N QEF YVQHD+L NTTAQYRSPEMIDLYR  PIDEKSDIWALGVFLYK+
Sbjct: 180 SVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKL 239

Query: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
           CYYTTPFEK GE AILHSR+Q+P+ P YSDRLKGLI  MLME P QRPN+CQVLE+VSR+
Sbjct: 240 CYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRM 299

Query: 299 QNEPCPIRNFYLLRAM 314
           Q   CP+RNFYLLRAM
Sbjct: 300 QGIQCPVRNFYLLRAM 315

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  513 bits (1320), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 241/339 (71%), Positives = 278/339 (82%), Gaps = 2/339 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P+I  Y PGT+L VGSH  +IIKY+TSGGFAQ+YT EISPPD + ++N ACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119
           PDK  LNTLRAEVDAMKLL+NNKHVVSYIDSHA+KS  N  +YEVF+LME+CERGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNTRLQ+RL ESE+L I SQ  QGIAAMH LQPPL+HRDIKIENVLIS    YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           VSG+IRPP N QE  YVQHD+L NTTAQYRSPEMID YR  PIDEKSDIWA+GVFLYK+C
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 240 YYTTPFEKS-GEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
           YYTTPFEK+ GEAAIL +RY+YP+FP YS+RLK LIH MLME P QRPNI QV+EE+S++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 299 QNEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLP 337
           QN PCPI NFYL+    ++  +  +P  V  ++  Q  P
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMVQLQPIPVNTLNVSQTHP 339

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  522 bits (1345), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 238/324 (73%), Positives = 271/324 (83%), Gaps = 1/324 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN PQI LY PGT+LTVGSH  +++KYLTSGGFAQ+YT +ISPPD ++N N ACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGIAYEVFVLMEFCERGGLIDF 119
           PDK  LNTLRAEVD MKLL+NN HVVSYIDSHAAK + N  +YEVF+LME+C+ GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNTRLQ RLRE EIL IMSQ  QGIAAMH L PPL+HRDIKIENVL++  G YKVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           V G+IRPP N+QE +YVQHDI+ NTTAQYR+PEMIDLYR  PIDEKSDIWALGVFLYK+C
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFEK+GEAAILH+ +Q+P++PQYSDRLK LI  MLME PSQRPN  QVLEEVS +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 300 NEPCPIRNFYLLRAMGQNAQLASE 323
           N  CPI NFYL+       Q+A +
Sbjct: 301 NVQCPIPNFYLMNNNVTQGQMAMQ 324

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  514 bits (1323), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 276/484 (57%), Positives = 323/484 (66%), Gaps = 24/484 (4%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P+I  Y PGTVL+VG+HHAKI+KY+ SGGFAQVY+AE+ P D  +  N  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118
           P+K GLN LRAEV+AMKLLK +KHVV YIDSHAA+S+  NG  YEVF+LMEFC  GGLID
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNG-TYEVFLLMEFCTAGGLID 119

Query: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178
           FMNTRLQ+RL+E EIL IMSQ  QGIAAMH LQPPLIHRDIKIENVLIS DG YKVCDFG
Sbjct: 120 FMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFG 179

Query: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238
           SVSG IRPPRN QEF +VQHDIL NTTAQYRSPEMIDLYR   IDEKSDIWALG+FLYK+
Sbjct: 180 SVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKL 239

Query: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
           CYYTTPFEK G+ AILHSRYQ+ + P YSDRLK LI  ML + P QRPNICQVLEEVSR+
Sbjct: 240 CYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRM 299

Query: 299 QNEPCPIRNFYLLRAMGQ-NAQLASEPPSVTYVSAQQLL-PAQTLQGIKHLQSM----VP 352
           Q    P+RNFYLLRAM   N   +   P V+ V+    + P   +  +   QS+    +P
Sbjct: 300 QGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMP 359

Query: 353 VTHVRTTPN-LGTLTKAITNNNQTESILPVRTQPESDLNLGNPLMKTKSVPL-SDDFASL 410
           V     TP  +  + K  +  +   +I P    P        P      VP+ S D +S 
Sbjct: 360 VG---VTPQPMPIMAKTRSGISTGGNIFPGAANPMVVPTQLGPAQVAGPVPMGSQDMSSG 416

Query: 411 YYRELHPFQKSQTFKSVESFQXXXXXXXXXXXXXXXXXKNNDRASTSTVDRPNNYVDSVT 470
               L PF ++ T  + + F                     +    +  DRP NYVDS T
Sbjct: 417 I---LPPFNRASTLPT-DGFSTGPGKDGGVITSAV------NTGPETIKDRPFNYVDSET 466

Query: 471 QTID 474
           QT D
Sbjct: 467 QTSD 470

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  507 bits (1305), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 231/315 (73%), Positives = 271/315 (86%), Gaps = 1/315 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN PQ+++Y PGT+L+VGSH A+IIKYLTSGGFAQVYTAEISP DP+ N++  CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCERGGLIDF 119
           PDK  LNTLRAEVDAMKLL+NN HVVSYIDSHAAK    I +YEVF+LME+C+RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNTRLQ+RL E+EIL+IMSQ  QG+AAMH LQPPL+HRDIKIENVL++  G YK+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           V G+IRPP N QEF YVQHDI+ NTTAQYRSPEMI+L +  PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFEK+GE AILH+ +Q+P+FP YSDR+K LI + L   PSQRPNI Q+LEEVS++Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 300 NEPCPIRNFYLLRAM 314
           N PCPI +FYL R +
Sbjct: 301 NVPCPIPDFYLQRKL 315

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  506 bits (1304), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 237/324 (73%), Positives = 267/324 (82%), Gaps = 2/324 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P++   + GT LTVG+H  KI+KYLTSGGFAQ+Y  EI     ++ +N ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119
           PDK  LN LRAEVDAMKLL NNKHVVSYIDSHA +S  N   YEVF+LME+CE GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNTRLQ+RL E EIL+IMSQT QGIA MH L PPL+HRDIKIENVL+S  G+YKVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           VSGVIRPPRN QE  YVQHDI+ NTTAQYR PEM+DLYR  PIDEK+DIWALGVFLYK+C
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFEK GE AILH+R+Q+PSFP YSDRLK LI  ML E PS RPN+CQVLEEVSR+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 300 NEPCPIRNFYLLRAMGQNAQLASE 323
           N PCPIRNFYLLRAM +  +L++E
Sbjct: 301 NVPCPIRNFYLLRAM-EKVKLSTE 323

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 80/159 (50%), Gaps = 11/159 (6%)

Query: 659 KSDSSD----IDVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASNRHSS 714
           +SD SD    ++     ++SIQ RV +LL+N       KSA GYGKYTD   E S+  ++
Sbjct: 533 RSDGSDFRLPLNPNSEKRKSIQLRVQHLLDNMSSNEVKKSAQGYGKYTD---ELSSTGTN 589

Query: 715 V-RITPITE--GKFNKYYNSGTLKGETSRNDXXXXXXXXXXXXXXXXXTEI-QNTRNFSR 770
           + ++TP +        + +  T++  + +N                      +     S 
Sbjct: 590 IPKVTPDSPVLADLIDFNDVPTIRIPSDKNQLSKSGKIKPAPPPKPKKLRSNKKISTLSA 649

Query: 771 LQSRQPQMERISSEATETIVDVNVDDLEADFRKRFPSKV 809
           L+    Q +RI+S+AT+ ++ +NVDDLE DF++RFPS V
Sbjct: 650 LRLEPKQNDRITSDATDVLMHLNVDDLEEDFKRRFPSAV 688

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  499 bits (1284), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 233/323 (72%), Positives = 266/323 (82%), Gaps = 5/323 (1%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P+I LY PG +L VGSH AKI+KYLTSGGFAQVY  EISP D +S +N ACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-----VNGIAYEVFVLMEFCERGG 115
           PDK  LN  RAEV+AMKLL+NNK+VVSYIDSHAAKS     V   +YEVF+LME+C   G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 116 LIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVC 175
           LIDFMNTRLQ+RL+E EIL IMS   QG+AAMH LQPPL+HRDIKIENVLIS+   +K+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 176 DFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFL 235
           DFGSV GVIRPP N  E ++VQHDIL NTTAQYRSPEM+ L ++ PI+EKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 236 YKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
           YK+CYYTTPFEK GE AILHSRYQYP++PQYSD LK LI +MLM  PS+RPNICQV+EEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 296 SRLQNEPCPIRNFYLLRAMGQNA 318
           SRLQ  PCP++NFYL RA+ Q A
Sbjct: 301 SRLQGVPCPLKNFYLERAIRQTA 323

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 12/105 (11%)

Query: 643 VKKNQTTPKTASRTTLKSD---SSDIDVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYG 699
           + KN +     SR++  S+   SS++  K V K SI  R  N + ++      K+A GYG
Sbjct: 577 LSKNDSKNAVDSRSSFNSNAEPSSELTNKTVKKNSITDRYLNSVGDNGVTSVKKTAEGYG 636

Query: 700 KYTDVNAEASNRHSSVRITPITEG----KFNKYYNSGTLKGETSR 740
           KYT V+ +  +  S     P+  G      NKY     +KG T +
Sbjct: 637 KYTKVSDKEGSLTSVNTAKPLESGHKSENTNKY-----IKGNTKQ 676

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  499 bits (1285), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 233/315 (73%), Positives = 263/315 (83%), Gaps = 1/315 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P I  Y  G  L VG HHA I+KYLTSGG+AQVY A+ISPPD  + ++  CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLIDF 119
           PDK  LNT RAEVDAMKLL+N  HVVSYIDS+AAKS ++  AYEV +LMEFC  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNTRLQ+RL+E EIL IMSQ  QG+AAMH L+PPL+HRDIKIENVLIS+ G YK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           V GVIRPP + QEFN+VQHDIL NTTAQYR+PEMIDL R+ PIDEKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFEK+GEAAILHSRY+Y ++P YSD LK LI LML   PSQRPNICQVLEEVSRLQ
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 300 NEPCPIRNFYLLRAM 314
             PCPI+NFYL RA+
Sbjct: 301 GIPCPIKNFYLERAI 315

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%)

Query: 666 DVKQVNKESIQRRVHNLLNNSEDPLAHKSASGYGKYT 702
           D  Q +  SIQ R+ NL++N+++   +K AS YGKYT
Sbjct: 579 DSNQSDNNSIQDRMKNLIDNADNIPINKIASDYGKYT 615

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  496 bits (1276), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 224/313 (71%), Positives = 255/313 (81%), Gaps = 1/313 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P I  YDPGT L VG H   IIKYLTSGGFAQ+Y  +++PP+P +  N ACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGIAYEVFVLMEFCERGGLIDF 119
           P+K GLNTLRAEV+AM+LLK   HVV YIDS+AA+S+ N   YEV  LMEFC  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNTRLQ+RL+E E+L IM+Q  QGI AMH L PPLIHRDIKIENVLIS +G YKVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           VSG+IRPP+N++EFN+VQ DI+ NTTAQYR PEM+DLYR  PI+EKSDIWALGVFLYKIC
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFE  GE AILH+RYQYP +P YS RLK LI +MLME P QRPN+CQVLEEVS +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 300 NEPCPIRNFYLLR 312
             PCP+ NFYL R
Sbjct: 301 GIPCPLPNFYLQR 313

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  492 bits (1267), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 249/416 (59%), Positives = 307/416 (73%), Gaps = 22/416 (5%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN PQI  Y+ GT LTVGSH  +IIKYLTSGGFAQVY+A I+PPDP+SN++ ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAM+LLKNN++VVSYIDSHAAK++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNG-SYEVFVLMEYCERGGLID 119

Query: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178
           FMNTRLQ+RL E EIL+IMSQ  QG+AAMH LQPPLIHRDIKIENVLIS +  YK+CDFG
Sbjct: 120 FMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFG 179

Query: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238
           SV G+IRPPRNSQE +YVQ DIL NTTAQYRSPEMID +R  PIDEKSDIWALG+FLYK+
Sbjct: 180 SVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKL 239

Query: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
           CYYTTPFEK G+ AIL  ++++P +P YS++LKGLI  +L++ P  RPN+ Q+L+ +S +
Sbjct: 240 CYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIM 299

Query: 299 QNEPCPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRT 358
           QN PCPI +  +++A           PS ++++  +L      Q I  L S  P T   T
Sbjct: 300 QNVPCPINDIQVVQA-----------PS-SHLNLTELHQLSATQNILSLNS--PTTMENT 345

Query: 359 TPNLGTLTKAITNNNQTESILPVR--TQPESDLNLGNPLMKTKSVPLSDDFASLYY 412
            PN  T   ++ +N  T  + P R  +Q   D +  N      S PL D   ++Y+
Sbjct: 346 MPN-ATFQISMADNTTTAQMHPNRKPSQIAYDASFSNS--AKGSQPLFDKSQNMYH 398

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  487 bits (1253), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 280/564 (49%), Positives = 348/564 (61%), Gaps = 55/564 (9%)

Query: 4   PQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDK 63
           PQ  L  PG +LTVGSH  KII+YLTSGGFAQ+Y+ E+  P P    + ACLKRV VPDK
Sbjct: 5   PQDCL-QPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPI-QGSLACLKRVHVPDK 62

Query: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGIAYEVFVLMEFCERGGLIDFMNT 122
             LNTLRAEVDAMK+LK ++HVVSYIDSHAAKS  +   YEV++LME+C RGGLIDFMN+
Sbjct: 63  PSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNS 122

Query: 123 RLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSG 182
           RLQ+RL E E+L+IMS   QGI AMH L PPLIHRDIKIENVLIS DG +KVCDFGSVSG
Sbjct: 123 RLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSG 182

Query: 183 VIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYT 242
           VIRPP+N+ EFNYVQHDIL NTTAQYR+PEMIDLYR  P+DEKSDIWALGVFLYK+CY+T
Sbjct: 183 VIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFT 242

Query: 243 TPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEP 302
           TPFEK GE AIL +++Q+PS+PQY+DRLK LI +ML E P QRPNICQVLEEVSR+Q  P
Sbjct: 243 TPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVP 302

Query: 303 CPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVP-VTHVRTTPN 361
           CP+ NFYL R        A  P  V + ++Q  LP  T Q      +  P VTH +   N
Sbjct: 303 CPLPNFYLERM----KHGACTP--VHHSASQPALPLATHQ----FSTSTPMVTHPQPPAN 352

Query: 362 LGTLTKAITNNNQTESILPVRTQPESD---LNLGNPLMKTKSVPLSDDFASLYYRELHPF 418
                          S LP   QP +      + N     K +P  +  A++    L+  
Sbjct: 353 -------------QMSPLPHGIQPITSNMVYMMHNTTPNIKDIPRENPAATIQKNALYSM 399

Query: 419 QKSQTFKSVESFQXXXXXXXXXXXXXXXXXKNNDRASTSTVDRPNN-------------- 464
             S+   ++ S                       R+S++ +  P N              
Sbjct: 400 SGSEHLSALSSDMHFNRPQLENSHTFSGV---GPRSSSNPIKIPRNEIQKFLSGTPPTSA 456

Query: 465 ----YVDSVTQTIDNMAALNLNQSSVAIN-KPSGPPKESIVPENVTGGSIVRSLSSKLKK 519
               YVDS TQT D + +        A++  P   P+  +  E  TG S++  LS K  +
Sbjct: 457 KKPTYVDSETQTGDIITSNKSGSRPFAMSLSPLSSPE--LFSEQSTGNSLLGRLSRKTIR 514

Query: 520 VITGESRSSSPIKSRQNTGDSIRS 543
             T + + S+P+KS+ + GD + S
Sbjct: 515 SPTSD-KGSNPLKSKSSVGDDLAS 537

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  483 bits (1242), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 220/309 (71%), Positives = 264/309 (85%), Gaps = 3/309 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN PQI  Y+ GT LTVGSH  +IIKYLTSGGFAQVY+A ISPPDP++N+N ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAMKLL+NN++VVSYIDSHAAK+   NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNG-SYEVFVLMEYCERGGLID 119

Query: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178
           FMNTRLQ+RL ESEIL+IM Q  QG+AAMH LQPPLIHRDIKIENVLIS    YK+CDFG
Sbjct: 120 FMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFG 179

Query: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238
           SV GVIRPPRN QE +YV+ D+L NTTAQYRSPEM+D++R  PIDEKSDIWALG+FLYK+
Sbjct: 180 SVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKL 239

Query: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
           CYYTTPFEK GE AIL+ ++++  +P YS++L+ LI  +L++ PSQRPN+ Q+L++++ +
Sbjct: 240 CYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNM 299

Query: 299 QNEPCPIRN 307
           QN P PIR+
Sbjct: 300 QNAPYPIRD 308

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  483 bits (1242), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 265/315 (84%), Gaps = 3/315 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN PQI  Y+ GT LTVGSH  +I+KYLTSGGFAQVY+A ISPPDP+S++N ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAM+LL+NN++VVSYIDSHAAK++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNG-SYEVFVLMEYCERGGLID 119

Query: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178
           FMNTRLQ+RL E EIL+IMSQ  QG+AAMH LQPPLIHRDIKIENVLIS +  YK+CDFG
Sbjct: 120 FMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFG 179

Query: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238
           SV GVIRPPRN QE +YVQ DI  NTTAQYRSPEM+D++R  PIDEKSDIWALG+FLYK+
Sbjct: 180 SVCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKL 239

Query: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
           CYYTTPFEK GE AIL   +++P +P YS++L+ LI  +L++ P QRPN+ Q+L+ +S +
Sbjct: 240 CYYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIM 299

Query: 299 QNEPCPIRNFYLLRA 313
           QN PCPI +  + +A
Sbjct: 300 QNVPCPISDIQVPQA 314

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  482 bits (1240), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 264/315 (83%), Gaps = 3/315 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN PQI  Y+ GT LTVGSH  +IIKYLTSGGFAQVY+  ISPPDP++N N ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAM+LLKNN++VVSYIDSHAAK++  NG +YEVFVLME+CERGGLID
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNG-SYEVFVLMEYCERGGLID 119

Query: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178
           FMNTRLQ+RL E EIL+I+SQ  QG+AAMH LQPPLIHRDIKIENVLIS +  YK+CDFG
Sbjct: 120 FMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFG 179

Query: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238
           SV G+IR PRNSQE +YVQ DIL NTTAQYRSPEMID++R  PIDEKSDIWALG+FLYK+
Sbjct: 180 SVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKL 239

Query: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
           CYYTTPFEK GE AIL  ++++P +P YS++LK LI  +L++ P  RP++ Q+L+ +S +
Sbjct: 240 CYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIM 299

Query: 299 QNEPCPIRNFYLLRA 313
           QN PCPI +   ++A
Sbjct: 300 QNVPCPINDIQTVQA 314

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  483 bits (1244), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 224/314 (71%), Positives = 260/314 (82%), Gaps = 3/314 (0%)

Query: 4   PQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDK 63
           PQ S + PGTVLTVGSH  K++KYLTSGGFAQ+Y  E+  PD     + ACLKRV VPDK
Sbjct: 5   PQDS-FQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVK-DVACLKRVHVPDK 62

Query: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGIAYEVFVLMEFCERGGLIDFMNT 122
           Q LNTLRAEVDAMKLL+ NKH+VSYIDSHA+KSV N  +YEV +LME+C RGGLI FMNT
Sbjct: 63  QSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFMNT 122

Query: 123 RLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSG 182
           RLQ RL+E E+L IM+Q VQGI AMH LQPPLIHRDIKIENVLI+ +G  KVCDFGSV G
Sbjct: 123 RLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSVCG 182

Query: 183 VIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYT 242
           VIRPP+N+ E +YVQHDIL NTTAQYR+PEMIDLYR   +DEKSDIWALGVFLYK+CYYT
Sbjct: 183 VIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCYYT 242

Query: 243 TPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEP 302
           TPFEK+GE AIL + +Q+PS+PQYS+RLK LI +ML E P  RPN CQVLEEV R+Q +P
Sbjct: 243 TPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQGQP 302

Query: 303 CPIRNFYLLRAMGQ 316
           CP++NFYL R++ Q
Sbjct: 303 CPVKNFYLERSLKQ 316

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  460 bits (1183), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 217/312 (69%), Positives = 252/312 (80%), Gaps = 3/312 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P IS Y  GT LTVGSH  +IIKYLT+GGFAQ+Y   ISP DP+S  N ACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV--NGIAYEVFVLMEFCERGGLID 118
           PDK  LN LRAEVDAMKLL+NN+ VVSYIDSHAAKS   NG  YEVF+LME+CE GGLI+
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNG-TYEVFLLMEYCENGGLIN 119

Query: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178
           F+N+RLQ+RL+ESE++ IM    QG+AAMH LQPPL+HRDIKIENVL+S +  +K+CDFG
Sbjct: 120 FLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFG 179

Query: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238
           SVSG IRPP N QE   VQ+DI+ NTTAQYRSPEMID+ R  PIDEKSDIWALGVFLYKI
Sbjct: 180 SVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKI 239

Query: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
           CYYTTPFEKSGEA IL SRY++P+FP YSDRL+ LI  +L   P+ RPNI  V++E+S +
Sbjct: 240 CYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDM 299

Query: 299 QNEPCPIRNFYL 310
           +N  CPI NFYL
Sbjct: 300 KNISCPIINFYL 311

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  450 bits (1157), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 255/315 (80%), Gaps = 1/315 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN  Q+ LY P TV+TVGSH AKI+KYL SGG+AQVY+A ++P D     N ACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK-SVNGIAYEVFVLMEFCERGGLIDF 119
           PDK+ LN LRAEVDA+K+L+N K+VVSYIDSHA+K S +  +YEVFVLME+C  G LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           +NTRL++RLRE EIL IM+Q   G+A MH LQP LIHRDIKIEN+LIS +G YKVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
           V GVIRPPR+ +E  Y+QHDI+ NTTAQYRSPEM+DL +   I+EKSDIWALGVFL+K+C
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           YYTTPFEK GE AIL S++QYP++P YSD LK +I ++L   P +RPNICQ++EE+SRLQ
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 300 NEPCPIRNFYLLRAM 314
               P++NFYL RA+
Sbjct: 301 GIVPPMKNFYLSRAL 315

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/39 (58%), Positives = 28/39 (71%)

Query: 672 KESIQRRVHNLLNNSEDPLAHKSASGYGKYTDVNAEASN 710
           K+SI+RRV  LL  SED   H++ASGYGKYTDV    +N
Sbjct: 611 KDSIKRRVRELLLVSEDEQYHRTASGYGKYTDVQEIVTN 649

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  442 bits (1137), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 210/322 (65%), Positives = 253/322 (78%), Gaps = 7/322 (2%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P I  Y PG V+ VGSH AKI+KYLTSGGFAQ+Y+ EISP D Y+N+N ACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG-IAYEVFVLMEFCERGGLIDF 119
           P+K GLN LR EVDAMKLLKNN+HVVSYIDS+AAKS  G  +YEVF+LME+CERG L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MNT+L+ RL+E E+L IM+Q  QGIAAMH L PPLIHRDIKIENVLIS DGL+KVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKS---DIWALGVFLY 236
           V G+IRPPRN QE  YVQHD++ NTTAQYRSPEMIDL +  PI+ K      W + + + 
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQIM 240

Query: 237 KICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVS 296
            + +YT  F +  E AIL+ RYQYP++P YSDRLK ++ ++L   P +RPNICQ+LEE+S
Sbjct: 241 -LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEIS 297

Query: 297 RLQNEPCPIRNFYLLRAMGQNA 318
           ++QN PCPI NFYL R+  Q A
Sbjct: 298 KIQNIPCPIDNFYLERSRHQGA 319

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 117/259 (45%), Gaps = 39/259 (15%)

Query: 449 KNNDRASTSTVDRPNNYVDSVTQTIDNMAALNLNQSSVAINKPSGPPKESIVPENVTGGS 508
           K N  A  ST  +   YVDS TQT++  +   L  + +        P  S    + TG S
Sbjct: 441 KLNIPAQNSTGSKNKTYVDSETQTLEEPS---LQHTRIL-------PHISTDRTDNTGNS 490

Query: 509 IVRSLSSKLKKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTGSSVSNNRTISFDSX 568
           IV  L  +L+ VIT +S +SS I + Q TG+SI+SA   L++ ++G + +N + +S ++ 
Sbjct: 491 IVSRLGVQLRNVITNDSSASSSIDTVQETGNSIKSAIESLKNSVSGMA-NNVKALSVENA 549

Query: 569 XXXXXXXSVNRRLAXXXXXXXNFNFDTKRXXXXXXXXXXENRRSMPPSILSDFDKHERNN 628
                      RL        N N                N   + P++++    H  N+
Sbjct: 550 RNHL------ERLGSSYSIGSNNNI------------AKPNSAPIIPAVVT---THTSNS 588

Query: 629 SRTGSRDYYRSHSPVKKNQTTPKTA----SRTTLKSDSS-DIDVKQVNKESIQRRVHNLL 683
            +T       +HS +        T      +T+ +S S     V +  K SI++RV NLL
Sbjct: 589 LKTAVSS--PTHSELSDENELYDTLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLL 646

Query: 684 NNSEDPLAHKSASGYGKYT 702
            N+ED    K+A+GYGKYT
Sbjct: 647 KNAEDSPVKKTAAGYGKYT 665

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  452 bits (1164), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 208/322 (64%), Positives = 248/322 (77%), Gaps = 3/322 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN--ANTACLKRV 58
           MN P+I  Y+ G VL +G+H   I KYL  GGFAQVY+  +       N     ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLI 117
           IVPDK GLNTLRAEVDAMKLLK NK++VSYIDSHA +S +    YEVF+LME+C RGG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 118 DFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDF 177
           DF+NTRL  RL+E EIL+IMS   QG+AAMH LQPPLIHRDIKIENVLIS +G YK+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 178 GSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYK 237
           GS   V+RPP+  QE  ++ HDI+ NTTAQYRSPEMID Y   PIDEKSDIWALGVFLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 238 ICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSR 297
           +CYYTTPFEK GE AIL+ ++Q+PS+PQYSD ++ +I +ML + P +RPNICQVLE+VS+
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 298 LQNEPCPIRNFYLLRAMGQNAQ 319
           LQ  PCPI NF L R   QN++
Sbjct: 301 LQGVPCPIENFMLTRIKLQNSR 322

 Score = 35.8 bits (81), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 23/31 (74%)

Query: 515 SKLKKVITGESRSSSPIKSRQNTGDSIRSAF 545
           +K+K      S ++SP+ SRQNTGDSI+SAF
Sbjct: 853 TKIKVSTDSFSSTASPLSSRQNTGDSIKSAF 883

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 672  KESIQRRVHNLLNNSE-DPLAHKSASGYGKYTD 703
            K+ I++RV  LL NSE D    ++A GYGKYTD
Sbjct: 1207 KDLIKKRVMELLKNSETDNGVTRTAHGYGKYTD 1239

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  429 bits (1104), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 199/312 (63%), Positives = 247/312 (79%), Gaps = 3/312 (0%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60
           MN P I  Y+PGT +TVGSH   I+KYLTSGG+AQ+Y+A+I P D +   N A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS--VNGIAYEVFVLMEFCERGGLID 118
           PDK  LNTLRAEVDAMK LK++K++VSYIDSHAAKS  ++G  YEVF++ME+C RGGLID
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDG-TYEVFLIMEYCSRGGLID 119

Query: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178
           FMNTRLQ+RL E+EIL I     QG+AAMH LQPPLIHRDIKIENVLIS+D  YK+CDFG
Sbjct: 120 FMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFG 179

Query: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238
           SVSG IRPP+  +E  YV+HDI+ +TTAQYR+PEM+DL +   +++KSDIWALGVFLYK+
Sbjct: 180 SVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKL 239

Query: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
           CYYTTPFE++GEA IL+   ++P +P YSD +K LI  ML + P  RPNI Q+++ VS+L
Sbjct: 240 CYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKL 299

Query: 299 QNEPCPIRNFYL 310
            N  CPI N ++
Sbjct: 300 LNVNCPIPNIHV 311

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  408 bits (1048), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 253/364 (69%), Gaps = 4/364 (1%)

Query: 9   YDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNT 68
           Y  GT L V SH   I  YLTSGGFAQVYTA I+           CLKRVIVP+KQ LN 
Sbjct: 9   YKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIVPNKQSLNI 68

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG-IAYEVFVLMEFCERGGLIDFMNTRLQSR 127
           LRAEVDAMK+LKNNK++VSYIDSHA +  N   +Y V +LME+C   GL+DFMN RL+ R
Sbjct: 69  LRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDFMNLRLKER 128

Query: 128 LRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPP 187
           L+E EIL+IM+   QG+  MH LQPPL+HRDIKIENVL+S DG +K+CDFGSVSGV+R P
Sbjct: 129 LKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGSVSGVLRSP 188

Query: 188 RNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEK 247
            +S+EF Y+Q+DIL NTTAQYRSPEM++L    PI+EKSDIWALG+ LYK+CYYTTPFE+
Sbjct: 189 TSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLCYYTTPFEE 248

Query: 248 SGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEPCPIRN 307
            G  AI+  ++ YP++PQY+D LK +I ++L   P QRPNICQ+LEE+ R+Q++  P+ N
Sbjct: 249 HGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQHKSSPLPN 308

Query: 308 FYLLRAMGQNAQLASEP---PSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTTPNLGT 364
           FY+ RAM       ++P   P + Y    + + +      KH Q+     +    PNL  
Sbjct: 309 FYVQRAMSSLQMDTTQPHRIPILKYTQMSKPVISSQSSPSKHCQTFSQKDYPYIQPNLSN 368

Query: 365 LTKA 368
             +A
Sbjct: 369 SARA 372

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 500 VPENVTGGSIVRSLSSKLKKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHG--LTGSSV 557
           +  N TGGS+++SL +K+K   TG  RS SPIKSRQNTGDSIRSAF  +R G  L  S +
Sbjct: 498 ISRNSTGGSLIKSLGTKIKLTTTGGKRSQSPIKSRQNTGDSIRSAFNKVRQGINLRSSRI 557

Query: 558 SNNRTI 563
           S+N ++
Sbjct: 558 SSNDSV 563

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%)

Query: 672 KESIQRRVHNLLNNSEDPLAHKSASGYGKYTD 703
           K+SI+ RV  L+ +S D     SA GYGKYTD
Sbjct: 629 KKSIKDRVQALMKSSSDNHVIISAHGYGKYTD 660

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  310 bits (794), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 205/323 (63%), Gaps = 23/323 (7%)

Query: 9   YDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEI--------SPPDPYSNANT-------- 52
           ++PG V+ VG H  +IIKYL  GGFAQ+Y+           + PD   ++N         
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 53  -----ACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG-IAYEVFV 106
                ACLKRV+VPD+ GLN LR EV+ M+ LK   ++V Y DS+A++  +G   +EV +
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLL 138

Query: 107 LMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLI 166
           LME C    L+D+MN RL ++L E EIL+IM     GI+ MH LQ PLIHRDIKIENVL+
Sbjct: 139 LMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLV 198

Query: 167 SHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKS 226
                +K+CDFGS S       + QE   +  +I  +TT QYRSPEMIDLYRN PIDEKS
Sbjct: 199 DSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKS 258

Query: 227 DIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRP 286
           DIWALGVFLYK+ +YTTPFE +G+ AILHS+Y+ P    YS RL  LI +ML E P+ RP
Sbjct: 259 DIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNLRP 317

Query: 287 NICQVLEEVSRLQNEPCPIRNFY 309
           NI QV+ +V        PI++ Y
Sbjct: 318 NIYQVMHQVCITIGIEPPIKDKY 340

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  305 bits (781), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 151/315 (47%), Positives = 204/315 (64%), Gaps = 11/315 (3%)

Query: 9   YDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAE----ISPPDP-----YSNANTACLKRVI 59
           Y PGT++ VG H  +++KYL  GGFA++Y  +    +S  DP       N +  CLKRV+
Sbjct: 29  YVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRVL 88

Query: 60  VPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCERGGLID 118
           V D  GLN +R EV+ M+ LK    VV Y DS+A++ ++G   YEV +LME C    L+D
Sbjct: 89  VQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSLLD 148

Query: 119 FMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG 178
           +MN RL ++L E EIL+IM      +A MH L  PLIHRDIKIENVL+     +K+CDFG
Sbjct: 149 YMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCDFG 208

Query: 179 SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKI 238
           S S  +    + Q+   +  +I  +TT QYRSPEMIDLYR  P++EKSDIWALGVFLYK+
Sbjct: 209 STSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLYKL 268

Query: 239 CYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
            +YTTPFE++G+ AILHS+Y++P    YS +L  LI +ML E P+ RPNI QVL ++  +
Sbjct: 269 MFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQICYI 327

Query: 299 QNEPCPIRNFYLLRA 313
                P+ + Y L A
Sbjct: 328 SGIKNPMDDAYGLGA 342

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  306 bits (785), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 157/328 (47%), Positives = 208/328 (63%), Gaps = 21/328 (6%)

Query: 6   ISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTA-----------EISP--PDPYSNANT 52
           +  Y PG V+ VGSH  +I++Y+  GGFAQ+Y+            E SP   D     + 
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-------AYEVF 105
           ACLKRVIV D+ GLN LR EV+ MK L    ++V Y DS+A++  NG         +EV 
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 106 VLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVL 165
           +LME C    L+D+MN RL ++L E EILE+M      IA MH L+ PLIHRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 166 ISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEK 225
           +     +K+CDFGS S         ++  Y+  +I  +TT QYRSPEMIDLYR  PIDEK
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 226 SDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQR 285
           SDIWALG+FLYK+ ++TTPFE++G+ AILHS++++P    YS +L  LI +ML E P+ R
Sbjct: 255 SDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNLR 313

Query: 286 PNICQVLEEVSRLQNEPCPIRNFYLLRA 313
           PNI QVL ++ +L+  P PI + Y L A
Sbjct: 314 PNIYQVLHQICQLKQVPIPIADKYGLGA 341

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  305 bits (780), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 150/315 (47%), Positives = 202/315 (64%), Gaps = 10/315 (3%)

Query: 4   PQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEI--------SPPDPYSNANTACL 55
           P +    PGT++ VGSH  +I+KYL  GGFA +Y  +         +P       + ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCERG 114
           KRV+V D+ GLN LR EV+ MK LKN+ ++V Y DS+A++  +G   YEV +LME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 115 GLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKV 174
            L+D+MN RL ++L E E+L+IM    + +A MH L  PLIHRDIKIENVL+  +  +K+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 175 CDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVF 234
           CDFGS S         Q+   + ++I  +TT QYR+PEMIDLYR  PIDEKSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 235 LYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEE 294
           LYK+ +YTTPFE +G+ AILHS+Y  P+   YS +L  LI +ML E P+ RPNI QV+ +
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 295 VSRLQNEPCPIRNFY 309
           V  +     P  + Y
Sbjct: 326 VCAIMKVDVPFEDKY 340

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  307 bits (787), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 204/318 (64%), Gaps = 16/318 (5%)

Query: 9   YDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEI--------SPP------DPYSNANTAC 54
           Y  GT + VGSH  ++IKY+  GGFAQ+YT +         S P       P    + AC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 55  LKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAA-KSVNGIAYEVFVLMEFCER 113
           LKRV+V D  GLN +R EV+ M+ L+    VV Y DS+A+ +S +   YEV +LMEFC  
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 114 GGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
             L+D+MN RL +RL E EI++IM  T  GIA +H L+ PLIHRDIKIENVL+  +  +K
Sbjct: 219 NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 174 VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGV 233
           +CDFGS S       N ++      +I  NTT QYRSPEMIDLYR  PIDEKSDIWALGV
Sbjct: 279 LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 234 FLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
           FLYK+ ++TTPFE++G+ AILHS+Y++P    YS +L  LI +ML E PS RPNI QVL+
Sbjct: 339 FLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 294 EVSRLQNEPCPIRNFYLL 311
            +  +     P+ + Y L
Sbjct: 398 YLCSINGWKVPLNDKYGL 415

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  306 bits (785), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 150/322 (46%), Positives = 211/322 (65%), Gaps = 12/322 (3%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAE----------ISPPDPYSNA 50
           +N+P    Y  G +++VG+H  +I+ YL  GGFAQ+Y  +          +      +  
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLME 109
           + ACLKRVIV D+ GLN +R EV+ MK LK++ ++V Y DS+A++  +G   +EV +LME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 110 FCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHD 169
            C    L+D+MN RL+++L ESEIL+IM     GI+ MH L  PLIHRDIKIENVL+  +
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 170 GLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIW 229
             +K+CD GS S    P  ++Q+   +  +I  +TT QYR+PEMIDLYR  PI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 230 ALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNIC 289
           ALG+FLYK+ +YTTPFE +G+ AILHS+Y +P   +YS ++  LI +ML E P+ RPNI 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPP-NKYSSKIINLIIIMLAENPNLRPNIF 310

Query: 290 QVLEEVSRLQNEPCPIRNFYLL 311
           QV+  +  + N P PI + Y L
Sbjct: 311 QVVYHICSIMNLPVPIEDRYGL 332

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  302 bits (773), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 199/308 (64%), Gaps = 11/308 (3%)

Query: 12  GTVLTVGSHHAKIIKYLTSGGFAQVYTA---------EISPPDPYSNANTACLKRVIVPD 62
           G+ + VG+H  +I+KYL  GGFA +Y           E +P        TACLKRV+V D
Sbjct: 32  GSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVLVTD 91

Query: 63  KQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCERGGLIDFMN 121
           + GLN +R EV  MK L    ++V Y DSHA++S +G+  +EV +LME C    L+D+MN
Sbjct: 92  ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPNNSLLDYMN 151

Query: 122 TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
            RL ++L E EIL+IM    + +A MH L  PLIHRD+KIENVL+  D  +K+CDFGS S
Sbjct: 152 QRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCDFGSTS 211

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYY 241
             +      QE   + ++I  +TT QYRSPEMIDLYR  PIDEKSDIWALG+FLYK+ +Y
Sbjct: 212 TCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYKLLFY 271

Query: 242 TTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNE 301
           TTPFE +G+ AILHS+Y++P    YS +L  LI +ML E P+ RPNI Q+++ +  +   
Sbjct: 272 TTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMDNLCSIMKV 330

Query: 302 PCPIRNFY 309
             PI + Y
Sbjct: 331 ENPIEDKY 338

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  303 bits (777), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 155/326 (47%), Positives = 211/326 (64%), Gaps = 29/326 (8%)

Query: 6   ISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN---------------- 49
           I  +  G  + VGSH  +I+KYLT GGFAQ+Y  +++    Y N                
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTE---YLNEFDAIDIQNQRQQQEL 82

Query: 50  --ANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS--VNGIAYEVF 105
              +  CLKRV+V D+ GL+ ++ EV+ MK L+   +VV Y DS+A ++   NG  +EVF
Sbjct: 83  KIGDLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANG-GFEVF 141

Query: 106 VLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVL 165
           +LME+C    L+D+MN RL ++L ESEIL IM     G++ +H L  PLIHRDIKIENVL
Sbjct: 142 LLMEYCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVL 201

Query: 166 ISHDGLYKVCDFGSVSGVIRPP--RNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           + H+  +K+CDFGS +  I PP    +Q+ + + HDI  +TT QYRSPEMIDL+R  P++
Sbjct: 202 VDHNNRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVN 259

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPS 283
           EK+DIWALGVFLYK+ +YTTPFE +G+ AILHS+Y+ P    YS+RL  LI +ML E P+
Sbjct: 260 EKADIWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENPN 318

Query: 284 QRPNICQVLEEVSRLQNEPCPIRNFY 309
            RPNI QVL E+  + N   PI + Y
Sbjct: 319 LRPNIYQVLSEICSILNVEVPIPDIY 344

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  302 bits (774), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 203/319 (63%), Gaps = 11/319 (3%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEI---------SPPDPYSNAN 51
           M  P +  Y PG ++ VG+H  +I+ YL  GGFAQ+Y  +          +   P    +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  TACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEF 110
            ACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A++  +G+  +EV +LME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDG 170
           C    L+D+MN RL ++L ESEI++IM      I+ MH L  PLIHRDIKIENVL+  + 
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 171 LYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWA 230
            +K+ DFGS S         Q+   +  +I  +TT QYRSPEMIDLYR  PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQ 290
           LG+FLYK+ ++TTPFE +G+ AILHS+Y++P   +YS +L  LI +ML E P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 VLEEVSRLQNEPCPIRNFY 309
           VL  +  + N   PI + Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  302 bits (774), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 204/319 (63%), Gaps = 11/319 (3%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEI---------SPPDPYSNAN 51
           M  P +  + PG ++ VG+H  ++I YL  GGFAQ+Y  +          +   P    +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  TACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEF 110
            ACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A++  +G+  +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDG 170
           C    L+D+MN RL ++L ESEI++IM   V  I+ MH L  PLIHRDIKIENVL+  + 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 171 LYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWA 230
            +K+ DFGS S         Q+   +  +I  +TT QYRSPEMIDLYR  PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQ 290
           LG+FLYK+ ++TTPFE +G+ AILHS+Y++P   +YS +L  LI +ML E P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 VLEEVSRLQNEPCPIRNFY 309
           VL  +  + N   PI + Y
Sbjct: 313 VLYHLCEILNIEVPIEDKY 331

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  301 bits (771), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 147/298 (49%), Positives = 190/298 (63%), Gaps = 12/298 (4%)

Query: 12  GTVLTVGSHHAKIIKYLTSGGFAQVYTAEI----------SPPDPYSNANTACLKRVIVP 61
           G+ + VG+   +I+KYLT GGFAQ+Y  +           +   P    + ACLKRV+V 
Sbjct: 28  GSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLKRVLVQ 87

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCERGGLIDFM 120
           D+ GLN +R EV+ MKLLK   ++V Y DS+A++  +G   +EV +LME C    L+DFM
Sbjct: 88  DENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNKSLLDFM 147

Query: 121 NTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSV 180
           N RL ++L E EIL IM      +A MH L PPLIHRDIKIENVL+     +K+ DFGS 
Sbjct: 148 NQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKLADFGST 207

Query: 181 SGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICY 240
           S         Q+   +  DI  +TT QYRSPEMIDLY+  PIDEKSDIWALG+FLYK+ +
Sbjct: 208 SKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIFLYKLLF 267

Query: 241 YTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
           Y TPFE +G+ AILHS+Y +P    YS RL  LI +ML E P+ RPNI QVL E+  +
Sbjct: 268 YITPFEMTGQFAILHSKYDFPQ-TNYSSRLINLIIIMLSENPNLRPNIYQVLHEICSI 324

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  300 bits (767), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 202/319 (63%), Gaps = 11/319 (3%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEI---------SPPDPYSNAN 51
           M  P +  Y PG ++ VG+H  +I+ YL  GGFAQ+Y  +          +   P    +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  TACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEF 110
            ACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A++  +G+  +EV +LME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDG 170
           C    L+D+MN RL ++L E+EI++IM      I+ MH L  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 171 LYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWA 230
            +K+ DFGS S         Q+   +  +I  +TT QYRSPEMIDLYR  PI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQ 290
           LG+FLYK+ ++TTPFE +G+ AILHS+Y++P   +YS +L  LI +ML E P+ RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 VLEEVSRLQNEPCPIRNFY 309
           VL  +  + N   PI + Y
Sbjct: 313 VLCHLCDILNVEVPIEDKY 331

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  300 bits (767), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 202/318 (63%), Gaps = 11/318 (3%)

Query: 4   PQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEI---------SPPDPYSNANTAC 54
           P +  Y PGTV+ VG+   +II ++  GGFAQ+Y+ +              P    + AC
Sbjct: 17  PVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGDIAC 76

Query: 55  LKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG-IAYEVFVLMEFCER 113
           LKRV+VPD+ GL+ +R EV+ MK L+  K ++ Y DS+A++  +G + YEV +LME C  
Sbjct: 77  LKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMELCPN 136

Query: 114 GGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
             L+D+MN RL +RL E EIL++M  T   I+ MH L  PLIHRDIKIENVL+     +K
Sbjct: 137 NSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQNNFK 196

Query: 174 VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGV 233
           +CDFGS S         Q+   +  +I  NTT QYRSPEMIDLYR  PI+EKSDIWALG+
Sbjct: 197 LCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGI 256

Query: 234 FLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
           FLYK+ ++ TPFE +G+ +ILHS+Y++P+  +YS +L  LI +ML E P  RPNI QV+ 
Sbjct: 257 FLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQVMH 315

Query: 294 EVSRLQNEPCPIRNFYLL 311
            +  +     PI + Y L
Sbjct: 316 HICSVIGCEVPIEDKYGL 333

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  299 bits (765), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 200/317 (63%), Gaps = 12/317 (3%)

Query: 4   PQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAE-ISPPDPYSN---------ANTA 53
           P    Y PGT + VG+H  +IIKY+  GGFAQ+Y  + I   + + N          + A
Sbjct: 17  PNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVA 76

Query: 54  CLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCE 112
           CLKRV+V D+ GLN +R EV+ MK L+   ++V Y DS+A++  NG   +EV +LME C 
Sbjct: 77  CLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELCP 136

Query: 113 RGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLY 172
              L+D+MN RL ++L E EIL+IM      ++ MH L  PL+HRDIKIENVL+     +
Sbjct: 137 NKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNF 196

Query: 173 KVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALG 232
           K+CDFGS S         Q+   +  +I  +TT QYRSPEMIDLYR  PIDEKSDIWALG
Sbjct: 197 KLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALG 256

Query: 233 VFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVL 292
           +FLYK+ ++TTPFE +G+ AILHS+Y++P    YS +L  LI +ML E P+ RPNI QVL
Sbjct: 257 IFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQVL 315

Query: 293 EEVSRLQNEPCPIRNFY 309
             +  +     PI + Y
Sbjct: 316 HNICSISGMKVPIEDQY 332

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  298 bits (762), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 146/319 (45%), Positives = 201/319 (63%), Gaps = 11/319 (3%)

Query: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEI---------SPPDPYSNAN 51
           M  P +  Y PG ++ VG+H  +++ YL  GGFAQ+Y  +          +   P    +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  TACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEF 110
            ACLKRV+V D+ GLN +R EV+ MK LK   ++V Y DS+A++  +G+  +EV +LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 111 CERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDG 170
           C    L+D+MN RL ++L E+EI++IM      I+ MH L   LIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 171 LYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWA 230
            +K+ DFGS S         Q+   +  +I  +TT QYRSPEMIDLYR  PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 231 LGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQ 290
           LGVFLYK+ ++TTPFE +G+ AILHS+Y++P   +YS +L  LI +ML E P+ RPNI Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 291 VLEEVSRLQNEPCPIRNFY 309
           VL  +  + N   PI + Y
Sbjct: 313 VLYHLCEILNVEVPIEDKY 331

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  291 bits (746), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 149/319 (46%), Positives = 201/319 (63%), Gaps = 12/319 (3%)

Query: 4   PQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNA----------NTA 53
           P   L  P T + VG+H  +I+++L  GGFA +Y  +        +A          + A
Sbjct: 24  PNSHLLSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIA 83

Query: 54  CLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCE 112
           CLKRVIVPD+ GLN LR EV+ MK L+ + ++V Y DS+A++  +G   +E+ +LME C 
Sbjct: 84  CLKRVIVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCP 143

Query: 113 RGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLY 172
           +  L+D+MN +L ++L E+EIL+IM      IA MH L  PLIHRDIKIENVL+  D  +
Sbjct: 144 KKSLLDYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNF 203

Query: 173 KVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALG 232
           K+CDFGS S         Q+   + ++I  +TT QYRSPEMIDLYR  PI+EKSDIWALG
Sbjct: 204 KLCDFGSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALG 263

Query: 233 VFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVL 292
           +FLYK+ +YTTPFE +G+ AILHS+Y+ P    YS +L  LI +ML E PS RPNI QV+
Sbjct: 264 IFLYKLLFYTTPFELTGQFAILHSKYEIPQ-NGYSSKLINLIIIMLAENPSLRPNIYQVM 322

Query: 293 EEVSRLQNEPCPIRNFYLL 311
             V  +     P  + Y L
Sbjct: 323 HHVCSILKCDVPFTDKYEL 341

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  295 bits (756), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 149/326 (45%), Positives = 204/326 (62%), Gaps = 26/326 (7%)

Query: 9   YDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAE-ISPPDPYSNANT--------------- 52
           +  GT + VGSH  +IIKY+  GGFAQ+Y  + +   + + ++NT               
Sbjct: 24  FPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNP 83

Query: 53  --------ACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIA-YE 103
                   ACLKRV+V D+ GLN +R EV+ MK LK   +VV Y DS+A++  NG + +E
Sbjct: 84  MILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFE 143

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           V +LME C    L+D+MN RL ++L E EIL+IM      ++ MH L+ PL+HRDIKIEN
Sbjct: 144 VLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIEN 203

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           VL+     +K+CDFGS S  +      Q+   +  +I  +TT QYRSPEMIDLYR  PID
Sbjct: 204 VLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPID 263

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPS 283
           EKSDIWALG+FLYK+ ++ TPFE +G+ AILHS+Y++P    YS +L  LI +ML E P+
Sbjct: 264 EKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPN 322

Query: 284 QRPNICQVLEEVSRLQNEPCPIRNFY 309
            RPNI QVL+ +  + N   PI + Y
Sbjct: 323 LRPNIYQVLDNICSMMNVEVPIEDIY 348

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  288 bits (738), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 147/316 (46%), Positives = 197/316 (62%), Gaps = 11/316 (3%)

Query: 6   ISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTA---------EISPPDPYSNANTACLK 56
           I  Y PG ++ VG H  +IIKYL  GGFA++Y A         +I+        +  CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIA-YEVFVLMEFCERGG 115
           RV+V D  GLN +R EV  MK L    ++V   DS+A++  +GIA YEV +LME C    
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 116 LIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVC 175
           L+D+MN RL  +L E EIL+IM      +A MH L  PLIHRDIKIENVL+     +K+C
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 176 DFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFL 235
           DFGS S  +      ++   +  ++  +TT QYRSPEMID+YR   I+EKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 236 YKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
           YK+ +Y TPFE++G+ AILHS+Y++P    YS +L  LI +ML E P+ RPNI QVL  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 296 SRLQNEPCPIRNFYLL 311
            ++ N   PI + Y L
Sbjct: 395 CKIINIKTPIDDIYGL 410

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  290 bits (741), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 148/310 (47%), Positives = 195/310 (62%), Gaps = 16/310 (5%)

Query: 12  GTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN-----------ANTACLKRVIV 60
           G++L VG H  +II+YL  GGFA +Y         Y+N            + ACLKRV V
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIE---YTNELDRHHSVLQRGDIACLKRVQV 87

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCERGGLIDF 119
            D+ GLN LR EV+ MK LK   +VV Y DS+A++  +G   +EV +LME C  G L+D+
Sbjct: 88  NDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDY 147

Query: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179
           MN RL ++L E E+L+IM    +GI+ MH L+ PLIHRDIKIENVL+     +K+CDFGS
Sbjct: 148 MNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGS 207

Query: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239
            S  +      QE   + ++I  +TT QYRSPEMIDLYR   I+EKSDIWALG+FLYK+ 
Sbjct: 208 TSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLL 267

Query: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           +YTTPFE +G+ AILHS+Y  P    +S +L  LI +ML E P  RPNI Q+L  +  + 
Sbjct: 268 FYTTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSIM 326

Query: 300 NEPCPIRNFY 309
               PI + Y
Sbjct: 327 ECDVPIEDHY 336

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  291 bits (746), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 150/329 (45%), Positives = 197/329 (59%), Gaps = 38/329 (11%)

Query: 6   ISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN---------------- 49
           I  Y  GT+LTVG    +I+KYLT GGFAQ+YT        Y N                
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIE---YLNEFDNDDAENDNNSRNL 93

Query: 50  --ANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK------------ 95
              + ACLKRV+VPD+ GL+ +R EVD MK L N  ++V Y DS+A+K            
Sbjct: 94  KIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNN 153

Query: 96  ----SVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQ 151
                   + +E+ +LME+C    L+DFMN RL ++L E+EIL+ M+     +  MH L 
Sbjct: 154 NDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLA 213

Query: 152 PPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSP 211
            PLIHRDIKIENVL+  +  +K+ DFGS + +  P    Q+   +  DI  NTT QYRSP
Sbjct: 214 QPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSP 273

Query: 212 EMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLK 271
           EMIDLY+  PIDEKSDIWALGV LYK+ +YTTPFE +G+ AILHS+Y++P+   YS +  
Sbjct: 274 EMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFI 332

Query: 272 GLIHLMLMEVPSQRPNICQVLEEVSRLQN 300
            LI +ML E P+ RPNI QVL  +  + N
Sbjct: 333 NLIIIMLAENPNLRPNIFQVLYYLKSISN 361

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  289 bits (739), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 145/310 (46%), Positives = 198/310 (63%), Gaps = 11/310 (3%)

Query: 12  GTVLTVGSHHAKIIKYLTSGGFAQVYTA---------EISPPDPYSNANTACLKRVIVPD 62
           G+ + VG+H  +I+KYL  GGFA +Y           E  P       + ACLKRV+V D
Sbjct: 74  GSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVLVTD 133

Query: 63  KQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIA-YEVFVLMEFCERGGLIDFMN 121
           + GLN +R EV  MK L    ++V Y DSHA+++ +G + +EV +LME C    L+D+MN
Sbjct: 134 ENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLDYMN 193

Query: 122 TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
            RL ++L E EIL+IM    + +A MH L  PLIHRD+KIENVL+  +  +K+CDFGS S
Sbjct: 194 QRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFGSTS 253

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYY 241
                    QE   + ++I  +TT QYRSPEMIDLYR  PI+EKSDIWALG+FLYK+ +Y
Sbjct: 254 TCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFY 313

Query: 242 TTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNE 301
           TTPFE +G+ AILHS+Y++P    YS +L  LI +ML E P+ RPNI QV++ +  +   
Sbjct: 314 TTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSILKV 372

Query: 302 PCPIRNFYLL 311
             P+ + Y L
Sbjct: 373 KNPLEDKYQL 382

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  289 bits (740), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 202/326 (61%), Gaps = 19/326 (5%)

Query: 2   NAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTA-------EISPPDPYSN----- 49
           N   I  ++ G  L VG+H  +I+ YLT GGFAQ+Y         E    D  SN     
Sbjct: 24  NVGTIEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISN 83

Query: 50  -----ANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNG-IAYE 103
                 + ACLKRV+V D+ GLN +R EV+ MK L+   ++V Y DS+A +S NG   YE
Sbjct: 84  YSLKLGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYE 143

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           V +LME C    L+++MN RL ++L E E+L+IM     G+A MH L+ PLIHRDIKIEN
Sbjct: 144 VLLLMELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIEN 203

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           VL+  +  +K+CDFGS +         Q+   +  ++  +TT QYRSPEMIDLYR  PI+
Sbjct: 204 VLVDSNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPIN 263

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPS 283
           EKSDIWALGVFLYK+ +YTTPFE +G+ A+LHS++  P+  +YS ++  L+ +ML E  +
Sbjct: 264 EKSDIWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLN 322

Query: 284 QRPNICQVLEEVSRLQNEPCPIRNFY 309
            RPNI QV+  + +L     PI + Y
Sbjct: 323 LRPNIYQVMHYICQLIQVDTPILDIY 348

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  288 bits (737), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 145/316 (45%), Positives = 195/316 (61%), Gaps = 11/316 (3%)

Query: 4   PQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTA---------EISPPDPYSNANTAC 54
           P +  + PG V+ VG+H  +++ YL  GGFAQ+Y           E     P    + AC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIA-YEVFVLMEFCER 113
           LKRV+V D+ GL+ +R EV+ MK L   +++V Y DS+A +  NG A +EV +LME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 114 GGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
             L+D+MN RL ++L E EIL+IM      ++ MH L+ PLIHRDIKIENVL+     +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 174 VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGV 233
           +CDFGS S         QE   +  +I  +TT QYR PEMIDLYR  PI+EKSDIWALG+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 234 FLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
           FLYK+ ++ TPFE +G+ AILHS+Y++P    YS +L  LI +ML E P  RPNI QVL 
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLN 315

Query: 294 EVSRLQNEPCPIRNFY 309
            +  +     PI + Y
Sbjct: 316 HICTMIGVEVPIEDKY 331

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  286 bits (732), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 147/320 (45%), Positives = 201/320 (62%), Gaps = 20/320 (6%)

Query: 4   PQISLYDP-GTVLTVGSHHAKIIKYLTSGGFAQVYTAEI-------------SPPDPYSN 49
           PQI    P G V+TVGSH  +++ YL  GGFAQ+Y  +              S   P   
Sbjct: 90  PQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKP 149

Query: 50  ANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAK--SVNG---IAYEV 104
            + ACLKRV+V D+ GLN +R+EV+ MK L+   ++V Y DS+A++    +G     +EV
Sbjct: 150 GSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEV 209

Query: 105 FVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENV 164
            +LME C    L+D+MN RL ++L E EI +IM      +A MH L  PLIHRDIKIENV
Sbjct: 210 LLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENV 269

Query: 165 LISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDE 224
           L+  +  +K+CDFGS S       + Q+   +  D+  +TT QYRSPEMIDL++  PI+E
Sbjct: 270 LVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINE 329

Query: 225 KSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQ 284
           KSDIWALGVFLYK+ ++TTPFE++G+ A+LHS++++P    YS +L  LI +ML E PS 
Sbjct: 330 KSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPP-NSYSSKLINLIIVMLAENPSL 388

Query: 285 RPNICQVLEEVSRLQNEPCP 304
           RPNI QVL  +S + N   P
Sbjct: 389 RPNIYQVLYYLSEVTNREVP 408

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  285 bits (729), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 144/313 (46%), Positives = 200/313 (63%), Gaps = 10/313 (3%)

Query: 6   ISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVY-------TAEISPPDP-YSNANTACLKR 57
           + +   G+ + VG H  ++I+YL  GGFA +Y       T E+   D      +T CLKR
Sbjct: 26  LEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKR 85

Query: 58  VIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCERGGL 116
           V V D+ GLN LR EV+ MK L+N  ++V Y DS+A++  +G   YEV +LME C  G L
Sbjct: 86  VRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSL 145

Query: 117 IDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCD 176
           +D+MN RL ++L E+E+L+IM     G++ MH  + PLIHRDIKIENVL+  D  +K+CD
Sbjct: 146 LDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCD 205

Query: 177 FGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLY 236
           FGS S  +    + QE   + ++I  +TT QYRSPEMIDLYR  PI+EKSDIWALG+FLY
Sbjct: 206 FGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 265

Query: 237 KICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVS 296
           K+ +YTTPFE +G+ AILHS+Y+ P    +S +L  L+ +ML E P  RPN+ QV+  + 
Sbjct: 266 KLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHIC 324

Query: 297 RLQNEPCPIRNFY 309
            +      I + Y
Sbjct: 325 SMMECEVKIDDLY 337

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  288 bits (737), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 204/322 (63%), Gaps = 16/322 (4%)

Query: 6   ISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAE-ISPPDPYSN----------ANTAC 54
           I  Y PG +++VG+H  KI  YL  GGFAQ+Y  + I   + + N           + AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCER 113
           LKRV+V D+ GLN +R EV+ MKLL+   ++V Y DS+A +  +G+  YE+ +LME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 114 GGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
             L+D+MN RL+++L E+EI++IM  T   ++ MH L  PLIH+DIK+EN+L+  +  +K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 174 VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGV 233
           +CDFGS S       +  +   +  +I  +TT QYRSPEMIDLYR  PI+E SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 234 FLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
           FLYK+ ++ TPFE++G+ +ILH+++  P    Y  +L  LI +ML E  + RPNI QV+ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIP-VNNYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 294 EVSRLQNEPCPIRNFYLLRAMG 315
           E+  + N P PI + Y    MG
Sbjct: 331 EICSITNTPLPIEDKY---GMG 349

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/352 (24%), Positives = 149/352 (42%), Gaps = 72/352 (20%)

Query: 13  TVLTVGSHHAKIIKYLTSGGFAQVYTAE-----------ISPPDPYSNANTACLKRVIVP 61
           T + V     KI + L  GG + VY  +           ++ P+ Y+      LK++I P
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYA------LKKIICP 74

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN 121
           + + ++    E++  K  ++  +V+  IDS   +  +G +  +++++ F   G L D +N
Sbjct: 75  NVESISNGMREIENYKRFQS-PYVIQSIDSQVMQEKDG-SKSIYIILPFYTLGSLQDSIN 132

Query: 122 TRL--QSRLRESEILEIMSQTVQGIAAMH-----------------------------VL 150
            RL   + + E+E + IM   ++G+  +H                             + 
Sbjct: 133 RRLLEGTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLE 192

Query: 151 QPPL---------------IHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNY 195
             PL                HRDI   N+L S DGL  + D GS S       N  +   
Sbjct: 193 DTPLEMDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRE 252

Query: 196 VQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEA---- 251
           +Q  +  N T  Y +PE++ L  N  +D K DIW+LG   Y + +  +PFE+  +     
Sbjct: 253 LQEWVNDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGAS 312

Query: 252 ---AILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQN 300
              AI   +Y +P   ++S+ L  +I   +   P QRP   Q+L  +  L++
Sbjct: 313 ITYAINTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLES 364

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 94.4 bits (233), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 83/338 (24%), Positives = 141/338 (41%), Gaps = 60/338 (17%)

Query: 13  TVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAE 72
           + +++     +I K L  GG + VY  E    + ++   T C             ++ + 
Sbjct: 17  SFVSINGRKYRIQKLLGEGGLSFVYLVESKEGELFALKKTRC----------PFGSIGSI 66

Query: 73  VDAMKLLKNNK-----HVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRL--Q 125
             AMK + N +     ++   +DS   +  +G +  V+VL+ +  +G L D +N  L   
Sbjct: 67  SPAMKEVANYQRFSSPYIAQIVDSQVVQEKDG-SKTVYVLLPYFAKGSLQDLINRHLLDC 125

Query: 126 SRLRESEILEIMSQTVQGIAAMHVLQP--------------------------------- 152
           +++ E +IL +     +G+  +H   P                                 
Sbjct: 126 TQMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGES 185

Query: 153 --PLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRS 210
                HRD+K  N++IS + L  + D GS S       + Q     Q     N T  Y +
Sbjct: 186 QQSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYAA 245

Query: 211 PEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEK----SGEA---AILHSRYQYPSF 263
           PE++D+  NS I EK DIW+ G  +Y +C+  +PFE+    SG +   AI   +Y  P  
Sbjct: 246 PEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRG 305

Query: 264 PQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNE 301
             YS  L  LI   L   P QRP++ +++  +  LQ +
Sbjct: 306 TSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQGQ 343

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 95.1 bits (235), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 75/300 (25%), Positives = 136/300 (45%), Gaps = 57/300 (19%)

Query: 55  LKRVIVP--DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCE 112
           LKR+  P  + + ++    EVD  K  ++  ++++ +DS   +  +G +  + +L+ +  
Sbjct: 73  LKRIRCPFGNIESISAAMKEVDNYKRFQS-PYIITLVDSQVVQEKDG-SKTLCILLPYFP 130

Query: 113 RGGLIDFMNTRL--QSRLRESEILEIMSQTVQGIAAMH---------------------- 148
            G L D +N  L   + + E+E + IM    +G+  +H                      
Sbjct: 131 LGSLQDMVNRNLLKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYS 190

Query: 149 ------VLQPPL----------------IHRDIKIENVLISHDGLYKVCDFGSVSGVIRP 186
                 +   PL                +HRDI++ N+L S +GL  V D GS       
Sbjct: 191 DEAAFLLDDTPLELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADIT 250

Query: 187 PRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFE 246
                + N +Q  +  N +  Y +PE++++  NS ID K+DIW++G   Y + +  +PFE
Sbjct: 251 VSTKHQLNELQDWVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFE 310

Query: 247 K----SGEA---AILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
           +    SG +   AI   +Y +P   +YS+ L  +I   L   P+ RP+I ++L+ +  LQ
Sbjct: 311 RELQVSGASLTYAIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/332 (24%), Positives = 141/332 (42%), Gaps = 60/332 (18%)

Query: 13  TVLTVGSHHAKIIKYLTSGGFAQVYTAEI-----SPPDPYSNANTACLKRVIVPDKQGLN 67
           T + V     KI + L  GG + VY  ++     S  +  + A    LK++I P  + ++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRL--Q 125
               E++  K  ++  +V+  IDS   +  +G +  +++++ +   G L D +N RL   
Sbjct: 81  NGMREIENYKRFQS-PYVIQSIDSQVMQEKDG-SKTIYIILPYYSLGSLQDSINRRLLEG 138

Query: 126 SRLRESEILEIMSQTVQGIAAMH-----------------------------VLQPPL-- 154
           + + E+E + IM    +G+  +H                             +   PL  
Sbjct: 139 TFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLEM 198

Query: 155 -------------IHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDIL 201
                         HRDI   N+L S DGL  + D GS S       N  + + +Q  + 
Sbjct: 199 DMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWVN 258

Query: 202 TNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEA-------AIL 254
            N T  Y +PE+++L  N  +  K DIW++G   Y + +  +PFE+  +        AI 
Sbjct: 259 DNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAIN 318

Query: 255 HSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRP 286
             +Y +P   ++S+RL  +I   +   P QRP
Sbjct: 319 TGKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 87/331 (26%), Positives = 152/331 (45%), Gaps = 57/331 (17%)

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRES 131
           E +A++ L N++ +V    +   +S       ++ L+E+   G  +  M  +    L E 
Sbjct: 230 EKNALQRLNNSRGIVKLFFTFQDES------SLYFLLEYAPNGDFLSVM--KKYGSLSED 281

Query: 132 EILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQ 191
                 +Q + GI  +H     +IHRDIK EN+L+  D   K+ DFG+    I  P+N  
Sbjct: 282 CTRYYSAQIIDGIKYLH--SKGIIHRDIKPENILLDKDMKVKITDFGTAK--ILEPKNED 337

Query: 192 EFNYVQHDILTNT-----TAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFE 246
           E N  + ++LT +     TA+Y SPE+++   +S +D + DIWA G  ++++     PF+
Sbjct: 338 EDN-PEFNLLTRSKSFVGTAEYVSPELLN---DSYVDARCDIWAFGCMVFQMIAGKPPFK 393

Query: 247 KSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEPCP 304
            + E        + QY     +   ++ L+  +L++VP QR  I Q+ +           
Sbjct: 394 ATNEYLTFQKVMKVQYAFTAGFPVVVRDLVKRILLKVPEQRLTIPQIEK----------- 442

Query: 305 IRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTTPNLGT 364
             +FY          ++ E  SV    A ++ P +      + +SM PV  ++  PN  T
Sbjct: 443 -HHFY--------KDISFEDGSVWTAPAPEIQPYKI-----NAKSMQPVPELKDAPNKRT 488

Query: 365 --------LTKAITNNNQTESILPVRTQPES 387
                   L KA TN++ T + LP   +PE+
Sbjct: 489 IINIPKRQLQKAHTNSSSTPN-LPTIERPET 518

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 131/271 (48%), Gaps = 50/271 (18%)

Query: 46  PYSNANTACLKRVIVPD-KQGLN---TLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIA 101
           P S+A T  LK++ + D K   N   T+  E++  KL+  +K+++S ID     +     
Sbjct: 70  PTSDA-TLALKKLPINDYKLKTNRRSTILKEIEIHKLVNGHKNIISMIDHFEIDAT---- 124

Query: 102 YEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKI 161
             +++++E C  G L D +  R +  LRE E   +M Q    +  +H  +  ++H D+K+
Sbjct: 125 --MYMVLELCGAGSLYDII-CRSKRSLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKL 179

Query: 162 ENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNT-----TAQYRSPEMI-- 214
            N+LI      ++CDFG               ++V  DI  N+     T  Y SPE+I  
Sbjct: 180 SNILIDSSNNLQLCDFGH--------------SFVSTDIDNNSINKFGTPNYLSPEIISN 225

Query: 215 -------DLYRNSPIDEKSDIWALGVFLYKICYYTTPFE----KSGEAAILHSRYQYPSF 263
                  DLY      ++SDIW++G+ LY + +  TPFE    +S    I+  +Y +   
Sbjct: 226 FILSDKKDLY----FPKESDIWSIGIVLYAMIFDKTPFEATTLRSTYENIVECKYGFVEN 281

Query: 264 PQYSDRLKGLIHLMLMEVPSQRPNICQVLEE 294
            + S+++K LI  +L   P +R  I +++ +
Sbjct: 282 KRVSNKVKKLIQNILKIQPLERKTIVEIVSD 312

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 136/328 (41%), Gaps = 60/328 (18%)

Query: 17  VGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTA-----CLKRVIVPDKQGLNTLRA 71
           V     +I + L  GG + VY  ++S      +   A      LK++I P  + ++    
Sbjct: 25  VNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMR 84

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRL--QSRLR 129
           E++  K  ++  +V+  IDS   +  +G +  +++++ +   G L D +N RL   + + 
Sbjct: 85  EIENYKRFQS-PYVIKSIDSQVMQEKDG-SKTIYIVLPYYSLGSLQDSINRRLLEGTFVS 142

Query: 130 ESEILEIMSQTVQGIAAMH-----------------------------VLQPPL------ 154
           E+E + IM    +G+  +H                             +   PL      
Sbjct: 143 EAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDMLS 202

Query: 155 ---------IHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTT 205
                     HRDI   N+L S DGL  + D GS S       N  + + +Q  +  N T
Sbjct: 203 SNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNCT 262

Query: 206 AQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEA-------AILHSRY 258
             Y  PE+++L  N  +  K DIW+LG   Y + +  +PFE+  +        AI   +Y
Sbjct: 263 LPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGKY 322

Query: 259 QYPSFPQYSDRLKGLIHLMLMEVPSQRP 286
            +P   ++S+ L  +I   +   P QRP
Sbjct: 323 SFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/336 (23%), Positives = 145/336 (43%), Gaps = 60/336 (17%)

Query: 15  LTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVD 74
           ++V  H   I + L  GGF+ VY  E        N   A LK++  P      ++ +   
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVE-----SRENGLMA-LKKIRCP----FGSIGSISP 68

Query: 75  AMKLLKNNK-----HVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRL--QSR 127
           AMK + N +     ++   IDS   +  +G +  V++L+ +  +G L D +N  L   ++
Sbjct: 69  AMKEVDNYQKFKSPYIAQIIDSQVVQERDG-SKTVYILLPYFSKGSLQDEINRHLLDCTQ 127

Query: 128 LRESEILEIMSQTVQGIAAMHVLQPP---------------------------------- 153
           + E E++ +     +G+  +H   P                                   
Sbjct: 128 VPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQ 187

Query: 154 -LIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPE 212
              H DIK  N++IS +G+  + D GS S       + Q     Q     + T  + +PE
Sbjct: 188 AYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPE 247

Query: 213 MIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGE---AAILHS----RYQYPSFPQ 265
           ++D+  NS I EK D+W+ G  +Y +C+  +PFE+  +   A++ +S    +Y  PS   
Sbjct: 248 ILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTN 307

Query: 266 YSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNE 301
           YS  L  ++   L   P  RP++ +++  +  LQ++
Sbjct: 308 YSSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQSQ 343

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 123/269 (45%), Gaps = 34/269 (12%)

Query: 31  GGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQG--LNTLRAEVDAMKLLKNNKHVVSY 88
           G F  VY         Y   N  C  +V+  D     +  ++ EV  +  LK   ++  Y
Sbjct: 28  GKFGIVYKGY------YIKTNRVCAIKVLNLDSADDEVEDVQKEVQFLSSLKQVPNITHY 81

Query: 89  IDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMH 148
             S+   +      E++V+ME+C  G L   +      ++ E  I  IM + +  IA MH
Sbjct: 82  YGSYLNNT------ELWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELL--IALMH 130

Query: 149 VLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQY 208
           + +  +IHRDIK  NVLI++DG  K+CDFG  + + +     Q             T  +
Sbjct: 131 IHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTM---------AGTPYW 181

Query: 209 RSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKSGEAAILHSRYQYPSFP-- 264
            +PE+I        D K DIW+LG+  Y+I     P+   ++  A  L ++ + P     
Sbjct: 182 MAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGR 239

Query: 265 QYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
           Q+S  LK  I L L E P +RP+  ++L+
Sbjct: 240 QHSSALKEFIALCLDEDPKERPSAEELLK 268

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 127/273 (46%), Gaps = 28/273 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      ++    A   ++ +  ++    L +E+   K +K++ ++V
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHS-NIV 155

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L+D +  R    L E E+    +Q    I  
Sbjct: 156 QFIDCFEDDA------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKY 207

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           +H  +  +IHRD+K+ N+    D   KV DFG ++ V+    N +E  Y         T 
Sbjct: 208 LHSRR--IIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANDRERKYT-----VCGTP 256

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILH----SRYQYPS 262
            Y +PE++ + ++S    + DIW++GV +Y +     PF+      I       +Y YP 
Sbjct: 257 NYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLCKYGYPK 315

Query: 263 FPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
               S   + LIH +L   P QRP I  ++++V
Sbjct: 316 DKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 79/151 (52%), Gaps = 7/151 (4%)

Query: 156 HRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMID 215
           H+DIK  N++ S DGL  +CD GS S       +  +    Q     + T  +RSPE+++
Sbjct: 212 HKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVEFQEWCNEHCTLPFRSPELLN 271

Query: 216 LYRNSPIDEKSDIWALGVFLYKICYYTTPFEK----SGEA---AILHSRYQYPSFPQYSD 268
           +  NS IDEK DIW+LG  LY +C+  +PFE+    SG +   AI   ++  P    YS 
Sbjct: 272 VTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGASMTYAIATGKFSIPPNTNYSP 331

Query: 269 RLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
            L  +I   +     +RP+I ++L  +  LQ
Sbjct: 332 ELIKIIKDCIEVDSKKRPSIDELLARLQDLQ 362

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 70/140 (50%), Gaps = 12/140 (8%)

Query: 13  TVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVP--DKQGLNTLR 70
           +VL  G H+A I + L  GGF+ VY  +        N +   LK++  P  + + ++   
Sbjct: 20  SVLINGQHYA-IQRLLGEGGFSFVYLVQ-----SRENNDLFALKKIHCPFGNIESVSEAM 73

Query: 71  AEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRL--QSRL 128
            EV++ K  ++  ++   + S   +  +G +  VF+L+ +   G L+D +NT L   + +
Sbjct: 74  REVNSYKKFRS-PYITHCVSSQVLQEQDG-SKTVFILLPYFPTGSLLDKINTHLLDGTTI 131

Query: 129 RESEILEIMSQTVQGIAAMH 148
            E EI+ I+    +G+  MH
Sbjct: 132 SEEEIVRILVSVARGLRTMH 151

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 99/193 (51%), Gaps = 16/193 (8%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++++ME+C  G   D +       + ES++  I+  TV+G+  +H      IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLH--DQKKIHRDIKAAN 143

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +L++  G  K+ DFG VSG IR       F           T  + +PE+I+  +    +
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGTF---------VGTPYWMAPEVIN-KQCKGYN 192

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSF-PQYSDRLKGLIHLMLME 280
           EK+DIW+LG+  Y++     P  K     ++ +  + + P    QYS++ K  + L L++
Sbjct: 193 EKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQYSEKAKYFVSLCLIK 252

Query: 281 VPSQRPNICQVLE 293
            P QRP+I  +LE
Sbjct: 253 DPKQRPSIEALLE 265

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 79/338 (23%), Positives = 140/338 (41%), Gaps = 72/338 (21%)

Query: 13  TVLTVGSHHAKIIKYLTSGGFAQVYTAE-----------ISPPDPYSNANTACLKRVIVP 61
           T + V     KI + L  GG + VY  +           I  P+ Y+      LK++I P
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYA------LKKIICP 74

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN 121
             + ++    E++  K  ++  +V+  IDS   +  NG +  +++++ +   G L D +N
Sbjct: 75  SVESISNGMREIENYKRFQS-PYVIQSIDSQVTQEKNG-SKIIYIILPYYSLGSLQDSIN 132

Query: 122 TRL--QSRLRESEILEIMSQTVQGIAAMH-----------------------------VL 150
            RL   + + E+E + IM    +G+  +H                             + 
Sbjct: 133 RRLLEGTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLE 192

Query: 151 QPPL---------------IHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNY 195
             PL                HRDI   N+L S +GL  + D GS S       +  + + 
Sbjct: 193 DTPLEMDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSE 252

Query: 196 VQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEA---- 251
           +Q  +  N T  Y +PE+++L  N  +  K DIW++G   Y + +  +PFE+  +     
Sbjct: 253 LQEWVNDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGAS 312

Query: 252 ---AILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRP 286
              AI   +Y +P   ++S+ L  +I   +   P QRP
Sbjct: 313 ITYAINTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 126/262 (48%), Gaps = 33/262 (12%)

Query: 31  GGFAQVYTAEISPPDPYSNANTACLKRVIV---PDKQGLNTLRAEVDAMKLLKNNKHVVS 87
           G F  VY A       +   N A +   +V     ++ ++ L  E+  +  L++      
Sbjct: 24  GNFGDVYKA-------FDKTNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRS-----P 71

Query: 88  YIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAM 147
           YI ++    +  ++  ++++ME+C  G   D + T   + L E+++  I  + ++G+  +
Sbjct: 72  YITNYITTMIEDVS--MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVLKGLKYL 129

Query: 148 HVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQ 207
           H  +   IHRDIK  N+L++ +G  K+ DFG VSG IR       F           T  
Sbjct: 130 HDQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRATMKRGTF---------VGTPY 177

Query: 208 YRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSF-P 264
           + +PE+++   N   +EK+DIW+LG+ +Y++     P  K     ++ S  R + P    
Sbjct: 178 WMAPEVVNKESNG-YNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRKPPKLHG 236

Query: 265 QYSDRLKGLIHLMLMEVPSQRP 286
           QYSD  KG +   L++ P+ RP
Sbjct: 237 QYSDVAKGFVAACLVKDPNLRP 258

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 95/195 (48%), Gaps = 23/195 (11%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIE 162
           +V++ +E+C    L +++   +Q R+   E  ++ +Q V  +   H LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLKLE 157

Query: 163 NVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPI 222
           N+L+   G  K+ DFG                    + +  TT  Y +PE+I+  R S  
Sbjct: 158 NILLDKKGRAKITDFGFTRECA---------TKTMLETVCGTTV-YMAPELIE--RKSYD 205

Query: 223 DEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRL-----KGLIHLM 277
             K DIW+LGV LY + + T PF++  E            F  Y+D +     K LI  +
Sbjct: 206 GFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPF--YNDDVVSKDAKDLISQL 263

Query: 278 LMEVPSQRPNICQVL 292
           L + PSQRP + QVL
Sbjct: 264 LCKDPSQRPQLSQVL 278

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 134/285 (47%), Gaps = 49/285 (17%)

Query: 17  VGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVP--DKQGLNTLRAEVD 74
           VG++  KI+K +  G F +VY A   P            K+V++   DK   N +R    
Sbjct: 36  VGNY--KILKQIGEGSFGKVYLALHKP----------THKKVVLKSSDKTDPNVVR---- 79

Query: 75  AMKLLKNNKHVVSYIDSHAAKSVNGIAYE--VFVLMEFCERGGLIDFMNTRLQSRLRESE 132
             ++  + +    YI     K    I  E  V++++E+C    L D++ ++ +  L ES 
Sbjct: 80  --EIFYHRQFDFPYI----TKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDES- 132

Query: 133 ILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQE 192
              I +Q V  +   H L    +HRD+K+EN+L+  D   K+ DFG           +++
Sbjct: 133 -ARIFAQIVGAVYYAHSLS--CVHRDLKLENILLDKDNNAKLTDFGF----------TRD 179

Query: 193 FNY-VQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFE----K 247
           F+   Q + +  TT  Y +PE+  L R      K DIWALG+ LY I   T PF+    K
Sbjct: 180 FSKNTQLETICGTTV-YMAPEL--LRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPK 236

Query: 248 SGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVL 292
             E  I+ +   Y +   ++D    L++ +L + PS RP I Q+L
Sbjct: 237 KTELKIISASPDYDN-KYFNDDSIDLVNRLLSKDPSMRPTIEQIL 280

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 124/270 (45%), Gaps = 27/270 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      ++    A   ++ +  ++  N L +E+   K +++ +++V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRH-QNIV 158

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID      +N     V++L+E C  G L+D +  R    L E E+    +Q    +  
Sbjct: 159 HFIDCFE-DDIN-----VYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALDH 210

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH     +IHRD+K+ N+    D   K+ DFG ++ +I    N  E  Y         T 
Sbjct: 211 MH--SRNIIHRDLKLGNIFFDKDFNLKIGDFG-LAAII---NNENERKYT-----ICGTP 259

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAIL----HSRYQYPS 262
            Y +PE+I   +      + DIW+LGV ++ +     PF+    + I     H  Y +P+
Sbjct: 260 NYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFPT 319

Query: 263 FPQYSDRLKGLIHLMLMEVPSQRPNICQVL 292
               S  +K LI  +L   P +RP I ++L
Sbjct: 320 DKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 104/215 (48%), Gaps = 27/215 (12%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++++ME+C  G   D +       L E ++  I    ++G+  +H  +   IHRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLH--EQRKIHRDVKAAN 149

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSP-- 221
           VL++ DGL K+ DFG VSG +R       F           T  + +PE+I    NS   
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNTF---------VGTPYWMAPEIIS---NSSHG 196

Query: 222 IDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS---RYQYPSFPQYSDRLKGLIHLML 278
            +EK+DIW+LG+ +Y++     P+ K     ++ +   +        +SD  K  I   L
Sbjct: 197 YNEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVSFSDAAKLFISACL 256

Query: 279 MEVPSQRPNICQVLEE-------VSRLQNEPCPIR 306
           ++ P +RP   ++L++       ++ L+NE   I+
Sbjct: 257 IKDPDERPTATELLQQPFVKNIKITDLRNEVMEIK 291

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 104/233 (44%), Gaps = 30/233 (12%)

Query: 66   LNTLRAEVDAMKLLK--NNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN-T 122
            L T+ +E+  M  L   +NK+++S +D              +V      + G ID  +  
Sbjct: 1049 LGTIPSEIQIMSTLNKTSNKNILSILDFFEDDDY------YYVEQPVHGKTGCIDLFDLI 1102

Query: 123  RLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSG 182
              ++ + E E   I  Q + GI+ +H  +  ++HRDIK ENV++   G  K+ DFGS + 
Sbjct: 1103 EFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVKLIDFGSAAY 1160

Query: 183  VIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKICY 240
            V   P           D+   T   Y SPE++  + Y   P     DIWALG+ LY I +
Sbjct: 1161 VKNGP----------FDVFVGTI-DYASPEVLRGEKYEGKP----QDIWALGILLYTIVF 1205

Query: 241  YTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
               PF    E  IL    ++P     S     LI L+L     +RP+I  + E
Sbjct: 1206 KENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDISE 1256

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 94/364 (25%), Positives = 152/364 (41%), Gaps = 88/364 (24%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNN 82
           KI+K +  G F +VY A            + CL    V  K G              KN+
Sbjct: 38  KILKIVGEGSFGKVYLA------------SHCLTHQKVVLKMGS-------------KND 72

Query: 83  KHVV-------SYIDSHAAKSVNGIAYEVFVLM--EFCERGGLIDFMNTRLQSRLRESEI 133
            +VV        +  SH  K    I  E +V M  E+C    L +++  +    L E   
Sbjct: 73  PNVVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECS- 131

Query: 134 LEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFG-----SVSGVIRPPR 188
            E+ SQ V  +   H ++   +HRD+K+EN+L+   G  K+ DFG     +  G++    
Sbjct: 132 -ELFSQIVGAVYYAHSMK--CVHRDLKLENILLDKKGHAKLTDFGFTRECATKGIL---- 184

Query: 189 NSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKS 248
                     + +  TT  Y +PE+I+  R      K D W+LG+ LY + + T PF++ 
Sbjct: 185 ----------ETICGTTV-YMAPELIE--RKPYEGYKIDTWSLGIILYTMIHGTMPFDEV 231

Query: 249 GEAAILHSRYQY-PSFP-QYSD-RLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEPCPI 305
            E    +    Y P++   Y D   K LI  +L + P+QRP++ QVL+          P 
Sbjct: 232 DEVKTKYKIVHYNPTYDNDYIDSNGKELISQLLEKDPNQRPSLTQVLQH---------PF 282

Query: 306 RNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTTPNLGTL 365
              Y L+ + +                ++++ AQ+  G KH  S +    ++   N G  
Sbjct: 283 LQPYGLKILER---------------TEKVIRAQS-HGTKHFHSKLERKLLKKLKNSGFD 326

Query: 366 TKAI 369
           T+AI
Sbjct: 327 TQAI 330

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 122/269 (45%), Gaps = 34/269 (12%)

Query: 31  GGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQG--LNTLRAEVDAMKLLKNNKHVVSY 88
           G F  VY         Y+     C  +V+  D     +  ++ E+  +  LK   ++  Y
Sbjct: 28  GKFGVVYKGY------YTKTKQVCAIKVLNLDSADDEVEDVQKEIQFLSSLKQVPNITHY 81

Query: 89  IDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMH 148
             S+   +      +++V+ME+C  G L   +      ++ E  I  IM + +   A MH
Sbjct: 82  YGSYLNDT------KLWVIMEYCAGGSLRTLLR---PGKIGEQYIGVIMRELL--TALMH 130

Query: 149 VLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQY 208
           + +  +IHRDIK  NVLI++DG  K+CDFG  + + +     Q             T  +
Sbjct: 131 IHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTM---------AGTPYW 181

Query: 209 RSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKSGEAAILHSRYQYPSFP-- 264
            +PE+I        D K DIW+LG+  Y+I     P+   ++  A  L ++ + P     
Sbjct: 182 MAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGR 239

Query: 265 QYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
           Q+S  LK +I L L E P +RP+   +L+
Sbjct: 240 QHSSALKEIIALCLDEDPKERPSAEDLLK 268

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 122/266 (45%), Gaps = 26/266 (9%)

Query: 31  GGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYID 90
           G F  VY A  +    Y       L+       + ++ L  E+  +  LK++ ++++YI 
Sbjct: 25  GNFGDVYKAIDNITKKYVAIKVINLEY----SDEDIDLLAQEIFFLAELKSD-YIINYIT 79

Query: 91  SHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVL 150
           +            ++++M++C  G   D +     + + E ++  I+   + G+  +H  
Sbjct: 80  TIMED------VSMWIVMDYCGGGSCSDLIKIVYPNGIVEEKVSFIVKNVLLGLQYLH-- 131

Query: 151 QPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRS 210
           +   IHRDIK  N+L++ DG  K+ DFG VSG I+       F           T  + +
Sbjct: 132 EQKKIHRDIKAANILLTDDGQVKLGDFG-VSGQIKATLKRDTFV---------GTPYWMA 181

Query: 211 PEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFPQ-YS 267
           PE+I+   N+  DEK DIW+LG+  Y++     P  K     ++ S  + + P     Y+
Sbjct: 182 PEVINKEINNGYDEKVDIWSLGITTYELLKGVPPLSKYDPVKVMTSLVKRKPPKLHGPYN 241

Query: 268 DRLKGLIHLMLMEVPSQRPNICQVLE 293
           D  K  I   L++ P  RPN+  +L+
Sbjct: 242 DFTKSFISFCLIKDPKLRPNVQNLLK 267

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 84/179 (46%), Gaps = 20/179 (11%)

Query: 115  GLIDFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
            G ID  +   L++ + E E   I  Q V  I  +H     ++HRDIK ENV++   G  K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLH--SQGIVHRDIKDENVVVDSKGFVK 1151

Query: 174  VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEK-SDIWALG 232
            + DFGS + V   P           D+   T   Y +PE++      P D K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 233  VFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            V LY I +   PF    E  IL    ++      S+    LI ++L + PSQRP I +V
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 132/274 (48%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      ++    A   ++ +  ++    L +E+   K +K+  ++V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMKH-PNIV 152

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            ++D     +       V++L+E C  G L+D M  R    L E E+    +Q    +  
Sbjct: 153 HFVDCFEDDT------NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVKY 204

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    D   KV DFG ++ V+    N++E  Y         T 
Sbjct: 205 MHSRR--VIHRDLKLGNIFFDKDYNLKVGDFG-LAAVL---ANNRERKYT-----VCGTP 253

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++ + +++    + DIW++GV +Y +     PF+ + +  +++ R     Y YP
Sbjct: 254 NYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQ-AKDVNVIYDRIKACQYGYP 311

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                S   K LI  +L   P +RP+I +++++V
Sbjct: 312 KDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 110/227 (48%), Gaps = 27/227 (11%)

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRES 131
           E +A++ + N+K +V    +   +S       ++ L+E+C  G  +  M  +    L E+
Sbjct: 227 EKNALQRINNSKMIVKLFFTFQDES------SLYFLLEYCPNGDFLSLM--KKYGSLNET 278

Query: 132 EILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQ 191
                 +Q +  I  +H     +IHRDIK EN+L+  +   K+ DFG+   +     N  
Sbjct: 279 VACYYSAQVIDAIDYLHT--NGIIHRDIKPENILLDKEFKIKLTDFGTAKILDSSTNN-- 334

Query: 192 EFNYVQHDILTNT-----TAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFE 246
                + D+LT +     TA+Y +PE+++   +S +D + D+WA G  LY++     PF+
Sbjct: 335 -----KFDLLTRSKSFVGTAEYVAPELLN---DSFVDYRCDVWAFGCILYQMIAGKPPFK 386

Query: 247 KSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            + E        + QY     +   ++ L+  +L++  +QRP+I Q+
Sbjct: 387 ATNEYLTFQKVMKVQYAFTAGFPLIIRDLVKKILVKDLNQRPSISQI 433

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 99/195 (50%), Gaps = 16/195 (8%)

Query: 102 YEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKI 161
           Y ++++ME+C  G   D + T  +  L E+++  ++   + G+  +H      IHRDIK 
Sbjct: 85  YLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHAQHK--IHRDIKA 142

Query: 162 ENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSP 221
            N+L++  GL KV DFG VS  +R    ++ F           T  + +PE++ +     
Sbjct: 143 ANILLTDSGLVKVADFG-VSAEMRSTMKAKTF---------VGTPYWMAPEVV-MNEGMG 191

Query: 222 IDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSF-PQYSDRLKGLIHLML 278
            +EKSDIW+LG+  Y++     P  K     ++ +  + + P     Y++ +K  I   L
Sbjct: 192 YNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIATCL 251

Query: 279 MEVPSQRPNICQVLE 293
           ++ P +RP+  ++LE
Sbjct: 252 IKDPEKRPSASELLE 266

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 84.3 bits (207), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 81/180 (45%), Gaps = 22/180 (12%)

Query: 115  GLIDFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
            G ID  +   L++ + E E+  I  Q V GI  +H     +IHRDIK ENV++   G  K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 174  VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  D Y   P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 232  GVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            G+ LY I +   PF    E  IL     +      S   K LI ++L     +RP I  +
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDDI 1432

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 123/270 (45%), Gaps = 28/270 (10%)

Query: 28  LTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVS 87
           L  GGFA+ +   I      S A     K+ I  ++     L +E+   + L+ + H+V 
Sbjct: 99  LGEGGFARCF--HIKDDVGISFACKIVSKKSIKTERTKFKLL-SEIQIHQNLRYS-HIVK 154

Query: 88  YIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAM 147
           ++D    +        V++L+E C  G L+D +  R    L E+E+  + +Q    I  M
Sbjct: 155 FMDCFEDE------LNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGAINYM 206

Query: 148 HVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQ 207
           H     +IHRD+K+ NV    +   K+ DFG  + +     N  E  Y         T  
Sbjct: 207 H--SNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATL----SNVSEKKYTMCG-----TPN 255

Query: 208 YRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILH----SRYQYPSF 263
           Y +PE+I L +      ++DIW+LG+ +Y +     PF+      I       +Y++P  
Sbjct: 256 YIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYEFPPD 314

Query: 264 PQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
              ++ +K LI  +L+  PSQRP I  +L+
Sbjct: 315 KYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 94/196 (47%), Gaps = 19/196 (9%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++ L+E+   G  +  M  +    L E       +Q +  I  MH     +IHRDIK EN
Sbjct: 244 LYFLLEYAPNGDFLSVM--KKYGSLNEECACYYGAQILDAIGFMHTRG--IIHRDIKPEN 299

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNT-----TAQYRSPEMI-DLY 217
           +L+  D   K+ DFG+ + ++    N    N   +++LT +     TA+Y SPE++ D Y
Sbjct: 300 ILMDKDMKVKITDFGT-AKILDEKTNGN--NKTSYELLTRSKSFVGTAEYVSPELLNDNY 356

Query: 218 RNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFPQYSDRLKGLIH 275
                D + DIWA G  LY++     PF+ + E        + QY     +   ++ LI 
Sbjct: 357 S----DSRCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTIIRDLIK 412

Query: 276 LMLMEVPSQRPNICQV 291
            +L++VP QR  I Q+
Sbjct: 413 RILLKVPEQRLTIGQI 428

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 130/274 (47%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      ++    A L    +  ++    L +E+   K +K+ ++VV
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMKH-QNVV 142

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L+D +  R    L E E+    +Q    I  
Sbjct: 143 QFIDCFEDDT------NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIKY 194

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    +   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 243

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++ + ++S    + DIW++GV LY +     PF+ S +   ++ R     + +P
Sbjct: 244 NYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFSFP 301

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                S+  K LI  +L   P +RP+I ++++ V
Sbjct: 302 KEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 133/274 (48%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      ++    A   ++ +  ++    L +E+   K +++  +VV
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHF-NVV 151

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L++ +  R    + E E+   M+Q    I  
Sbjct: 152 QFIDCFEDDT------NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIKY 203

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    +   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 204 MHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 252

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++ + ++S    + DIW++GV +Y +     PF+ S +  +++ R     + +P
Sbjct: 253 NYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-SKDVNMIYERIKNRDFAFP 310

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                S+  K LIH +L   P +RP+I ++++ V
Sbjct: 311 KDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/257 (27%), Positives = 118/257 (45%), Gaps = 36/257 (14%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++ L+E+   G L+  M  +    L E       +Q +  I  MH     +IHRDIK EN
Sbjct: 248 LYFLLEYAPNGDLLSLM--KKFGSLNEECCCYYGAQIIDAIKFMH--SKGIIHRDIKPEN 303

Query: 164 VLISHDGLYKVCDFGSVSGVI-RPPRNSQEFNYVQHDILTNT-----TAQYRSPEMIDLY 217
           +L+  D   K+ DFG+   +  +PP  S       +D+LT +     TA+Y SPE+++  
Sbjct: 304 ILLDKDMKVKITDFGTAKILDNKPPGTS-------YDLLTRSKSFVGTAEYVSPELLN-- 354

Query: 218 RNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFPQYSDRLKGLIH 275
            ++  D +SDIWA G  ++++     PF+ + E        + QY     +   ++ L+ 
Sbjct: 355 -DNYTDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTVVRDLVK 413

Query: 276 LMLMEVPSQRPNICQVLE---------EVSRLQNEPCPIRNFYLLRAMGQNA--QLASEP 324
            +L++ P QR  I  + +         + S + N+P P    Y + A    A  QL   P
Sbjct: 414 RILIKAPEQRLTIEAIEKHHFFRSKNFQDSSIWNDPAPEIQPYKINAKSMQAVPQLKDIP 473

Query: 325 PSVTYVSAQQLLPAQTL 341
                VS+   LP +T+
Sbjct: 474 LPKRIVSS---LPKKTI 487

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 80.9 bits (198), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/338 (24%), Positives = 139/338 (41%), Gaps = 71/338 (21%)

Query: 15  LTVGSHHAKIIKYLTSGGFAQVY--------TAEISPPDPYSNANTACLKRVIVP--DKQ 64
           L++      I K L    F+ +Y        TA  +P       N   LKR+  P  + +
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTP-----RTNLYALKRIRCPFGNIE 80

Query: 65  GLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRL 124
            ++    EVD  K  ++  +++  +DS  A+  +G +  V++L+ +   G L D  +  L
Sbjct: 81  SISGAMKEVDNYKRFQS-PYIIHLVDSQVAQQRDG-SKTVYILLPYFPLGSLQDSTSRNL 138

Query: 125 --QSRLRESEILEIMSQTVQGIAAMH-----------------------------VLQPP 153
              + + E+E + I+    +G+  +H                             +   P
Sbjct: 139 LNGTFISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTP 198

Query: 154 L----------------IHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQ 197
           L                 HRDIK  N+L S DGL  + + GS S          +   +Q
Sbjct: 199 LELDILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQ 258

Query: 198 HDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEK----SGEA-- 251
             +  + T  Y +PE++ +  N  +D K DIW+LG   Y + +  +PFE+    SG +  
Sbjct: 259 AWVSDHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLK 318

Query: 252 -AILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNI 288
            AI    + +PS  +YS+ L  LI   L   P+ RP+I
Sbjct: 319 YAIGTGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 130/280 (46%), Gaps = 49/280 (17%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVP--DKQGLNTLRAEVDAMKLLK 80
           KI+K +  G F +VY A   P            ++V++   DK   N +R      ++  
Sbjct: 38  KILKQIGEGSFGKVYLASHKPTH----------RKVVLKTSDKSDPNLVR------EVFY 81

Query: 81  NNKHVVSYIDSHAAKSVNGIAYE--VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMS 138
           + +    YI     K    I  E  V++ +E+C    L + +   +  R+   E  ++ +
Sbjct: 82  HRQFDFPYI----TKLYEVIVTETKVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFA 135

Query: 139 QTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQH 198
           Q V  +   H L    +HRD+K+EN+L+  +G  K+ DFG     +   ++S E      
Sbjct: 136 QIVSAVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDFGFTRECV--SKSSLE------ 185

Query: 199 DILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRY 258
             +  TT  Y +PE+I   R +    K DIW+LGV LY +   T PF++  E     +++
Sbjct: 186 -TICGTTV-YMAPELIQ--RQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETK---TKW 238

Query: 259 QYPS-FPQYSDRL-----KGLIHLMLMEVPSQRPNICQVL 292
           +  + FP ++D       K LI  +L + PS+RP + Q+L
Sbjct: 239 KIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 82/340 (24%), Positives = 153/340 (45%), Gaps = 35/340 (10%)

Query: 26  KYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHV 85
           ++L  GGFA+ +  +      ++    A   ++ +  ++    L +E+   K + ++ ++
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSM-SHTNI 140

Query: 86  VSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIA 145
           V +ID     +VN     V++L+E C  G L++ +  R    + E E+   M+Q   GI 
Sbjct: 141 VQFIDCFE-DNVN-----VYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGIQ 192

Query: 146 AMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTT 205
            MH  +  +IHRD+K+ N+        K+ DFG ++ V+   R        +       T
Sbjct: 193 YMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFG-LAAVLANDR--------ERKFTICGT 241

Query: 206 AQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQY 260
             Y +PE++ + ++S    + DIW++GV LY +     PF+ + +   ++ R     + Y
Sbjct: 242 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQ-AKDVNTIYERIKQRNFAY 299

Query: 261 PSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEPCPIRNFYLLRAMGQNAQL 320
           P   + S   K LI  +L   P +RP+I ++++ V      P     + L   M      
Sbjct: 300 PKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVWFRGTFP----PYTLNSVMTTVPDY 355

Query: 321 ASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVPVTHVRTTP 360
           +   P  ++++ Q  L A  L  + H   MV     RT P
Sbjct: 356 SHITPQESFMNFQNCLEASGLLSV-HQNHMVANISERTVP 394

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 86/331 (25%), Positives = 150/331 (45%), Gaps = 65/331 (19%)

Query: 6   ISL-YDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRV------ 58
           ISL YDP +   + +H+ +I+K L +G   +V  A+    D  +N   A +K V      
Sbjct: 77  ISLSYDPVSKTQILNHY-EIVKELGNGQHGKVKLAK----DIRANQLVA-IKMVNRYEKK 130

Query: 59  ---IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGG 115
                P +   N ++ E+  MK   NNKHVV  I+     S    + ++++++E+CE+G 
Sbjct: 131 TYFAGPKRNDPNKIKKEIAIMKKC-NNKHVVKLIEILDDLS----SRKIYLVLEYCEKGP 185

Query: 116 LIDF------MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHD 169
           ++        +++R   +L      EI    + G+  +H     +IHRDIK  N+L+  +
Sbjct: 186 ILWCPRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLH--SQGIIHRDIKPANLLMDKN 243

Query: 170 GLYKVCDFG-SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI-------------- 214
           G+ K+ DFG S++       N  E    +    T  T  + +PE+               
Sbjct: 244 GVVKISDFGVSLAANGNIDTNDDELELTK----TVGTPVFYAPEICLGAAAMERFNLDKD 299

Query: 215 DLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AAILHSRYQYPSFPQYSD-- 268
           +L+  S I  K DIWALG+ LY + +   PF    E      I++ + ++P+F    D  
Sbjct: 300 ELFNGSCISFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNH 359

Query: 269 -----------RLKGLIHLMLMEVPSQRPNI 288
                        K L++ +L + P++R +I
Sbjct: 360 ISEISHIREFVHAKDLLNKLLEKNPAKRISI 390

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 76/346 (21%), Positives = 140/346 (40%), Gaps = 66/346 (19%)

Query: 12  GTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRA 71
           G  +++      +   L  G    +Y  ++  P    +     LK+V  P  +     RA
Sbjct: 21  GVRISINGKSYLVTTLLREGELTALY--QVKCPKRSHSGGVYALKKVTCPIGRADFVTRA 78

Query: 72  EVDAMKLLK-NNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRL--QSRL 128
             +     + N+ ++ + +D   A+  NG    +++L+ +   G L D +N  +     L
Sbjct: 79  MTEISNYQRFNSPYITNILDFQVAQHDNGTKI-IYMLLPYFPAGSLQDLINNMIIRGDSL 137

Query: 129 RESEILEIMSQTVQGIAAMH-------------------------------------VLQ 151
            ES ++ +M    +G+  MH                                     +L 
Sbjct: 138 SESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMELDLLS 197

Query: 152 PPL--------IHRDIKIENVLISHDGLYKVCDFGSVSGVIRPP----RNSQEFNYVQHD 199
           PPL        +H  +  EN+++S +GL  + +  S    +R P     NS+    +Q  
Sbjct: 198 PPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLG-LQEW 253

Query: 200 ILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAA---ILHS 256
           +  N+   Y  PE++DL+ N+ I  + DIW+LG   Y + Y  + F +  +     I HS
Sbjct: 254 LNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPIKHS 313

Query: 257 ----RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRL 298
                + +P  P+YS  LK ++   L+  P +RP+I + L +   L
Sbjct: 314 ISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 115/236 (48%), Gaps = 26/236 (11%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN 121
           D   +  ++ E+  + LL+   ++  Y  S+       I  +++++ME+C  G + + + 
Sbjct: 42  DINEIQDIQNEIKFLSLLRYAPNITYYYHSYL------INRKIWIIMEYCNGGSVRNLIK 95

Query: 122 TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
                R  E  I  I+ + +  +  +H     +IHRDIK  N+LI+ +G  K+CDFG  +
Sbjct: 96  I---GRFNEIYISVILRELLYALEYIH--HDNIIHRDIKAANILINQNGGIKLCDFGIAA 150

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYY 241
            +        EF+  +   +   T  + +PE+I    +S  D K+DIW++G+  Y+I   
Sbjct: 151 KL--------EFSKPKRQTMAG-TPYWMAPEVI--IESSLYDTKADIWSVGITAYEITTG 199

Query: 242 TTPFEK--SGEAAILHSRYQYPSF--PQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
             P+ +  + +A  L ++ + P      YS  LK  I L L E PS+R    ++LE
Sbjct: 200 NPPYCEYDATKAMQLITKLKPPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKLLE 255

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 89/179 (49%), Gaps = 23/179 (12%)

Query: 116 LIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVC 175
           L DF+  +   ++ E E   I  Q V GI  +H L   +IHRDIK EN++I  +G  +V 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 176 DFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEK-SDIWALGVF 234
           DFGS +     P             + + T  Y SPE++   +  P + K  D+WALG+ 
Sbjct: 822 DFGSAAYATNGPFQ-----------VFHGTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 235 LYKICYYTTPFEKSGEAAILHSRYQY-PSFPQ-YSDRLKGLIHLMLMEVPSQRPNICQV 291
           LY I +  TPF    E  I+ +  +  P+  +  SD+ + LIH ML +    RP I ++
Sbjct: 868 LYIITFKQTPFNSVAE--IIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 86/180 (47%), Gaps = 22/180 (12%)

Query: 115  GLIDFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
            G ID  +   +++ + E E + I  Q   GI  +H     ++HRDIK ENV++  +G  K
Sbjct: 1045 GSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVK 1102

Query: 174  VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y   P     DIWA+
Sbjct: 1103 IVDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAI 1147

Query: 232  GVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            GV LY I Y   PF    E  IL +  +  S  + SD    LI  +L    S+RP+I ++
Sbjct: 1148 GVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/183 (31%), Positives = 85/183 (46%), Gaps = 20/183 (10%)

Query: 115  GLIDFMNT-RLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
            G +D  +    +S + E E   I  Q V GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1038 GSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1095

Query: 174  VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKS-DIWALG 232
            + DFGS + V   P           D+   T   Y +PE++     +P + KS DIWA+G
Sbjct: 1096 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GNPYEGKSQDIWAIG 1141

Query: 233  VFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVL 292
            + LY + Y   PF    E  IL    ++      S   K LI  +L     +RP I ++ 
Sbjct: 1142 ILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEIC 1199

Query: 293  EEV 295
            ++V
Sbjct: 1200 QDV 1202

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 134/291 (46%), Gaps = 31/291 (10%)

Query: 104 VFVLMEFCERGGLIDFMNT-RLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIE 162
           ++ L+E+   G   DF++  +    L +   +   +Q +  I  +H  Q  +IHRDIK E
Sbjct: 237 LYFLLEYAPNG---DFLSVIKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHRDIKPE 291

Query: 163 NVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPI 222
           N+L+  D   K+ DFG+   ++     +Q +N ++       TA+Y SPE+++   ++ +
Sbjct: 292 NILLDKDMKVKLTDFGTAK-LVEKDETTQTYNLLERSKSFVGTAEYVSPELLN---DNYV 347

Query: 223 DEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLME 280
           D K DIWA G  L+++     PF+ + E        + QY     +   ++ LI  +L++
Sbjct: 348 DYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLIKQILVK 407

Query: 281 VPSQRPNICQVLEEVSRLQNEPCPIRNFYLLRAMGQNAQLASEPPSVT--YVSAQQLLPA 338
            P QR +  QV +             +F+        +   ++PP +    ++A+ + P 
Sbjct: 408 NPEQRLDTLQVKK------------HHFFKDTNFHDGSVWDTDPPEIAPYKITAKAMQPV 455

Query: 339 QTLQGIK-HLQSMVPVTHVRTTPNLGTLTKAITNNNQTESILPVRTQPESD 388
             L+  K HL   +P    + TP   + +   T     ++  PV ++P SD
Sbjct: 456 PALKEAKPHLIINMP----KKTPRSSSSSLPTTPEPTPDNKKPVASKPASD 502

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 85/183 (46%), Gaps = 22/183 (12%)

Query: 115  GLIDFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
            G ID  +    ++ + E E   I  Q V GI  +H     ++HRDIK ENV++   GL K
Sbjct: 1243 GCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIKDENVIVDSKGLVK 1300

Query: 174  VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y   P     DIWAL
Sbjct: 1301 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAL 1345

Query: 232  GVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            G+ LY I +   PF    E  IL    ++ S  + ++    LI  +L+     RP I ++
Sbjct: 1346 GILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEI 1403

Query: 292  LEE 294
             ++
Sbjct: 1404 FDD 1406

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 94/187 (50%), Gaps = 16/187 (8%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++++ME+C  G   D +    +  L E++   I  + ++G+  +H  +   IHRDIK  N
Sbjct: 86  IWIVMEYCGGGSCADLIKYAYKRGLPENKASFITKEVLKGLRYLH--EQKKIHRDIKAAN 143

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +L++ DG+ K+ DFG VSG I+       F           T  + +PE++     S  +
Sbjct: 144 ILLTDDGMVKLGDFG-VSGQIKATLKKDTF---------VGTPYWMAPEVVK-KDESGYN 192

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSF-PQYSDRLKGLIHLMLME 280
           EK+DIW+LG+ +Y++     P  K     ++ S  + + P     YS+  K  I   L++
Sbjct: 193 EKADIWSLGITVYELLKGCPPLAKYDPMKVMISVPKRRAPKLHGHYSEDAKSFISHCLIK 252

Query: 281 VPSQRPN 287
            P+ RPN
Sbjct: 253 DPNARPN 259

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 123/261 (47%), Gaps = 36/261 (13%)

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRL 128
           +  E+  MKL+ ++ +V+  ++    KS      E+++++E+ + G L D++ ++   +L
Sbjct: 173 IEREIVIMKLI-SHPNVMGLLEVWENKS------ELYLVLEYVDGGELFDYLVSK--GKL 223

Query: 129 RESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISH-DGLYKVCDFGSVSGVIRPP 187
            E E +   +Q +QG++  H     + HRD+K EN+L+   + + K+ DFG  +  +  P
Sbjct: 224 SEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPENLLLDKKNKVIKIADFGMAA--LELP 279

Query: 188 RNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
               E         +  +  Y SPE++    Y   P    SD+W+ G+ L+ +     PF
Sbjct: 280 NKLLE--------TSCGSPHYASPEIVMGKPYHGGP----SDVWSCGIILFALLTGHLPF 327

Query: 246 EKSGEAAIL----HSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEE--VSRLQ 299
                  +L      R+Q P  P  ++  K LI  +L+  P +R  I ++L    + + +
Sbjct: 328 NDDNIKKLLLKVQAGRFQLP--PYLTNDAKDLITRILVTNPEKRLTINEILNHPLIKKYR 385

Query: 300 NEPCPIRNFYLLRAMGQNAQL 320
           N P  IR   LL     N+ L
Sbjct: 386 NPPAHIRKLNLLGRGKSNSDL 406

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 107/224 (47%), Gaps = 30/224 (13%)

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRL 128
           +R E+  +  LK   ++  Y  S+       I  +++V+ME+C  G L   +   +   +
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYL------IDTKLWVIMEYCAGGSLRTLLRPGI---I 109

Query: 129 RESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPR 188
            E  I  IM + +  + ++H  +  +IHRDIK  N+LI+++G  K+CDFG  + + +   
Sbjct: 110 EEKYIGVIMREILVALISIH--RDNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSML 167

Query: 189 NSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKICYYTTPF- 245
             Q             T  + +PE+I   +Y     D K DIW+LG+  Y+I     P+ 
Sbjct: 168 KRQTM---------AGTPYWMAPEVIMEGVY----YDTKVDIWSLGITAYEIATGNPPYC 214

Query: 246 -EKSGEAAILHSRYQYPSFP--QYSDRLKGLIHLMLMEVPSQRP 286
             ++  A  + ++ + P     +YS  LK  I L L E P +RP
Sbjct: 215 HMEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 128/274 (46%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +         ++    A   ++ +  ++    L +E+   K +KN  ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVA---KLSIKSEKTRRKLLSEIQIHKSMKN-VNIV 143

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L+D +  R    L E E+    +Q    I  
Sbjct: 144 QFIDCFEDDT------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKY 195

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    D   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 196 MHSRR--VIHRDLKLGNIFFDKDYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 244

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++ + +++    + DIW++GV LY +     PF+ S +   ++ R     + +P
Sbjct: 245 NYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQ-SKDVNTIYERIKCCDFTFP 302

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                S   K LI  +L   P +RP++ ++++ V
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 111/227 (48%), Gaps = 25/227 (11%)

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRES 131
           E +A++ L N++ +V    +   +S       ++ L+E+   G  +  M  +    L E 
Sbjct: 215 EKNALQRLNNSRGIVKLYFTFQDES------SLYFLLEYAPNGDFLSIM--KKYGSLNED 266

Query: 132 EILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQ 191
                 +Q +  I  +H     ++HRDIK EN+L+  D   K+ DFG+   ++ P  N+ 
Sbjct: 267 CACYYSAQIIDAIDFLH--SKGIVHRDIKPENILLDKDFKVKLTDFGTAK-ILEPKPNTT 323

Query: 192 EFNYVQHDILTNT-----TAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFE 246
           +     +D+L+ +     TA+Y SPE+++   ++ +D + DIWA G  L+++     PF+
Sbjct: 324 D----SYDLLSRSKSFVGTAEYVSPELLN---DNYVDYRCDIWAFGCILFQMIAGKPPFK 376

Query: 247 KSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            + E        + QY     +   ++ L+  +L++ P+QR  I Q+
Sbjct: 377 ATNEYLTFQKVMKVQYAFTAGFPLVVRDLVKGILIKQPAQRLTIPQI 423

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 86/180 (47%), Gaps = 22/180 (12%)

Query: 115  GLIDFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
            G +D  +   L++ + E E   I  Q V GI  +H     ++HRDIK ENV++  +G  K
Sbjct: 1055 GSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLH--DNGIVHRDIKDENVIVDSNGFVK 1112

Query: 174  VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y   P     DIWA+
Sbjct: 1113 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAI 1157

Query: 232  GVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            GV LY I +   PF    E  IL +  +  S  + SD    LI  +L    S+RP+I ++
Sbjct: 1158 GVLLYTIIFKENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

>Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100W
           (REAL)
          Length = 1080

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 109/226 (48%), Gaps = 23/226 (10%)

Query: 75  AMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEIL 134
           A++ L N+  VV    +   +S       ++ L+E+   G  +  M  +    L E+   
Sbjct: 234 ALQKLNNSHSVVRLFSTFQDES------SLYFLLEYAPNGDFLSLM--KKYGSLDENCAC 285

Query: 135 EIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFN 194
              SQ +  I  +HV    +IHRDIK EN+L+  +   K+ DFG+   ++ P  NS   +
Sbjct: 286 YYGSQIIDAIDHLHV--SGIIHRDIKPENILLDGEMRIKLTDFGTAK-LLEPTNNSS--S 340

Query: 195 YVQHDILTNT-----TAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSG 249
             ++D+ T +     TA+Y SPE+++   +S  D + DIWA G  L+++     PF+ + 
Sbjct: 341 KSKYDLSTRSKSFVGTAEYVSPELLN---DSFTDYRCDIWAFGCILFQMIAGKPPFKATN 397

Query: 250 EAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
           E        + QY   P +   ++ L+  +L++   QR  I Q+ E
Sbjct: 398 EYLTFQKVMKVQYAFTPGFPLIIRDLVKKILIKNLDQRLTINQIKE 443

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 113/247 (45%), Gaps = 39/247 (15%)

Query: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGI-AYEVFVLMEFCERGGLI-- 117
           P K   + ++ E+  MK   ++KHVV  I+      ++ + + ++++++E+C RG +   
Sbjct: 188 PGKTENDKIKREIAIMKKC-HHKHVVKLIEV-----LDDLKSRKIYLVLEYCSRGEVKWC 241

Query: 118 --DFMNTRLQ--SRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
             D + T  +  S L      EI+   V G+  +H     +IHRDIK  N+L+S  G+ K
Sbjct: 242 PPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLHY--QGIIHRDIKPANLLLSETGIVK 299

Query: 174 VCDFG-----SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI-------------- 214
           + DFG     S S V        E    +    T  T  + +PE+               
Sbjct: 300 ISDFGVSLAASSSNVDGSDETIDELELAK----TAGTPAFFAPEICLGEDAFEKYQLDRE 355

Query: 215 DLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYP-SFPQYSDRLKGL 273
           +L++ S I  K DIWALGV LY + +   PF  S E  +       P  FP+YSD LK  
Sbjct: 356 ELFKGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNN 415

Query: 274 IHLMLME 280
             L + E
Sbjct: 416 QVLQMTE 422

>TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa]
           {ON} Anc_3.60 YNL298W
          Length = 934

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 116/243 (47%), Gaps = 40/243 (16%)

Query: 23  KIIKYLTSGGFAQVYTAEIS--PPDPYSNANT-------------ACLKRVIVPDKQGLN 67
           K+I+    G    VY AE    PPDP SN N                +K++I+  +    
Sbjct: 638 KMIEKAGQGASGSVYLAERIRLPPDPISNNNAKYTTENSSQIGDKVAIKQMILSKQPRKE 697

Query: 68  TLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFM-----NT 122
            +  E+  M+  ++ K++V++++++          +++V+ME+ E G L D +     N 
Sbjct: 698 LIVNEILVMQDSRH-KNIVNFLEAYLK-----TEDDLWVVMEYMEGGSLTDIIENSPENV 751

Query: 123 RLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSG 182
             +S L E +I  I+ +T QG+  +H     +IHRDIK +NVL+ + G  K+ DFG  + 
Sbjct: 752 TNKSPLTEPQIAYIVRETCQGLKFLHERH--IIHRDIKSDNVLLDNQGRVKITDFGFCAK 809

Query: 183 VIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYT 242
           +    + S+    V        T  + +PE++   +    DEK D+W+LG+   ++    
Sbjct: 810 LTD--QRSKRATMV-------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLEGE 857

Query: 243 TPF 245
            P+
Sbjct: 858 PPY 860

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 95/196 (48%), Gaps = 25/196 (12%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIE 162
           +V++ +E+C    L D + ++  SRL   E  E+ +Q    +   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 163 NVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPI 222
           NVL+  +G  K+ DFG            +       + +  TT  Y +PEMI   ++ P 
Sbjct: 163 NVLLDKNGNAKLTDFGFT---------RESMTKAVLETVCGTTV-YMAPEMI---QHKPY 209

Query: 223 DE-KSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRL-----KGLIHL 276
           D  K DIW+LGV LY +     PF++  +  +L  +      P   +R+     + LI  
Sbjct: 210 DGFKVDIWSLGVILYTLLCGCLPFDEDDD--LLTKQKIINDTPVIDERITIPEAQNLIEQ 267

Query: 277 MLMEVPSQRPNICQVL 292
           +L + P++RPN   +L
Sbjct: 268 LLSKDPTERPNTSAIL 283

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 125/267 (46%), Gaps = 32/267 (11%)

Query: 31  GGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYID 90
           G +  VY A     D         +K ++  + + LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEIVYENDEELNDIMAEISLLKNL-NHHNIVKY-H 86

Query: 91  SHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVL 150
               KS     YE+++L+E+C  G L   + +R  + L E+E    ++QT+ G+  +H  
Sbjct: 87  GFIRKS-----YELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLH-- 138

Query: 151 QPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRS 210
              +IHRDIK  N+L+S D   K+ DFG VS ++    NS              T  + +
Sbjct: 139 GEGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG-------TLNWMA 186

Query: 211 PEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFP--QYSD 268
           PE++    N      SDIW+LG  + ++     P+    +A I ++      +P   +S+
Sbjct: 187 PEILG---NRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSE 243

Query: 269 RLKGLIHLMLMEVPSQRPNICQVLEEV 295
            LK  +    ++   +RP   Q+L+ V
Sbjct: 244 SLKDFLSKCFVKNMYKRPTADQLLKHV 270

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/336 (21%), Positives = 141/336 (41%), Gaps = 67/336 (19%)

Query: 25  IKYLTSGGF-------AQVYTAEISPPDPYSNANTACLKRVIVP--DKQGLNTLRAEVDA 75
           +K LTSG         + + T+ ++  D Y       +++++ P  D + ++    E+D 
Sbjct: 51  VKSLTSGSIFGGMRRQSSMSTSNLNDIDGYDEPTDMVVRQIMCPFGDIESVSNALKEIDN 110

Query: 76  MKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQS--RLRESEI 133
            +  K+  +++  +DS   +  +G +  V +L+ +   G L D ++  L    R+ ESE+
Sbjct: 111 YRYFKS-PYIMQCLDSQVIQRRDG-SKTVLILLPYLPLGSLRDAIDRNLLDGIRMSESEV 168

Query: 134 LEIMSQTVQGI--------------------------------AAMHVLQPPL------- 154
           + +M  T +G+                                AAM +   P        
Sbjct: 169 IRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGMDAVSMTLSDDAAMLLDGTPFEMDMLSS 228

Query: 155 --------IHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
                    H +IK  N+L S DGL  + + GS+  +     N +    ++     + T 
Sbjct: 229 HSMKMDSYAHMNIKPSNILFSSDGLPVITELGSLQKLDLKIENVKMLKSIKEWTEEHCTV 288

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEA-------AILHSRYQ 259
            Y  PE+++L   + +D   DIW+LG  LY + +  +PF++  +         I  +RY 
Sbjct: 289 YYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLLFGISPFKREEQVNEVPLKYGISKARYS 348

Query: 260 YPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
           +P    YS +L  +I   L   P+ RP + ++L ++
Sbjct: 349 FPEGHVYSKKLVSVIETCLQVNPTMRPTVNELLGQL 384

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 93/199 (46%), Gaps = 29/199 (14%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIE 162
           E+++++E+ E G L D++  R   +L E E +    Q VQG++  H     + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPE 193

Query: 163 NVLIS-HDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNT-TAQYRSPEMI--DLYR 218
           N+L+   +   K+ DFG  +                  + T+  +  Y SPE++    Y 
Sbjct: 194 NLLLDKKNKTVKIADFGMAA-----------LETTNRLLETSCGSPHYASPEIVMGQKYH 242

Query: 219 NSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAIL----HSRYQYPSFPQYSDRLKGLI 274
            SP    SD+W+ G+ L+ +     PF       +L    H RYQ PS    S   K LI
Sbjct: 243 GSP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAKDLI 296

Query: 275 HLMLMEVPSQRPNICQVLE 293
             +L+  P +R  + ++LE
Sbjct: 297 SKILVVDPEKRITVDKILE 315

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/290 (24%), Positives = 135/290 (46%), Gaps = 31/290 (10%)

Query: 11  PGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLR 70
           P  + T G  + + + +L  GGFA+ +  +      ++    A   ++ +  ++    L 
Sbjct: 63  PSLIKTKGRDYHRGM-FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLL 118

Query: 71  AEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           +E+   K +K+  ++V + D     +       V++L+E C  G L+D +  R Q  L E
Sbjct: 119 SEIQIHKSMKH-PNIVQFTDCFEDDT------NVYILLEICPNGSLMDLLKQRKQ--LTE 169

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            E+    +Q V  I  MH  +  +IHRD+K+ N+        K+ DFG ++ V+    N 
Sbjct: 170 PEVRFFTTQIVGAIKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---AND 223

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGE 250
           +E  Y         T  Y +PE++   +++    + DIW++GV +Y +     PF+ + E
Sbjct: 224 RERKYT-----ICGTPNYIAPEVLT-GKHTGHSFEVDIWSIGVMIYALLIGKPPFQ-AKE 276

Query: 251 AAILHSR-----YQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
              ++ R     + +P     S   K LI  +L   P +RP++ +++E V
Sbjct: 277 VNTIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 88/183 (48%), Gaps = 22/183 (12%)

Query: 115  GLIDFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
            G ID  +    +S + ESE   I  Q V GI  +H     ++HRD+K ENV++   G  K
Sbjct: 1199 GCIDLFDLIEFKSNMTESEARLIFIQVVLGIKHLH--DSNIVHRDVKDENVIVDAKGFVK 1256

Query: 174  VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWAL 231
            + DFGS + V     NS  F     D+   T   Y +PE++  + Y   P     DIWA+
Sbjct: 1257 LIDFGSAAYV-----NSGPF-----DVFVGTI-DYAAPEVLSGEPYLGKP----QDIWAI 1301

Query: 232  GVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            G+ LY I +   PF    E  IL +  +  +    S     LI  +L + P++RP I ++
Sbjct: 1302 GILLYTIMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEI 1359

Query: 292  LEE 294
            + +
Sbjct: 1360 VND 1362

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 120/256 (46%), Gaps = 35/256 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K +KH  +V++IDS+  K       +++V+ME+ E G L D +   +   L E
Sbjct: 642 INEILVMKGSKHPNIVNFIDSYVLKG------DLWVIMEYMEGGSLTDVVTHCI---LTE 692

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T+ G+  +H     ++HRDIK +N+L+S +G  K+ DFG  + +       
Sbjct: 693 GQIGAVCRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI------- 743

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 744 NELNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 798

Query: 249 GEAAILHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVLE-----EVSRLQN 300
             A  L +    P   +    S  LK  +   L   P +R +  ++L      E++   +
Sbjct: 799 LRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHDEYITEIAEANS 858

Query: 301 EPCPIRNFYLLRAMGQ 316
              P+     L+ + +
Sbjct: 859 SLAPLVKLARLKKLAE 874

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 94/190 (49%), Gaps = 10/190 (5%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++ L+E+   G  +  +  +  S  +E  +    +Q +  I  +H     ++HRDIK EN
Sbjct: 232 LYFLLEYAPNGDFLSVIK-KFGSLSQECAVY-YSAQILDAIDYLH--HKGIVHRDIKPEN 287

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +L+  D   K+ DFG+   ++     +Q FN ++       TA+Y SPE+++   ++ +D
Sbjct: 288 ILLDKDMKVKLTDFGTAR-ILEKDETTQTFNLLERSKSFVGTAEYVSPELLN---DNYVD 343

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEV 281
            K DIWA G  L+++     PF+ + E        + QY     +   ++ LI  +L++ 
Sbjct: 344 YKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRDLIKKILVKS 403

Query: 282 PSQRPNICQV 291
           P QR +  Q+
Sbjct: 404 PEQRLDASQI 413

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 125/267 (46%), Gaps = 32/267 (11%)

Query: 31  GGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYID 90
           G +  VY A     D         +K V+  + + LN + AE+  +K L +N ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEVVYENDEELNDIMAEISLLKNLNHN-NIVKY-H 86

Query: 91  SHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVL 150
               KS     YE+++L+E+C  G L   + +R  + L E+E    ++QT+ G+  +H  
Sbjct: 87  GFIRKS-----YELYILLEYCANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLH-- 138

Query: 151 QPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRS 210
              +IHRDIK  N+L+S D   K+ DFG VS ++    NS              T  + +
Sbjct: 139 GEGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG-------TLNWMA 186

Query: 211 PEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFP--QYSD 268
           PE++    N      SDIW+LG  + ++     P+    +A I ++      +P   +S+
Sbjct: 187 PEILG---NRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSE 243

Query: 269 RLKGLIHLMLMEVPSQRPNICQVLEEV 295
            LK  +    ++   +RP   Q+L+ V
Sbjct: 244 PLKDFLSKCFVKNMYKRPTADQLLKHV 270

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 108/221 (48%), Gaps = 26/221 (11%)

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRL 128
           ++ E+  +  LK   ++  Y  S+   +      +++++ME+C  G L   +      ++
Sbjct: 69  VQKEIQFLSSLKQVPNITHYYGSYLYDT------KLWIIMEYCAGGSLRTLLR---PGKI 119

Query: 129 RESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPR 188
            E  I  IM + +  +A +++ +  +IHRDIK  NVLI++DG  K+CDFG  + + +   
Sbjct: 120 DEKYIGVIMRELL--VALLYIHKDNVIHRDIKAANVLITNDGRVKLCDFGVAAQLTQ--- 174

Query: 189 NSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--E 246
                + V+   +   T  + +PE+I        D K DIW+LG+  Y+I     P+   
Sbjct: 175 -----SNVRRQTMAG-TPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEITTGNPPYCDV 226

Query: 247 KSGEAAILHSRYQYPSFP--QYSDRLKGLIHLMLMEVPSQR 285
           ++  A  L ++ + P     QYS  LK  I L L E P +R
Sbjct: 227 EALRAMQLITKSKPPRLEGRQYSPLLKEFIALCLDEDPKER 267

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 98/211 (46%), Gaps = 22/211 (10%)

Query: 96  SVNGI---------AYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
           S+NGI            ++ L+E+   G L+  +  +      E+  +   +Q +  I  
Sbjct: 317 SINGIIKLYCTFQDEANLYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHY 374

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGV----IRPPRNSQEFNYVQHDILT 202
           +H +   +IHRDIK EN+L++ D   K+ DFG+   +        ++   FN ++     
Sbjct: 375 IHSMG--IIHRDIKPENILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERSKSF 432

Query: 203 NTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQY 260
             TA+Y SPE++    +S  D + DIWA G  L+++     PF+ + E        + QY
Sbjct: 433 VGTAEYVSPELLT---DSYTDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQY 489

Query: 261 PSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
                +   L+ LI  +L++ P+ R  I Q+
Sbjct: 490 AFTAGFPTILRDLIKKILIKNPNNRLTIHQI 520

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 87/190 (45%), Gaps = 22/190 (11%)

Query: 112  ERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGL 171
            E G +  F    L++ + E E   +  Q   GI  +H     ++HRDIK ENV++ + G 
Sbjct: 1059 ETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGF 1116

Query: 172  YKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIW 229
             K+ DFGS + V   P           D+   T   Y +PE++  + Y   P     DIW
Sbjct: 1117 VKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIW 1161

Query: 230  ALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNIC 289
            A+GV LY I Y   PF    E  IL    +  S  + S     LI  +L    S+RP I 
Sbjct: 1162 AIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPTID 1219

Query: 290  QVLEEVSRLQ 299
             ++E+ S LQ
Sbjct: 1220 DIMED-SWLQ 1228

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 129/274 (47%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      ++    A   ++ +  ++    L +E+   K +K+  ++V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-PNIV 137

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L+D +  R    L E E+    +Q V  I  
Sbjct: 138 QFIDCFEDDT------NVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIKY 189

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH     +IHRD+K+ N+    +   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 190 MH--NRRVIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 238

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++   ++S    + DIW++GV +Y +     PF+ + E  I++ R     Y +P
Sbjct: 239 NYIAPEVL-AGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGDYIFP 296

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                S  +  LI  +L   P +RP++ ++++ V
Sbjct: 297 REKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 113/230 (49%), Gaps = 30/230 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K +KH  +V++IDS+  K       +++V+ME+ E G L D +   +   L E
Sbjct: 666 INEILVMKGSKHQNIVNFIDSYVLKG------DLWVVMEYMEGGSLTDVVTHCI---LTE 716

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
           ++I  +  +T++G+  +H     +IHRDIK +N+L+S +G  K+ DFG  + +       
Sbjct: 717 AQIGAVCRETLRGLQFLH--SKGVIHRDIKSDNILLSMNGEIKLTDFGFCAQI------- 767

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 768 NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 822

Query: 249 GEAAILHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
             A  L +    P   +    S  LK  +   L   P  R +  ++L +V
Sbjct: 823 LRALYLIATNGTPKLKEPEVLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 113/242 (46%), Gaps = 39/242 (16%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K +KH  +V++IDS+  K       +++V+ME+ E G L D +   +   L E
Sbjct: 698 INEIMVMKGSKHRNIVNFIDSYLLKG------DLWVVMEYMEGGSLTDVVTHCI---LTE 748

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T+ G+  +H     +IHRDIK +N+L+S  G  K+ DFG  + +       
Sbjct: 749 GQIGAVCRETLAGLQFLHSKG--VIHRDIKSDNILLSMTGEIKLTDFGFCAQI------- 799

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 800 NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 854

Query: 249 GEAAILHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQR---------PNICQVLEEVS 296
             A  L +    P   +     + L+  +   L   P QR         P + QV EE S
Sbjct: 855 LRALYLIATNGTPKLKEPDNLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVTQVAEENS 914

Query: 297 RL 298
            L
Sbjct: 915 SL 916

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 99/201 (49%), Gaps = 35/201 (17%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           V++ +E+C    L +++   ++ R+   E   + SQ V  +   H ++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 164 VLISHDGLYKVCDFG-----SVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYR 218
           +L+   G  K+ DFG     +  G++              + +  TT  Y +PE+I+  R
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGIL--------------ETVCGTTV-YMAPELIE--R 201

Query: 219 NSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQ-YPSFPQYSDRL-----KG 272
                 K D W+LG+ LY + +   PF+   E   + ++Y+   + P Y D       K 
Sbjct: 202 KPYEGYKIDTWSLGIILYTMIHGAMPFD---EEDDIKTKYRIVNNEPFYDDNFIDANGKD 258

Query: 273 LIHLMLMEVPSQRPNICQVLE 293
           LI  +L + PSQRP++ QVL+
Sbjct: 259 LIMQLLQKDPSQRPSLTQVLQ 279

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 113/244 (46%), Gaps = 35/244 (14%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++ L+E+   G  +  +  +    L E       SQ +  + ++H +   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNEICARYYASQIIDAVDSLHSIG--IIHRDIKPEN 254

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQE----FNYVQHDILTNTTAQYRSPEMIDLYRN 219
           +L+  D   K+ DFG+   +   P N+ +    F+          TA+Y SPE+++   +
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVGTAEYVSPELLN---D 311

Query: 220 SPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AAILHSRYQYPS-FPQYSDRLKGLI 274
           S  D + DIWA G  LY++     PF+ + E      ++  +Y + + FPQ    +K L+
Sbjct: 312 SYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI---VKDLV 368

Query: 275 HLMLMEVPSQRPNICQV----------LEEVSRLQNEPCPIRNFYLLRAMGQNAQLASEP 324
             +L+  P+ R  I Q+           E+ S    +P  I+++ +      +A+    P
Sbjct: 369 KKLLVRDPNDRLAIEQIKAHVFFDKINFEDGSVWDGDPPEIQSYKI------SAEAMKPP 422

Query: 325 PSVT 328
           P V+
Sbjct: 423 PKVS 426

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 113/230 (49%), Gaps = 30/230 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K +KH  +V++IDS+       +  +++V+ME+ E G L D +   +   L E
Sbjct: 670 INEILVMKGSKHPNIVNFIDSYL------LDGDLWVIMEYMEGGSLTDVVTHCI---LTE 720

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T+ G+  +H     ++HRDIK +N+L+S +G  K+ DFG  + V       
Sbjct: 721 GQIGAVCRETLSGLQFLH--SKGVLHRDIKSDNILLSINGNIKLTDFGFCAQV------- 771

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E    +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 772 NETTLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 826

Query: 249 GEAAILHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
             A  L +    P   +    SD LK  +   L   P QR +  ++LE+V
Sbjct: 827 LRALYLIATNGTPELKEREKLSDVLKHFLDWCLSVNPDQRASATELLEDV 876

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 93/201 (46%), Gaps = 33/201 (16%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIE 162
           E+++++E+ E G L D++ +R   +L E E +    Q VQG++  H     + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPE 196

Query: 163 NVLISHDGL-YKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA---QYRSPEMI--DL 216
           N+L+    L  K+ DFG  +                 D L  T+     Y SPE++    
Sbjct: 197 NLLLDKKNLSVKIADFGMAA-------------LETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 217 YRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAIL----HSRYQYPSFPQYSDRLKG 272
           Y  SP    SD+W+ G+ L+ +     PF       +L      +YQ P     S+  K 
Sbjct: 244 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ--NISNEAKD 297

Query: 273 LIHLMLMEVPSQRPNICQVLE 293
           LI  +L+  P+ R  I +VLE
Sbjct: 298 LIAKILIVDPAMRITIDEVLE 318

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 111/227 (48%), Gaps = 25/227 (11%)

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRES 131
           E + ++ LKN K ++S   +   +S       ++ L+E+   G L+  M  R    + E 
Sbjct: 203 EKNTLQRLKNTKGIISLYFTFQDES------SLYFLLEYAPNGDLLSLM--RKHGSVNEK 254

Query: 132 EILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQ 191
                 +Q +  +  MH     +IHRD+K EN+L+  D   K+ DFG+   +     +S 
Sbjct: 255 CTQYYAAQIIDALGFMH--DKGVIHRDLKPENILLDVDMKVKLTDFGTARLL-----DST 307

Query: 192 EFNYVQHDILTNT-----TAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFE 246
             + +++D+LT +     TA+Y SPE+++   ++ +D + DIWA G  L+++     PF+
Sbjct: 308 SEDDLKYDLLTRSNSFVGTAEYVSPELLN---DNYVDFRCDIWAFGCILFQMIAGKPPFK 364

Query: 247 KSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            + E        + Q+     +   ++ L+  +L++ P +R  I Q+
Sbjct: 365 ANNEYLTFQKVMKVQFAFTAGFPMTVRDLVKNILIKNPERRLLINQI 411

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 124/274 (45%), Gaps = 43/274 (15%)

Query: 31  GGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVS--- 87
           G F  VY A        S  NT  +K V          L    D + LL    + ++   
Sbjct: 43  GNFGDVYKA-----IDKSTGNTVAIKVV---------NLEETDDEIDLLAQEIYFLAELH 88

Query: 88  --YIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIA 145
             YI ++ +  V  ++  ++++ME+C  G   D +    +  L E ++  I  + ++G+ 
Sbjct: 89  SPYITNYFSTFVEDVS--MWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLE 146

Query: 146 AMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTT 205
            +H  +   IHRDIK  N+L++ DG  K+ DFG VSG +   R    F           T
Sbjct: 147 YLHSQRK--IHRDIKAANILLTDDGKVKLGDFG-VSGQMMATRRRDTF---------VGT 194

Query: 206 AQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSF-- 263
             + +PE+I        +EK+DIW+LG+ ++++     P  +     +L S    PS   
Sbjct: 195 PFWMAPEVIARSEQG-YNEKADIWSLGITVFELLKGQPPLSQHDPMKVLMS---IPSRRP 250

Query: 264 PQYSDR----LKGLIHLMLMEVPSQRPNICQVLE 293
           P+  DR    ++  + L L + P++RP   ++L+
Sbjct: 251 PKLEDRYSHAIREFVSLCLNKDPAKRPTASELLK 284

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 130/274 (47%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      ++    A L    +  ++    L +E+   K +++  ++V
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMRH-ANIV 161

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID    ++       V++L+E C  G L++ +  R    L E E+    +Q   GI  
Sbjct: 162 QFIDCFEDET------NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIKY 213

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    +   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 214 MHSRR--VIHRDLKLGNIFFDKNYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 262

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++ + ++S    + DIW++GV +Y +     PF+ + +   ++ R     + +P
Sbjct: 263 NYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQ-AKDVNTIYERIKCCDFVFP 320

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                S   + L+  +L   P +RP+I +VL+ V
Sbjct: 321 KEKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 96/197 (48%), Gaps = 19/197 (9%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++ L+E+   G  +  +  +    L E       SQ +  + ++H +   +IHRDIK EN
Sbjct: 198 LYFLLEYAPHGDFLALI--KKYGSLNEQCARYYASQIIDAVDSLHTIG--IIHRDIKPEN 253

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQE----FNYVQHDILTNTTAQYRSPEMIDLYRN 219
           +L+  D   K+ DFG+   +   P N  +    F+          TA+Y SPE+++   +
Sbjct: 254 ILLDKDMKVKLTDFGTAKILPEEPSNDADGKPCFDLNARSKSFVGTAEYVSPELLN---D 310

Query: 220 SPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AAILHSRYQYPS-FPQYSDRLKGLI 274
           S  D + DIWA G  L+++     PF+ S E      ++  +Y + + FPQ    +K L+
Sbjct: 311 SYTDSRCDIWAFGCILFQMVAGKPPFKASNEYLTFQKVMKIQYAFTAGFPQI---IKDLV 367

Query: 275 HLMLMEVPSQRPNICQV 291
             +L++ P+ R  I Q+
Sbjct: 368 KKLLVKEPNDRLTIEQI 384

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 128/274 (46%), Gaps = 28/274 (10%)

Query: 26  KYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHV 85
           ++L  GGFA+ +  +      ++    A   ++ +  ++    L +E+   K +K+ +++
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMKH-QNI 201

Query: 86  VSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIA 145
           V ++D      +N     V++L+  C  G L++ +  R    L E E+     Q    I 
Sbjct: 202 VQFVDCFE-DHIN-----VYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICGAIK 253

Query: 146 AMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTT 205
            MH  +  +IHRD+K+ N+    +   K+ DFG ++ V+    N +E  Y         T
Sbjct: 254 YMHSRR--VIHRDLKLGNIFFDENYNLKIGDFG-LAAVLA---NDRERKYT-----VCGT 302

Query: 206 AQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAIL----HSRYQYP 261
             Y +PE++ L ++S    + DIW++GV ++ +     PF+      I     +S Y +P
Sbjct: 303 PNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEYTFP 361

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                S   K LI  +L+  P  RP+I +++E V
Sbjct: 362 INKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 128/274 (46%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +    D ++    A   +  +  ++    L +E+   K + +  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAH-PNIV 142

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID     S       V++L+E C  G L++ +  R    L E E+    +Q    I  
Sbjct: 143 QFIDCFEDDS------NVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIKY 194

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    +   K+ DFG ++ V+    N  E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYT-----ICGTP 243

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++ + ++S    + DIW+LGV LY +     PF+ + +   ++ R     + +P
Sbjct: 244 NYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFSFP 301

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                SD  K LI  +L   P +RP++ ++++ V
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 112/227 (49%), Gaps = 30/227 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K +KH  +V++IDS+  K       +++V+ME+ E G L D +   +   L E
Sbjct: 372 INEILVMKGSKHSNIVNFIDSYLLKG------DLWVVMEYMEGGSLTDVVTHCI---LTE 422

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T++G+  +H     +IHRDIK +N+L+S +G  K+ DFG  + +       
Sbjct: 423 GQIGAVCRETLKGLQFLH--SKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQI------- 473

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 474 NEVNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 528

Query: 249 GEAAILHSRYQYPSF--PQ-YSDRLKGLIHLMLMEVPSQRPNICQVL 292
             A  L +    P    P+  SD LK  +   L   P  R N  ++L
Sbjct: 529 LRALYLIATNGTPKLKDPENLSDTLKEFLGWCLKVDPEDRANAAELL 575

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 82/292 (28%), Positives = 127/292 (43%), Gaps = 63/292 (21%)

Query: 17  VGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAM 76
           VG++  KI+K +  G F +VY A   P          CLK     DK   N +R      
Sbjct: 38  VGNY--KILKQVGEGSFGKVYLALHRP-----THRKVCLK---TSDKNDPNIVR------ 81

Query: 77  KLLKNNKHVVSYIDSHAAKSVNGIAYE--VFVLMEFCERGGLID-FMNTRLQSRLRESEI 133
           ++  + +    YI     K    I  E  V++ +E+C    L D  ++    S L  +E+
Sbjct: 82  EVFYHRQFDFPYI----TKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAEL 137

Query: 134 LEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEF 193
              +S  V    +MH      +HRD+K+EN+L+  +G  K+ DFG               
Sbjct: 138 FAQISGAVYYAHSMHC-----VHRDLKLENILLDKNGNAKLTDFG--------------- 177

Query: 194 NYVQHDILTNTTAQ-------YRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFE 246
                + +T TT +       Y +PE+I+  R +    K DIW+LGV LY +   + PF+
Sbjct: 178 --FTRECMTKTTLETVCGTTVYMAPELIE--RRTYDGFKIDIWSLGVILYTLITGSLPFD 233

Query: 247 KSGEA----AILHSRYQYPS--FPQYSDRLKGLIHLMLMEVPSQRPNICQVL 292
              E      I++    Y S   P   D  K LI  +L + P +RP++ QVL
Sbjct: 234 DDDEVKTKWKIVNEEPNYDSTLIP---DDAKDLISRLLAKNPKERPSLPQVL 282

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 129/283 (45%), Gaps = 55/283 (19%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVP--DKQGLNTLRA-----EVDA 75
           KI+K +  G F +VY A   P            ++V++   DK   N +R      + D 
Sbjct: 38  KIMKQIGEGSFGKVYLASHKPTH----------RKVVLKTSDKNDPNVVREVFYHRQFDY 87

Query: 76  MKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILE 135
           + + +  + +V+               +V++ +E+C    L + +      R+   E   
Sbjct: 88  LYITRLYEVIVTET-------------KVWMALEYCPGKELYEHL--LALKRISLDECSR 132

Query: 136 IMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNY 195
           + +Q V  I   H L    +HRD+K+EN+L+   G  K+ DFG     +         + 
Sbjct: 133 LFAQIVGAIYYAHSLN--CVHRDLKLENILLDKKGNAKLTDFGFTRECV---------SK 181

Query: 196 VQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILH 255
            Q D +  TT  Y +PE+ +  R S    K DIWALGV LY +   + PF++  EA    
Sbjct: 182 SQLDTICGTTV-YMAPELTE--RKSYDGFKIDIWALGVILYTMINGSMPFDEDDEAK--- 235

Query: 256 SRYQYPS-FPQYSDRL-----KGLIHLMLMEVPSQRPNICQVL 292
           ++++  +  P+ ++ L     K LI  +L + P++RP+I ++L
Sbjct: 236 TKWKIVNEMPEINEDLVSPDAKDLIEQLLAKDPNERPSIEKIL 278

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 132/282 (46%), Gaps = 35/282 (12%)

Query: 19  SHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKL 78
           +H+  + + +  G F  VY A     D  +N   A     +    + L  L  E+  +  
Sbjct: 19  AHNYIVKECVGRGNFGDVYRA----IDRTTNKVVAIKVVDLENTNERLEVLAQEIFFLAE 74

Query: 79  LKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMS 138
           LK+  ++++YI +    +       ++++ME+C  G   D +     + L E ++  I  
Sbjct: 75  LKS-PYIINYITTLLEDA------SMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITR 127

Query: 139 QTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQH 198
           + ++G+  +H  +   IHRDIK  N+L++ +G  K+ DFG VSG ++        + ++ 
Sbjct: 128 EILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFG-VSGQLK--------STLRR 176

Query: 199 DILTNTTAQYRSPEM----IDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAIL 254
             +   T  + +PE+    I+ Y     DEK DIW+LG+ ++++     P  K     +L
Sbjct: 177 GTIVG-TPYWMAPEVASQNIEGY-----DEKIDIWSLGITVFELLKGVPPLVKLDPIRVL 230

Query: 255 H--SRYQYPSFP-QYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
              SR   P     YSD  K  + L L++ P++RP    +L+
Sbjct: 231 ANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 110/224 (49%), Gaps = 30/224 (13%)

Query: 78  LLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILE 135
           +++ +KH  +V++IDS+ AK       +++++ME+ E G L D +   L   L E +I  
Sbjct: 668 VMRESKHSNIVNFIDSYLAKG------DLWIVMEYMEGGSLTDVVTHCL---LSEGQIGA 718

Query: 136 IMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNY 195
           +  +T++G+  +H     ++HRDIK +N+L+S  G  K+ DFG  + +        E N 
Sbjct: 719 VCRETLKGLQFLH--SKGVLHRDIKSDNILLSLKGNIKLTDFGFCAQI-------NENNL 769

Query: 196 VQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKSGEAAI 253
            +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E    A  
Sbjct: 770 KRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALY 824

Query: 254 LHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVLEE 294
           L +    P   +    SD L   +   L   PS+R    ++L++
Sbjct: 825 LIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERATATELLDD 868

>KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {ON}
           similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007C STE20 Signal transducing kinase of the PAK (p21-
           activated kinase) family involved in pheromone response
           and pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 954

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 111/229 (48%), Gaps = 30/229 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K +KH  +V++IDS+  +       +++V+ME+ E G L D +   +   L E
Sbjct: 709 INEILVMKASKHANIVNFIDSYLLRG------DLWVVMEYMEGGSLTDVVTHCI---LTE 759

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T++G+  +H     +IHRDIK +N+L+S  G  K+ DFG  + +       
Sbjct: 760 GQIGAVSRETLKGLQFLH--SKGVIHRDIKSDNILLSMTGEIKLTDFGFCAQI------- 810

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 811 NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 865

Query: 249 GEAAILHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVLEE 294
             A  L +    P        SD LKG +   L   P +R    ++L +
Sbjct: 866 LRALYLIATNGTPELKDADSLSDDLKGFLGWCLHVDPDERATASELLSD 914

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 96/193 (49%), Gaps = 16/193 (8%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++++ME+C  G   D +     + + E ++  I SQ ++G+  +H  +   IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVLRGLVYLH--EQKKIHRDIKAAN 143

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +L++ +G  K+ DFG VSG IR       F           T  + +PE++    N   D
Sbjct: 144 ILLTDEGTVKLGDFG-VSGQIRATLKRGTF---------VGTPYWMAPEVVS-KENDGYD 192

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSF-PQYSDRLKGLIHLMLME 280
           EK+DIW+LG+ +Y++     P  K     ++ +  + + P+    YS   K  +   L++
Sbjct: 193 EKADIWSLGITVYELLKGAPPLSKCDPMKVMINLPKRKPPALHGHYSHSAKNFVSSCLVK 252

Query: 281 VPSQRPNICQVLE 293
            P  R +  +++E
Sbjct: 253 NPVGRASAYEMVE 265

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 106/218 (48%), Gaps = 32/218 (14%)

Query: 28   LTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVS 87
            +T+G    V   E+     YS+ N A L  V          LR+EV  +K L ++ ++V 
Sbjct: 1201 VTTGEMMAVKQVEVPK---YSSQNEAILSTV--------EALRSEVSTLKDL-DHLNIVQ 1248

Query: 88   YIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAM 147
            Y+      S+    Y +F  +E+   G +   +  R+  R  ES I  + +Q ++G+A +
Sbjct: 1249 YLGFENKNSI----YSLF--LEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLRGLAYL 1300

Query: 148  HVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQ 207
            H     ++HRD+K +N+L+  DG+ K+ DFG +S      R S++  Y   D+    T  
Sbjct: 1301 H--SKGILHRDMKADNLLLDQDGICKISDFG-IS------RKSKDI-YSNSDMTMRGTVF 1350

Query: 208  YRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
            + +PEM+D  +      K DIW+LG  + ++     P+
Sbjct: 1351 WMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPW 1386

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 96/199 (48%), Gaps = 31/199 (15%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIE 162
           E+++++E+ + G L D++ ++   +L ESE +    Q + GI+  H     + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 163 NVLISHD-GLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA--QYRSPEMI--DLY 217
           N+L+     + K+ DFG  +              V + +L  +     Y SPE++    Y
Sbjct: 265 NLLLDKKRRIIKIADFGMAAL------------QVSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 218 RNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAIL----HSRYQYPSFPQYSDRLKGL 273
             +P    SDIW+ G+ L+ +     PF       +L    + RYQ PS+   S   K L
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNL 366

Query: 274 IHLMLMEVPSQRPNICQVL 292
           I  +L+  PS+R +  Q+L
Sbjct: 367 ISRILVVDPSKRISTEQIL 385

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 118/230 (51%), Gaps = 40/230 (17%)

Query: 21  HAKIIKYLTSGGFAQVYTA-EISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLL 79
           +A ++K +  GG A VYTA E+         N +   + I  +KQ    L   ++ + ++
Sbjct: 613 YANLVK-IGRGGSALVYTAYEVG-------TNLSVAIKQINLEKQPRKQLI--LNEIIVM 662

Query: 80  KNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIM 137
           K ++H  +V++IDS+    V+G   +++V+ME+ E G L D +   +   LRE +I  + 
Sbjct: 663 KKSQHPNIVNFIDSYL---VDG---KLWVIMEYMEAGSLTDVVTRCI---LREGQIGAVC 713

Query: 138 SQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGV--IRPPRNSQEFNY 195
            + ++G+  +H     +IHRDIK +NVL+S DG  K+ DFG  + +  I   RN+     
Sbjct: 714 REVLKGLVFLH--SKGVIHRDIKSDNVLLSMDGDIKLTDFGFCAQLNDIHLKRNTMV--- 768

Query: 196 VQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
                    T  + +PE+++     P   K DIW+LGV + ++     P+
Sbjct: 769 --------GTPYWMAPEIVEKKHYCP---KVDIWSLGVMIIEMIEGEPPY 807

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 120/256 (46%), Gaps = 35/256 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K ++H  +V++IDS+  K       +++V+ME+ E G L D +   +   L E
Sbjct: 665 INEILVMKGSRHPNIVNFIDSYVLKG------DLWVIMEYMEGGSLTDVVTHCI---LTE 715

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T+ G+  +H     ++HRDIK +N+L+S +G  K+ DFG  + +       
Sbjct: 716 GQIGAVCRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI------- 766

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 767 NELNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 821

Query: 249 GEAAILHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVLE-----EVSRLQN 300
             A  L +    P   +    S  LK  +   L   P +R +  ++L      E++   +
Sbjct: 822 LRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEERASATELLHDEYITEIAEANS 881

Query: 301 EPCPIRNFYLLRAMGQ 316
              P+     L+ + +
Sbjct: 882 SLAPLVKLARLKKLAE 897

>KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa]
           {ON} Anc_3.60 YNL298W
          Length = 829

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 115/243 (47%), Gaps = 39/243 (16%)

Query: 23  KIIKYLTSGGFAQVYTAE--ISPPDPYSNANTACLKR---VIVPDKQGLNTL------RA 71
           K+I+    G    VY AE   SPP  Y N +   ++      + DK  +  +      R 
Sbjct: 532 KMIEKAGQGASGSVYLAERLESPPSEYQNDHVVSIENNEPQAIGDKVAIKQMILSKQPRK 591

Query: 72  E--VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFM-----NT 122
           E  V+ + ++KN++H  +V++++++          +++V+MEF E G L D +     N 
Sbjct: 592 ELIVNEILVMKNSRHKNIVNFLEAYLK-----TEDDLWVVMEFMEGGSLTDIIENSPTNG 646

Query: 123 RLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSG 182
              S L E +I  I+ +T QG+  +H     +IHRDIK +NVL+      K+ DFG  + 
Sbjct: 647 SNHSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTRARVKITDFGFCAK 704

Query: 183 VIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYT 242
           +    + S+    V        T  + +PE++   +    DEK D+W+LG+   ++    
Sbjct: 705 LTD--KRSKRATMV-------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLEGE 752

Query: 243 TPF 245
            P+
Sbjct: 753 PPY 755

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 111/229 (48%), Gaps = 30/229 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K++KH  +V++IDS   K       +++V+MEF E G L D +   +   L E
Sbjct: 594 INEIIVMKDSKHPNIVNFIDSFLLKG------DLWVIMEFMEGGSLTDVVTHCI---LTE 644

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T++G+  +H     +IHRDIK +N+L+S  G  K+ DFG  + +       
Sbjct: 645 GQIGTVCRETLRGLQFLHSNG--VIHRDIKSDNILLSMKGDIKLTDFGFCAQI------- 695

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 696 NEHNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIESEPPYLNETP 750

Query: 249 GEAAILHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVLEE 294
             A  L +    P   +    SD L   +   L   P +R +   +LE+
Sbjct: 751 LRALYLIATNGTPKLKEPELLSDVLNDFLSWCLKVNPDERASASTLLED 799

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 112/241 (46%), Gaps = 25/241 (10%)

Query: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTR 123
           + +N L  E+  +  LK+      YI ++       ++  ++++ME+C  G   D +   
Sbjct: 55  EDINLLAQEIFFLAELKS-----PYITNYITTMTEDVS--MWIIMEYCGGGSCADLLRNI 107

Query: 124 LQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGV 183
               L ES+   I  + ++G+  +H  +   IHRDIK  N+L++ +G  K+ DFG VSG 
Sbjct: 108 YNCGLPESKSAYITREVLKGLEYLH--EQKKIHRDIKAANILLTDEGKVKLGDFG-VSGQ 164

Query: 184 IRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTT 243
           IR       F           T  + +PE++    +   DEK+DIW+LG+ +Y++   + 
Sbjct: 165 IRATLKRGTF---------VGTPFWMAPEVVSKDSDG-YDEKADIWSLGITVYELLKGSP 214

Query: 244 PFEKSGEAAI---LHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVL--EEVSRL 298
           P  K     +   L  R        YS   K  +   L++ P  RP+  ++L  E V+ L
Sbjct: 215 PLYKCDPMKVMVNLPKRKPPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNL 274

Query: 299 Q 299
           Q
Sbjct: 275 Q 275

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 71/265 (26%), Positives = 123/265 (46%), Gaps = 32/265 (12%)

Query: 31  GGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYID 90
           G +  VY A     D         +K ++    + LN + AE+  +K L N+ ++V Y  
Sbjct: 34  GSYGVVYKAINKHTD-----QVVAIKEIVYESDEELNDIMAEISLLKNL-NHDNIVKY-H 86

Query: 91  SHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVL 150
               KS     YE+++L+E+C  G L   + +R  + L E+E    ++QT+ G+  +H  
Sbjct: 87  GFIRKS-----YELYILLEYCANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLH-- 138

Query: 151 QPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRS 210
              +IHRDIK  N+L+S D   K+ DFG VS ++    NS              T  + +
Sbjct: 139 GEGVIHRDIKAANILLSADNTVKLADFG-VSTIV----NSSALTLAG-------TLNWMA 186

Query: 211 PEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFP--QYSD 268
           PE++    N      SDIW+LG  + ++     P+    +A I ++      +P   +S+
Sbjct: 187 PEILG---NRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSE 243

Query: 269 RLKGLIHLMLMEVPSQRPNICQVLE 293
            LK  +    ++   +RP   Q+L+
Sbjct: 244 SLKDFLSKCFVKNMYKRPTADQLLK 268

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 97/194 (50%), Gaps = 20/194 (10%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++++MEFC  G   D +    + RL E+++  I+ + + G+  +H  +   IHRDIK  N
Sbjct: 110 MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAAN 167

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +L++ DG  K+ DFG VSG I        F           T  + +PE+I   +++  +
Sbjct: 168 ILLTDDGEVKLGDFG-VSGQIMATLKRTTF---------VGTPYWMAPEII-AKKDNGYN 216

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAIL-HSRYQYPSFPQYSDRLKG----LIHLML 278
           EK+DIW+LG+   ++     P+ K     +L +   + P  P+   R  G     I L L
Sbjct: 217 EKADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRKP--PKLQGRFTGSARDFIALCL 274

Query: 279 MEVPSQRPNICQVL 292
           ++ P  RP+  ++L
Sbjct: 275 IKDPDLRPSAAELL 288

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 110/229 (48%), Gaps = 30/229 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K +KH  +V++IDS+  K       +++V+ME+ E G L D +   +   L E
Sbjct: 663 INEILVMKGSKHPNIVNFIDSYVLKG------DLWVIMEYMEGGSLTDVVTHCI---LTE 713

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T+ G+  +H     ++HRDIK +N+L+S +G  K+ DFG  + +       
Sbjct: 714 GQIGAVCRETLSGLEFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI------- 764

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 765 NELNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 819

Query: 249 GEAAILHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVLEE 294
             A  L +    P   +    S  LK  +   L   P  R +  ++L +
Sbjct: 820 LRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHD 868

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 110/229 (48%), Gaps = 30/229 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K +KH  +V++IDS+  +       +++V+ME+ E G L D +   +   L E
Sbjct: 710 INEILVMKASKHANIVNFIDSYLLRG------DLWVVMEYMEGGSLTDVVTHCI---LTE 760

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T++G+  +H     +IHRDIK +NVL+S  G  K+ DFG  + +       
Sbjct: 761 GQIGAVSRETLKGLQFLH--SKGVIHRDIKSDNVLLSMSGEIKLTDFGFCAQI------- 811

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 812 NEINLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 866

Query: 249 GEAAILHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVLEE 294
             A  L +    P        SD LK  +   L   P +R    Q+L +
Sbjct: 867 LRALYLIATNGTPELKDADSLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 63/247 (25%), Positives = 113/247 (45%), Gaps = 26/247 (10%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN 121
           D+  +  ++ E+  +  LK   ++  Y  S+   +       ++++ME+C  G L   + 
Sbjct: 71  DEDEVEDVQKEIQFLASLKQLPNITRYYGSYLKNT------SLWIIMEYCGGGSLRSLLR 124

Query: 122 TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
                ++ E  I  IM + +  IA  ++ +  +IHRDIK  NVLI++DG  K+CDFG  +
Sbjct: 125 ---PGKIDEKYIGVIMREIL--IALKYIHKDNVIHRDIKAANVLINNDGSIKLCDFGVAA 179

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYY 241
            + +     Q             T  + +PE+I        D K+DIW+ G+  Y++   
Sbjct: 180 QLNQTKSRRQTM---------AGTPYWMAPEVI--MEGVYYDTKADIWSTGITAYEVTTG 228

Query: 242 TTPF--EKSGEAAILHSRYQYPSFP--QYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSR 297
             P+   ++  A  L ++ + P      YS  +K  I   L E PS+RP   ++L+    
Sbjct: 229 NPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLKTAFI 288

Query: 298 LQNEPCP 304
              +P P
Sbjct: 289 KTYKPLP 295

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 130/281 (46%), Gaps = 39/281 (13%)

Query: 19  SHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKL 78
           S +  +IK +  G    VYTA     DP      A  +  +  +KQ    L   ++ + +
Sbjct: 648 SKYTDLIK-IGQGASGGVYTAH----DPTREGYVAIKQMNL--EKQPKKELI--INEIIV 698

Query: 79  LKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEI 136
           +K +KH  +V++IDS+  K       +++V+ME+ E G L D +   L   L E+++  +
Sbjct: 699 MKESKHENIVNFIDSYLLKG------DLWVIMEYMEGGSLTDVVTHCL---LTEAQVGAV 749

Query: 137 MSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYV 196
             +T+ G+  +H     +IHRDIK +N+L+S  G  K+ DFG  + +        E N  
Sbjct: 750 CRETLSGLQFLH--SKGVIHRDIKSDNILLSMRGDIKLTDFGFCAQI-------NELNLK 800

Query: 197 QHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKSGEAAIL 254
           +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E    A  L
Sbjct: 801 RTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYL 855

Query: 255 HSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVL 292
            +    PS  +    SD L   +   L   P +R +   +L
Sbjct: 856 IATNGTPSLKEPEALSDALNNFLGWCLKVNPDERASAKDLL 896

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 142/328 (43%), Gaps = 68/328 (20%)

Query: 13  TVLTVGSHHAKIIKYLTSGGFAQVYTAE-ISPPDPY---------SNANTACLKRVIVP- 61
           T + VGS    + K +  G FA V+ A  I+P  P+         S  N  C    IVP 
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPR 88

Query: 62  ----DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLI 117
               +K+ L  L  E+  +K + ++ H+V  ID          + + +++ME+C  G L 
Sbjct: 89  SKLKNKKLLENLEIEIAILKKI-SHPHIVKLID------FERTSKDFYLIMEYCSLGDLT 141

Query: 118 DFMNTRLQSRLRESEILE--------------------IMSQTVQGIAAMHVLQPP-LIH 156
            F+  + Q  ++   +LE                    I++   Q  +A+  L+   L+H
Sbjct: 142 -FLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVH 200

Query: 157 RDIKIENVLIS-----HDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQ---- 207
           RDIK +N+L+S     ++      D G V     P     +F + +   L NT+      
Sbjct: 201 RDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPNTSMAETLC 258

Query: 208 ----YRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAIL------HSR 257
               Y +PE+++  +    + K+D+W++G  LY++CY   PF+ S    +       +  
Sbjct: 259 GSPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKANDL 315

Query: 258 YQYPSFPQYSDRLKGLIHLMLMEVPSQR 285
             +P++ +  + LK LI  +L   P +R
Sbjct: 316 IYFPTYIEIDNNLKSLISKLLTFDPQER 343

>Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON}
           YHL007C (REAL)
          Length = 980

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 119/256 (46%), Gaps = 35/256 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K +KH  +V++IDS+  K       +++V+ME+ E G L D +   +   L E
Sbjct: 704 INEILVMKGSKHPNIVNFIDSYVLKG------DLWVIMEYMEGGSLTDVVTHCI---LTE 754

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T+ G+  +H     ++HRDIK +N+L+S +G  K+ DFG  + +       
Sbjct: 755 GQIGAVCRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI------- 805

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 806 NELNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 860

Query: 249 GEAAILHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVLE-----EVSRLQN 300
             A  L +    P   +    S  LK  +   L   P +R +   +L      E++   +
Sbjct: 861 LRALYLIATNGTPKLKEPENLSSYLKKFLDWCLCVEPEERASATDLLHDEYITEIAEANS 920

Query: 301 EPCPIRNFYLLRAMGQ 316
              P+     L+ + +
Sbjct: 921 TLAPLVKLARLKKLAE 936

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 98/209 (46%), Gaps = 49/209 (23%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQS--RLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIK 160
           +V++ +E+C    L D    R+ S  R+   E +++ +Q V G+   H L    +HRD+K
Sbjct: 103 KVWMALEYCPGKELYD----RVLSMHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLK 156

Query: 161 IENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQ-------YRSPEM 213
           +EN+L+   G  K+ DFG                    + +T TT +       Y +PE+
Sbjct: 157 LENILLDKSGDAKLTDFG-----------------FTRECMTKTTLETICGTTVYMAPEL 199

Query: 214 IDLYRNSPIDEKSDIWALGVFLYKICYYTTPF----EKSGEAAILHSRYQYPSFPQYSDR 269
           I+  R S    K DIW+LGV LY +   + PF    E   E  I+H        PQ ++ 
Sbjct: 200 IE--RKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQT------PQLNEN 251

Query: 270 L-----KGLIHLMLMEVPSQRPNICQVLE 293
           +     K LI  +L + P+ RP + Q+L+
Sbjct: 252 IVTADAKDLILRLLAKNPNDRPTVEQILK 280

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 134/294 (45%), Gaps = 38/294 (12%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      ++    A   ++ +  ++    L +E+   K +++  ++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRH-PNIV 133

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            + D     +       V++L+E C  G L+D +  R Q  L E E+    +Q V  I  
Sbjct: 134 QFTDCFEDDT------NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIKY 185

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+        K+ DFG ++ V+    N +E  Y         T 
Sbjct: 186 MHSRR--IIHRDLKLGNIFFDKHFNLKIGDFG-LAAVL---ANDRERKYT-----ICGTP 234

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++   +++    + D+W++GV +Y +     PF+ + E   ++ R     + +P
Sbjct: 235 NYIAPEVLT-GKHTGHSFEVDVWSIGVMIYALLIGKPPFQ-AKEVNTIYERIKVCDFNFP 292

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEPCPIRNFYLLRAMG 315
                S   K LI  +L   P +RP++ +++E V          RN + +R  G
Sbjct: 293 RDKPISSEAKVLIKDILSLDPLERPSLTEIMEYVW--------FRNVFPMRING 338

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 108/235 (45%), Gaps = 30/235 (12%)

Query: 66   LNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERG--GLIDFMN-T 122
            L T+ +E+  M +L  NKH     D +  + ++    + +  +E    G  G ID  +  
Sbjct: 1024 LGTIPSEIQIMAVL--NKHP----DENILRLLDFFEDDDYYYIETPVHGETGSIDLFDLI 1077

Query: 123  RLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSG 182
             L++ + E E   I  Q + GI  +H  +  ++HRDIK ENV++   G  K+ DFGS + 
Sbjct: 1078 ELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVKLIDFGSAAY 1135

Query: 183  VIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKICY 240
            V   P           D+   T   Y +PE++  + Y   P     DIWA+G+ LY I +
Sbjct: 1136 VKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAVGILLYTIVF 1180

Query: 241  YTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
               PF    E  I+    ++    + S+    LI  +L +   +RP I  + ++V
Sbjct: 1181 KENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDIYDDV 1233

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 129/274 (47%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +    + ++    A   +  +  ++    L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID     S       V++L+E C  G L++ +  R    L E E+    +Q    I  
Sbjct: 143 QFIDCFEDDS------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIKY 194

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    +   K+ DFG ++ V+    N  E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYT-----ICGTP 243

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++ + ++S    + DIW+LGV LY +     PF+ + +   ++ R     + +P
Sbjct: 244 NYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFSFP 301

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                SD  K LI  +L   P +RP++ ++++ V
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 110/227 (48%), Gaps = 21/227 (9%)

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRES 131
           E +A++ L N++ +V    +   ++       ++ L+E+   G  +  +  +    + E 
Sbjct: 259 EKNALQKLNNSRGIVRLFFTFQDEA------SLYFLLEYAPNGDFLSLI--KKFGSMNED 310

Query: 132 EILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQ 191
                 +Q +  I  +H     +IHRDIK EN+L+  +   K+ DFG+ + ++ P  +S 
Sbjct: 311 CASYYSAQIIDAIHFVHSRG--IIHRDIKPENILLDSEMKVKLTDFGT-AKILEPKSSSS 367

Query: 192 EFNYVQHDILTNT-----TAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFE 246
              +  +D+LT +     TA+Y SPE+++   +S  D + DIWA G  ++++     PF+
Sbjct: 368 SSKHETYDLLTRSKSFVGTAEYVSPELLN---DSYADSRCDIWAFGCIVFQMIAGKPPFK 424

Query: 247 KSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            + E        + QY     +   ++ L+  +L++ P QR  I Q+
Sbjct: 425 ATNEYLTFQKVMKVQYAFTAGFPLVIRDLVKRILIKAPEQRLTISQI 471

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 126/274 (45%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +         ++    A   ++ +  ++    L +E+   K +K+  ++V
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMKH-VNIV 155

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L+D +  R    L E E+    +Q    I  
Sbjct: 156 QFIDCFEDDT------NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKY 207

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+        K+ DFG  + +     N +E  Y         T 
Sbjct: 208 MHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATL----ANDRERKYT-----VCGTP 256

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQY 266
            Y +PE++ + ++S    + DIW++GV +Y +     PF+ S +   ++ R +   F   
Sbjct: 257 NYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQ-SKDVNTIYERIKCRDFSFP 314

Query: 267 SDRL-----KGLIHLMLMEVPSQRPNICQVLEEV 295
            D+L     K LI  +L   P +RP++ ++++ +
Sbjct: 315 KDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 99/233 (42%), Gaps = 28/233 (12%)

Query: 66   LNTLRAEVDAMKLLKNN--KHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTR 123
            L T+ +E+  M  L  N  K+++  +D         I   V       E G +  F    
Sbjct: 888  LGTIPSEIQIMATLNKNSQKNILKLLDFFEDDDYYYIETPVH-----GETGSIDLFDVIE 942

Query: 124  LQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGV 183
             +  + E E   +  Q V  I  +H     ++HRDIK ENV++   G  K+ DFGS + V
Sbjct: 943  FKKDMVEHEAKLVFKQVVASIKHLH--NQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYV 1000

Query: 184  IRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKICYY 241
               P           D+    T  Y +PE++    Y+  P     DIWALGV LY I Y 
Sbjct: 1001 KSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIWALGVLLYTIIYK 1045

Query: 242  TTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEE 294
              P+    E  IL    ++    + S+   GLI  +L     +RP I ++ E+
Sbjct: 1046 ENPYYNIDE--ILEGELRFDKAEKVSEGCIGLIKRILTREVDKRPTIDEIYED 1096

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 134/303 (44%), Gaps = 40/303 (13%)

Query: 28   LTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVS 87
            +T+G    V   E+     YS+ N A L  V          LR+EV  +K L ++ ++V 
Sbjct: 1195 VTTGEMMAVKQVEVPK---YSSQNEAILSTV--------EALRSEVSTLKDL-DHLNIVQ 1242

Query: 88   YIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAM 147
            Y+      ++    Y +F  +E+   G +   +  R+  R  E  I  + +Q ++G+A +
Sbjct: 1243 YLGFENKDNI----YSLF--LEYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYL 1294

Query: 148  HVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQ 207
            H     ++HRD+K +N+L+  DG+ K+ DFG +S      R S++  Y   D+    T  
Sbjct: 1295 H--SKGILHRDMKADNLLLDQDGICKISDFG-IS------RKSKDI-YSNSDMTMRGTVF 1344

Query: 208  YRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAIL----HSRYQYP-- 261
            + +PEM+D  +      K DIW+LG  + ++     P+      A +     S+   P  
Sbjct: 1345 WMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIP 1402

Query: 262  --SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEPCPIRNFYLLRAMGQNAQ 319
              + P  S   +G +       P +RP   ++L     + N     ++  L + +  N +
Sbjct: 1403 EDTLPLISQVGRGFLDACFEINPEKRPTATELLSHRFSVVNVTFDFKSTELAKFIKSNDK 1462

Query: 320  LAS 322
            L S
Sbjct: 1463 LNS 1465

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 129/274 (47%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      ++    A   ++ +  ++    L +E+   K +K+  ++V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVA---KLSIKSEKTRRKLLSEIQIHKSMKH-PNIV 150

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            + D     +       V++L+E C  G +++ +  R    L E E+   M Q +  I  
Sbjct: 151 QFTDCFEDDT------NVYILLEICPNGSVMELLRQR--KHLTEPEVRFCMIQIIGAIRY 202

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    +   K+ DFG ++ V+    N +E  Y         T 
Sbjct: 203 MHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG-LAAVLA---NDKERKYT-----ICGTP 251

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++   +++    + DIW++GV LY + +   PF+ + E   ++ R     + +P
Sbjct: 252 NYIAPEVLT-GKHTGHSYEVDIWSIGVMLYALLFGKPPFQ-AKEVETIYERIKCRDFIFP 309

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
           +    S   K LI  +L   P+ RP++ ++ + V
Sbjct: 310 ADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 95/196 (48%), Gaps = 25/196 (12%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++++MEFC  G   D +    + RL E+++  I+ + + G+  +H  +   IHRD+K  N
Sbjct: 107 MWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAAN 164

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +L++ +G  K+ DFG VSG I        F           T  + +PE+I   R++  D
Sbjct: 165 ILLTDEGEVKLGDFG-VSGQIMATLKRNTF---------VGTPYWMAPEIIA--RDNGYD 212

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHS-------RYQYPSFPQYSDRLKGLIHL 276
           EK+DIW+LG+   ++     P+ K     +L +       R Q     +++   +  I L
Sbjct: 213 EKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQ----GRFTSSARDFIAL 268

Query: 277 MLMEVPSQRPNICQVL 292
            L + P+ RP    +L
Sbjct: 269 CLTKDPALRPTASDLL 284

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 115/235 (48%), Gaps = 33/235 (14%)

Query: 12   GTVLTVGSHHAKIIKY-LTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLR 70
            G ++  GS  A  +   +T+G    V   E+     YS+ N A L  V          LR
Sbjct: 1181 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPK---YSSQNEAILGTV--------EALR 1229

Query: 71   AEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
            +EV  +K L ++ ++V Y+     ++ N I Y +F  +E+   G +   +  R+  R  E
Sbjct: 1230 SEVSTLKDL-DHLNIVQYL---GFENKNNI-YSLF--LEYVAGGSVGSLI--RMYGRFDE 1280

Query: 131  SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            S I  + +Q ++G+A +H     ++HRD+K +N+L+  DG+ K+ DFG +S      R S
Sbjct: 1281 SLIRHLTTQVLKGLAYLH--SKGILHRDMKADNLLLDQDGICKISDFG-IS------RKS 1331

Query: 191  QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
            ++  Y   D+    T  + +PEM+D  +      K DIW+LG  + ++     P+
Sbjct: 1332 KDI-YSNSDMTMRGTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPW 1383

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 120/286 (41%), Gaps = 61/286 (21%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNN 82
           KI+K +  G F +VY A   P          CLK     DK   N +R      ++  + 
Sbjct: 42  KILKQIGEGSFGKVYLALHRP-----THRKVCLK---TSDKNDPNIVR------EVFYHR 87

Query: 83  KHVVSYIDSHAAKSVNGIAYE--VFVLMEFCERGGLIDFMNTRLQSRLRE-SEILEIMSQ 139
           +    YI     K    I  E  V++ +E+C    L D + +  +  L E  E+   +S 
Sbjct: 88  QFDFPYI----TKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGELFAQISG 143

Query: 140 TVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHD 199
            V    +MH      +HRD+K+EN+L+  +G  K+ DFG                    +
Sbjct: 144 AVYYAHSMHC-----VHRDLKLENILLDKNGNAKLTDFG-----------------FTRE 181

Query: 200 ILTNTTAQ-------YRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAA 252
            +T TT +       Y +PE+I+  R +    K DIW+LGV LY +     PF+   EA 
Sbjct: 182 CMTKTTLETVCGTTVYMAPELIE--RRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAK 239

Query: 253 ILHS------RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVL 292
                     +Y     P   D  + LI  +L + P +RP++ QVL
Sbjct: 240 TKWKIVNEEPKYDAKVIP---DDARDLISRLLAKNPGERPSLSQVL 282

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 89/191 (46%), Gaps = 22/191 (11%)

Query: 105  FVLMEFCERGGLIDFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
            ++ +E     G ID  +   L++ + E E   I  Q V GI  +H     ++HRDIK EN
Sbjct: 877  YIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRDIKDEN 934

Query: 164  VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSP 221
            V++  +G  K+ DFGS +     P           ++    T  Y +PE++  + Y+  P
Sbjct: 935  VIVDSNGFVKLIDFGSAAYTKTGP----------FEVFVG-TIDYAAPEILGGNPYKGKP 983

Query: 222  IDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEV 281
                 DIWALGV LY + Y   PF    E  IL  + ++      +     LI  +L + 
Sbjct: 984  ----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRWILTKS 1037

Query: 282  PSQRPNICQVL 292
             + RP+I +++
Sbjct: 1038 VNDRPSIDEIV 1048

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 91/190 (47%), Gaps = 10/190 (5%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++ L+E+   G  +  M  +    L E       +Q + GI  +H  +  +IHRDIK EN
Sbjct: 278 LYFLLEYAPNGDFLSIM--KKYGSLNEECARYYGAQILNGIYFLH--RHGIIHRDIKPEN 333

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +L+      K+ DFG+   + R    ++E++          TA+Y SPE+++   +S +D
Sbjct: 334 ILLDKSMKVKLTDFGTAKLLNRK-DGTEEYDLTTRSKSFVGTAEYVSPELLN---DSWVD 389

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEV 281
            K DIWA G  L+++     PF+ + E        + QY     +   ++ L+  +L++ 
Sbjct: 390 HKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPMVVRDLVKQILVKK 449

Query: 282 PSQRPNICQV 291
           P  R  I Q+
Sbjct: 450 PEHRLTIPQI 459

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 83/185 (44%), Gaps = 22/185 (11%)

Query: 113  RGGLIDFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGL 171
              G ID  +    ++ + E E   I  Q   G+  +H L   ++HRDIK ENV+I   G 
Sbjct: 1129 ESGCIDLFDLIEFRTDMTEDEAKLIFKQVASGLQHLHSLG--IVHRDIKDENVIIDSKGY 1186

Query: 172  YKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIW 229
             K+ DFGS + V   P           D+   T   Y +PE++  + Y   P     DIW
Sbjct: 1187 VKIIDFGSAAYVKNGP----------FDVFVGTI-DYAAPEVLAGNPYEGKP----QDIW 1231

Query: 230  ALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNIC 289
            ALG+ LY I +   PF    E  I+     + +    +     LI  ML++   +RP+I 
Sbjct: 1232 ALGILLYTIIFKENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDIN 1289

Query: 290  QVLEE 294
            +V  +
Sbjct: 1290 EVFSD 1294

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 129/274 (47%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +    + ++    A   +  +  ++    L +E+   K + ++ ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID     S       V++L+E C  G L++ +  R    L E E+    +Q    I  
Sbjct: 143 QFIDCFEDDS------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIKY 194

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    +   K+ DFG ++ V+    N  E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYT-----ICGTP 243

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++ + ++S    + DIW+LGV LY +     PF+ + +   ++ R     + +P
Sbjct: 244 NYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFSFP 301

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                SD  K LI  +L   P +RP++ ++++ V
Sbjct: 302 RDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/274 (23%), Positives = 127/274 (46%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +         ++    A L    +  ++    L +E+   K +K+ +++V
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMKH-QNIV 205

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L++ +  R Q  L E E+    +Q    I  
Sbjct: 206 QFIDCFEDDT------NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGAIKY 257

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    +   K+ DFG ++ V+   R        +       T 
Sbjct: 258 MHSRR--VIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDR--------ERKFTVCGTP 306

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++ + ++S    + D+W++GV +Y +     PF+ + +   ++ R     + +P
Sbjct: 307 NYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQ-AKDVNTIYERIKCCDFIFP 364

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                S   K L+  +L   P +RP+I ++++ V
Sbjct: 365 KEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 111/251 (44%), Gaps = 39/251 (15%)

Query: 54  CLKRVIVPDKQGLNTLRAEVDAMKLLKNNKH---VVSYIDSHAAKSVNGIAYEVFVLMEF 110
           C K+ I+ +++ +  +  E D + LL    H   V  +   H   ++       + ++EF
Sbjct: 42  CSKKHIIRERK-VKYVTVEKDLLNLLAGGGHPGVVRLFCTFHDTDNL-------YYVLEF 93

Query: 111 CERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDG 170
              G L+  +  R   RL E     I SQ V  +  MH     +IHRD+K ENVL+S +G
Sbjct: 94  VSGGELLGLV--RRMGRLPEEWCRRIASQLVDTVDYMHAKG--VIHRDLKPENVLLSQEG 149

Query: 171 LYKVCDFGSVS----GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKS 226
              + DFG+      G   P    +  ++V        TA+Y SPE++    +S     S
Sbjct: 150 RIVITDFGAACCASEGGSAPGAADRAASFV-------GTAEYVSPELL---LHSQCSFGS 199

Query: 227 DIWALGVFLYKICYYTTPFEKSGE------AAILHSRYQYPSFPQYSDRLKGLIHLMLME 280
           D+WALG  +Y++     PF    E         L  R+ Y + P     +  L+  +L+ 
Sbjct: 200 DVWALGCIIYQLTQGAPPFRGDTELQSFEKIVALDYRWVYAAPPL----IVALVQSILVL 255

Query: 281 VPSQRPNICQV 291
            P QRP+  Q+
Sbjct: 256 DPLQRPSAKQL 266

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 91/198 (45%), Gaps = 13/198 (6%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++ L+E+   G  +  +  +    L E       SQ +  + ++H +   +IHRDIK EN
Sbjct: 199 LYFLLEYASHGDFLGLI--KKYGSLNEKCARYYASQIIDAVDSLHAIG--IIHRDIKPEN 254

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQE----FNYVQHDILTNTTAQYRSPEMIDLYRN 219
           +L+  D   K+ DFG+   +   P N+ +    F+          TA+Y SPE+++   +
Sbjct: 255 ILLDKDMKVKLTDFGTAKILPEQPSNNADGKPCFDLYARSKSFVGTAEYVSPELLN---D 311

Query: 220 SPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFPQYSDRLKGLIHLM 277
           S  D + DIWA G  LY++     PF+ + E        + QY     +    K L+  +
Sbjct: 312 SYTDSRCDIWAFGCILYQMVAGKPPFKAANEYLTFQKVMKIQYAFTAGFPLIAKDLVKKL 371

Query: 278 LMEVPSQRPNICQVLEEV 295
           L+  P+ R  + Q+   V
Sbjct: 372 LVREPNDRLTVEQIKAHV 389

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 110/229 (48%), Gaps = 23/229 (10%)

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRES 131
           E  A++ L N+  VV    +   +S       ++ L+E+   G  +  M  +    L E+
Sbjct: 227 EKTALQKLNNSPSVVRLFSTFQDES------SLYFLLEYAPNGDFLSLM--KKYGSLDET 278

Query: 132 EILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQ 191
                 +Q +  I  +H     +IHRDIK EN+L+  +   K+ DFG+ + ++ P  NS 
Sbjct: 279 CARYYAAQIIDAIDYLH--SNGIIHRDIKPENILLDGEMKIKLTDFGT-AKLLNPTNNS- 334

Query: 192 EFNYVQHDILTNT-----TAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFE 246
             +  ++D+ T +     TA+Y SPE+++   +S  D + DIWA G  L+++     PF+
Sbjct: 335 -VSKPEYDLSTRSKSFVGTAEYVSPELLN---DSFTDYRCDIWAFGCILFQMIAGKPPFK 390

Query: 247 KSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
            + E        + QY   P +   ++ L+  +L++   +R  I Q+ E
Sbjct: 391 ATNEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILVKNLDRRLTISQIKE 439

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 82/185 (44%), Gaps = 21/185 (11%)

Query: 112  ERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGL 171
            E G +  F     +  + E E   +  Q V  I  +H     ++HRDIK ENV++   G 
Sbjct: 931  ETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--GQGIVHRDIKDENVIVDSHGF 988

Query: 172  YKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIW 229
             K+ DFGS + +   P           D+    T  Y +PE++    Y+  P     DIW
Sbjct: 989  VKLIDFGSAAYIKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIW 1033

Query: 230  ALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNIC 289
            ALGV LY I Y   P+    E  IL    ++    + S+   GLI  +L     +RP I 
Sbjct: 1034 ALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEKVSEECIGLIKRILTREVDKRPTID 1091

Query: 290  QVLEE 294
            ++ E+
Sbjct: 1092 EIYED 1096

>TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1121

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 93/197 (47%), Gaps = 17/197 (8%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++ L+E+   G  +  M  +    L E       +Q +  I  +H     +IHRDIK EN
Sbjct: 317 LYFLLEYAPNGDFLSVM--KKYGTLNEECACYYGAQIIDAIHFIH--SKGIIHRDIKPEN 372

Query: 164 VLISHDGLYKVCDFGSVSGVIRP--PRNSQEFNYVQHDILTNT-----TAQYRSPEMIDL 216
           +L+  D   K+ DFG+   ++ P    N+        D+LT +     TA+Y +PE+++ 
Sbjct: 373 ILLDGDMKVKLTDFGTAK-ILDPVTKVNNNNSKTATFDLLTRSKSFVGTAEYVTPELLN- 430

Query: 217 YRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFPQYSDRLKGLI 274
             +S  D + DIWA G  L+++     PF+ + E        + QY     +   ++ L+
Sbjct: 431 --DSYTDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVVIRDLV 488

Query: 275 HLMLMEVPSQRPNICQV 291
             +L++ PSQR  I  +
Sbjct: 489 KKILLKQPSQRLTISAI 505

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 110/230 (47%), Gaps = 30/230 (13%)

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRL 128
           ++ EV  +  LK   ++  Y  S   ++      +++V+ME+C  G L     T L+   
Sbjct: 66  VQKEVQFLSSLKQVPNITQYYGSFLYET------KLWVIMEYCAGGSL----RTLLRPGK 115

Query: 129 RESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPR 188
            + + L ++ + +  +A +++ +  +IHRDIK  NVLI++ G  K+CDFG  + +     
Sbjct: 116 IDEKYLGVIVRNLL-VALLYIHKDNVIHRDIKAANVLITNGGHVKLCDFGVAAQLTTANH 174

Query: 189 NSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKICYYTTPF- 245
             Q             T  + +PE+I   +Y N+    K+DIW+LG+  Y+I     P+ 
Sbjct: 175 KRQTM---------AGTPYWMAPEVIMEGVYYNT----KADIWSLGITTYEIATGNPPYC 221

Query: 246 -EKSGEAAILHSRYQYPSFP--QYSDRLKGLIHLMLMEVPSQRPNICQVL 292
             ++  A  L ++ + P      YS  LK  I L L E P  RP   ++L
Sbjct: 222 DVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEARPTAEELL 271

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 128/274 (46%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +    + ++    A   +  +  ++    L +E+   K + +  ++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSMAH-PNIV 142

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            ++D     S       V++L+E C  G L++ +  R    L E E+    +Q    I  
Sbjct: 143 QFVDCFEDDS------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIKY 194

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+    +   K+ DFG ++ V+    N  E  Y         T 
Sbjct: 195 MHSRR--VIHRDLKLGNIFFDSNYNLKIGDFG-LAAVL---ANESERKYT-----ICGTP 243

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++ + ++S    + DIW+LGV LY +     PF+ + +   ++ R     + +P
Sbjct: 244 NYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQ-ARDVNTIYERIKCRDFSFP 301

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                SD  K LI  +L   P +RP++ ++++ V
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 95/193 (49%), Gaps = 19/193 (9%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           V++ +E+C    L D++   L+ R+   E   + +Q V  +   H LQ   +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +L+  +G   + DFG                  Q + +  TT  Y +PE+I   R +   
Sbjct: 159 ILLDKNGYAMLTDFGFTRECA---------TKTQLETVCGTTV-YMAPELIK--REAYDG 206

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAI-LHSRYQYPS-FPQY-SDRLKGLIHLMLME 280
            K D W+LG+ LY + +   PF++       L   ++ P+   +Y S + K LI  +L +
Sbjct: 207 YKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLLDK 266

Query: 281 VPSQRPNICQVLE 293
             +QRPN+ +VL+
Sbjct: 267 NAAQRPNLNEVLQ 279

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 124/286 (43%), Gaps = 61/286 (21%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNN 82
           KI+K +  G F +VY A   P          CLK     DK   N +R      ++  + 
Sbjct: 42  KILKQIGEGSFGKVYLALHRP-----THRKVCLK---TSDKNDPNIVR------EVFYHR 87

Query: 83  KHVVSYIDSHAAKSVNGIAYE--VFVLMEFCERGGLID-FMNTRLQSRLRESEILEIMSQ 139
           +    YI     K    I  E  V++ +E+C    L D  ++    S L   E+   +S 
Sbjct: 88  QFDFPYI----TKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGELFAQISG 143

Query: 140 TVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHD 199
            V    +MH      +HRD+K+EN+L+  +G  K+ DFG                    +
Sbjct: 144 AVYYAHSMHC-----VHRDLKLENILLDKNGNAKLTDFG-----------------FTRE 181

Query: 200 ILTNTTAQ-------YRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAA 252
            +T TT +       Y +PE+I   R +    K D W+LGV LY +   + PF+   EA 
Sbjct: 182 CMTKTTLETVCGTTVYMAPELIG--RKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEA- 238

Query: 253 ILHSRYQYPS-FPQYSDRL-----KGLIHLMLMEVPSQRPNICQVL 292
              ++++  +  P+Y  +L     K LI  +L + P +RP++ QVL
Sbjct: 239 --KTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W
           (REAL)
          Length = 1081

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 131/294 (44%), Gaps = 25/294 (8%)

Query: 7   SLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGL 66
           SL    +V+  G    K    +  G ++ V  A  +  D         L +  +  ++ +
Sbjct: 165 SLKSKKSVIKKGIKDFKFGSIIGDGAYSTVVLA--TSIDTKKKYAAKVLNKEYLIRQKKV 222

Query: 67  NTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQS 126
             +  E  A++ L N+  VV    +   +S       ++ L+E+   G  +  M  +   
Sbjct: 223 KYVSIEKTALQKLNNSLSVVRLFSTFQDES------SLYFLLEYAPNGDFLSLM--KKYG 274

Query: 127 RLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRP 186
            + E+      +Q +  I  +H     +IHRDIK EN+L+  +   K+ DFG+   ++ P
Sbjct: 275 SIDENCACYYAAQIIDAIDYLH--SNGIIHRDIKPENILLDEEMRIKLTDFGTAK-LLSP 331

Query: 187 PRNSQEFNYVQHDILTNT-----TAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYY 241
             NS   +  ++D+ T +     TA+Y SPE+++   +S  D + DIWA G  L+++   
Sbjct: 332 TSNS--VSKPKYDLSTRSKSFVGTAEYVSPELLN---DSFTDYRCDIWAFGCILFQMIAG 386

Query: 242 TTPFEKSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
             PF+ + E        + QY   P +   ++ L+  +L++   QR  I Q+ E
Sbjct: 387 KPPFKATNEYLTFQKVMKVQYAFTPGFPLVIRDLVKRILVKNLDQRLTINQIKE 440

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 104/230 (45%), Gaps = 30/230 (13%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN 121
           D   +  ++ E+  +  LK   ++  Y  S+   +       +++LME+C  G L   + 
Sbjct: 59  DSDEVEDVQREIQFLASLKQMPNITRYYGSYLKDT------SLWILMEYCAGGSLRSLLR 112

Query: 122 TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H  +  +IHRDIK  NVLI+++G  K+CDFG  +
Sbjct: 113 P---GKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVAA 167

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKIC 239
            V +     Q             T  + +PE+I   +Y     D K DIW+LG+  Y+I 
Sbjct: 168 QVNQTSLRRQTM---------AGTPYWMAPEVIMEGVY----YDTKVDIWSLGITTYEIA 214

Query: 240 YYTTPF--EKSGEAAILHSRYQYPSFP--QYSDRLKGLIHLMLMEVPSQR 285
               P+   ++  A  L  + + P      YS  LK  I L L E P +R
Sbjct: 215 TGNPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKER 264

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 97/197 (49%), Gaps = 19/197 (9%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++ L+E+   G  +  +  +    L E+      SQ +  + ++H +   +IHRDIK EN
Sbjct: 199 LYFLLEYAPHGDFLGLI--KKYGSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPEN 254

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQE----FNYVQHDILTNTTAQYRSPEMIDLYRN 219
           +L+  +   K+ DFG+   +   P N+ +    F+          TA+Y SPE+++   +
Sbjct: 255 ILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLN---D 311

Query: 220 SPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AAILHSRYQYPS-FPQYSDRLKGLI 274
           +  D + DIWA G  LY++     PF+ + E      ++  +Y + + FPQ    +K L+
Sbjct: 312 NYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI---VKDLV 368

Query: 275 HLMLMEVPSQRPNICQV 291
             +L+  P+ R  I Q+
Sbjct: 369 KKLLVRDPNDRLTIKQI 385

>Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON}
            similar to Ashbya gossypii ABR014W
          Length = 1122

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 93/175 (53%), Gaps = 25/175 (14%)

Query: 73   VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
            ++ + ++K +KH  +V++IDS+  K       +++V+ME+ E G L D +   +   L E
Sbjct: 879  INEILVMKGSKHKNIVNFIDSYLLKG------DLWVVMEYMEGGSLTDVVTHCI---LTE 929

Query: 131  SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
             +I  +  +T++G+  +H     +IHRDIK +N+L+S DG  K+ DFG  + +       
Sbjct: 930  GQIAAVSRETLRGLHFLH--SKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQI------- 980

Query: 191  QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
             E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+
Sbjct: 981  NESNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 1030

>KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} similar
           to uniprot|P48562 Saccharomyces cerevisiae YNL298W CLA4
           Involved in localizing cell growth with respect to the
           septin ring protein kinase homologous to Ste20p
           interacts with CDC42
          Length = 879

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 112/237 (47%), Gaps = 34/237 (14%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYSN---------ANTACLKRVIVPDKQGLNTLRAEV 73
           ++++    G    VY AE     PY +          N   +K++I+  +     +  E+
Sbjct: 589 RMVEKAGQGASGSVYLAERLQLPPYKDELEAEKNQLGNKVAIKQMILSKQPRKELIVNEI 648

Query: 74  DAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFM-----NTRLQSRL 128
             MK  K+N ++V++++++          +++V+ME+ E G L D +      +  QS L
Sbjct: 649 LVMKDSKHN-NIVNFLEAYLK-----TEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPL 702

Query: 129 RESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPR 188
            E +I  I+ +T QG+  +H     +IHRDIK +NVL+   G  K+ DFG  + +    +
Sbjct: 703 TEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDTRGRVKITDFGFCAKLTD--K 758

Query: 189 NSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
            S+    V        T  + +PE++   +    DEK D+W+LG+   ++     P+
Sbjct: 759 RSKRATMV-------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLESEPPY 805

>ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON}
           similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129W PAK1 Upstream kinase for the SNF1 complex
           partially redundant function with Elm1p and Tos3p
           members of this family of kinases have functional
           orthology with LKB1 a mammalian kinase associated with
           Peutz-Jeghers cancer-susceptibility syndrome and some
           similarities with YGL179C uniprot|P43637 Saccharomyces
           cerevisiae YGL179C TOS3 Putative protein kinase, related
           to and redundant with Elm1p and Pak1p in activating the
           SNF1 complex
          Length = 1131

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 99/216 (45%), Gaps = 34/216 (15%)

Query: 56  KRVIVPDKQGLNT----LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFC 111
           +R +V DK+   T    +R E+  MK   + KHVV  ++          + ++++++E+C
Sbjct: 154 RRFLVLDKKNSLTQNEKIRREIAIMKKC-HYKHVVKLVEVLDDLK----SRKIYLVLEYC 208

Query: 112 ERGGLIDFMNTRLQSRLRESEIL------EIMSQTVQGIAAMHVLQPPLIHRDIKIENVL 165
            RG +       L++  R   +L      EI+   V G+  +H     +IHRDIK  N+L
Sbjct: 209 SRGEVKWCPGDVLETEARGPPLLNFQRTREIIRGVVLGLEYLHYQG--VIHRDIKPANLL 266

Query: 166 ISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNT--TAQYRSPEMI--------- 214
           ++ DG  K+ DFG VS   R P        +    L  T  T  + +PE+          
Sbjct: 267 MAEDGTVKISDFG-VSLAARDPNGDANLESLDELELAKTAGTPAFFAPEICLGEEAFEKF 325

Query: 215 -----DLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
                DL++ S +    DIWALGV LY + +   PF
Sbjct: 326 SIDRSDLFKGSSVSFMIDIWALGVTLYCLLFGMLPF 361

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 111/231 (48%), Gaps = 32/231 (13%)

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRL 128
           ++ E+  +  LK   ++  Y  S+   +      +++V+ME+C  G L   +      ++
Sbjct: 68  VQKEIQFLASLKQVPNITRYYGSYLYDT------KLWVIMEYCAGGSLRTLLRP---GKI 118

Query: 129 RESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPR 188
            E  +  I+ + +  IA +++ +  +IHRDIK  NVLI+++G  K+CDFG  +       
Sbjct: 119 DEKYLGVIVRKLL--IALVYIHKDNVIHRDIKAANVLITNEGHVKLCDFGVAA------- 169

Query: 189 NSQEFNYVQHDILTNT-TAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
              +     H   T   T  + +PE+I   +Y N+    K+DIW+LG+  Y+I     P+
Sbjct: 170 ---QLTAANHKRQTMAGTPYWMAPEVIMEGVYYNT----KADIWSLGITAYEIATGNPPY 222

Query: 246 --EKSGEAAILHSRYQYPSFP--QYSDRLKGLIHLMLMEVPSQRPNICQVL 292
              ++  A  L ++ + P      YS  LK  I L L E P +RP    +L
Sbjct: 223 CDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERPTAEDLL 273

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/240 (27%), Positives = 103/240 (42%), Gaps = 31/240 (12%)

Query: 60   VPDKQGLNTLRAEVDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLI 117
            V D+Q L T+ +E+  M  L    H  ++S +D         I   V          G I
Sbjct: 1164 VRDRQ-LGTIPSEIQIMATLNKKPHDNILSLLDFFEDDDYYYIETPVH------GETGCI 1216

Query: 118  DFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCD 176
            D  +    ++ + E E   I  Q V GI  +H     ++HRDIK ENV++   G  K+ D
Sbjct: 1217 DLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVKIID 1274

Query: 177  FGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVF 234
            FGS + V   P           D+   T   Y +PE++  + Y   P     DIWA+G+ 
Sbjct: 1275 FGSAAYVKSGP----------FDVFVGTI-DYAAPEVLSGEPYEGKP----QDIWAIGIL 1319

Query: 235  LYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEE 294
            LY I +   PF    E  IL    ++ +    S+    LI  +L+    +RP I ++  +
Sbjct: 1320 LYTIVFKENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEIFND 1377

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 82/292 (28%), Positives = 127/292 (43%), Gaps = 63/292 (21%)

Query: 17  VGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAM 76
           VG++  KI+K +  G F +VY A   P          CLK     DK   N +R      
Sbjct: 38  VGNY--KILKQIGEGSFGKVYLALHRP-----THRKVCLK---TSDKNDPNIVR------ 81

Query: 77  KLLKNNKHVVSYIDSHAAKSVNGIAYE--VFVLMEFCERGGLIDFMNTRLQSRLRE-SEI 133
           ++  + +    YI     K    I  E  V++ +E+C    L D + +  +  L E  E+
Sbjct: 82  EVFYHRQFDFPYI----TKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGEL 137

Query: 134 LEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEF 193
              +S  V    +MH      +HRD+K+EN+L+  +G  K+ DFG               
Sbjct: 138 FAQISGAVYYAHSMHC-----VHRDLKLENILLDRNGNAKLTDFG--------------- 177

Query: 194 NYVQHDILTNTTAQ-------YRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFE 246
                + +T TT +       Y +PE+I+  R +    K DIW+LGV LY +     PF+
Sbjct: 178 --FTRECMTKTTLETVCGTTVYMAPELIE--RKTYDGFKIDIWSLGVILYTLITGYLPFD 233

Query: 247 KSGEA----AILHSRYQYPS--FPQYSDRLKGLIHLMLMEVPSQRPNICQVL 292
              E      I++   +Y S   P   D  K LI  +L + P +RP++ QVL
Sbjct: 234 DDDEVKTKWKIVNEEPKYDSKFIP---DDAKDLISRLLAKNPGERPSLPQVL 282

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/291 (23%), Positives = 130/291 (44%), Gaps = 26/291 (8%)

Query: 13  TVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAE 72
           T++  G    K    L  G ++QV+ A  S  D         L +  +  ++ +  +  E
Sbjct: 109 TIIRKGIKDFKFGDMLGDGSYSQVFLA-TSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIE 167

Query: 73  VDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESE 132
             A++ LK+   V++   +   ++       ++ L+E+   G  +  +  +    L E  
Sbjct: 168 KTALQNLKSVTGVINLSFTFQDEA------NLYFLLEYAPNGDFLSLI--KKFGTLNEEC 219

Query: 133 ILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQE 192
            +   +Q +  I +MH     +IHRDIK EN+L+  +   K+ DFG+   +    + S +
Sbjct: 220 TIYYSAQIIDAIGSMH--SHGIIHRDIKPENILLDGNMKIKLTDFGTAKLL---QKKSDK 274

Query: 193 FNYVQHDILTNT-----TAQYRSPEMI-DLYRNSPIDEKSDIWALGVFLYKICYYTTPFE 246
                +++LT +     TA+Y SPE++ D Y     D K DIWA G  +Y++     PF+
Sbjct: 275 NGKPHYNLLTRSSSFVGTAEYVSPELLSDNY----TDYKCDIWAFGCLVYQMIAGKPPFK 330

Query: 247 KSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
            + E        + Q+     +   ++ L+  +L++ P +R  I Q+ E  
Sbjct: 331 ATNEYLTFQKVMKVQFAFTAGFPTIIRDLVKNILVKQPEKRLTIPQIKEHC 381

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 80/182 (43%), Gaps = 21/182 (11%)

Query: 112  ERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGL 171
            E G +  F      S + E EI  +  Q V G+  +H     ++HRDIK EN+++ + G 
Sbjct: 1211 ETGSIDLFDLIEFTSNMTEFEIKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDNKGF 1268

Query: 172  YKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIW 229
             K+ DFGS + V   P           D+   T   Y +PE++  + Y   P     DIW
Sbjct: 1269 IKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGKP----QDIW 1313

Query: 230  ALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNIC 289
            ALG+ LY I +   PF    E  IL    ++      S     LI L+L     +RP I 
Sbjct: 1314 ALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLILNRNVFKRPTID 1371

Query: 290  QV 291
             +
Sbjct: 1372 DI 1373

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 111/229 (48%), Gaps = 30/229 (13%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           V+ + ++K +KH  +V++IDS+  +       +++V+ME+ E G L D +   +   L E
Sbjct: 741 VNEILVMKGSKHNNIVNFIDSYLFRG------DLWVVMEYMEGGSLTDVVTHCI---LTE 791

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T++G+  +H     +IHRDIK +N+L+S +G  K+ DFG  + +       
Sbjct: 792 GQIGAVSRETLKGLQFLH--SKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQI------- 842

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF--EKS 248
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+  E  
Sbjct: 843 NEVNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETP 897

Query: 249 GEAAILHSRYQYPSFPQ---YSDRLKGLIHLMLMEVPSQRPNICQVLEE 294
             A  L +    P        S ++   ++  LM  P  R     +LE+
Sbjct: 898 LRALYLIATNGTPKLKDPGNLSHKMAMFLNWCLMVDPEDRGTAADLLED 946

>ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL007C (STE20)
          Length = 971

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 93/175 (53%), Gaps = 25/175 (14%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K ++H  +V++IDS+  K       +++V+ME+ E G L D +   +   L E
Sbjct: 726 INEILVMKGSRHNNIVNFIDSYLLKG------DLWVIMEYMEGGSLTDVVTHCI---LTE 776

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T++G+  +H     +IHRDIK +N+L+S DG  K+ DFG  + +       
Sbjct: 777 GQIAAVSRETLRGLHFLH--SKGVIHRDIKSDNILLSMDGNIKLTDFGFCAQI------- 827

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
            E N  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+
Sbjct: 828 NETNLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 877

>CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12003 Saccharomyces cerevisiae
           YPL236c
          Length = 399

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 79/152 (51%), Gaps = 8/152 (5%)

Query: 156 HRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMID 215
           H+ +   N++ S +GL  + + GS S      + +++ N ++  +  N  + Y +PE +D
Sbjct: 249 HKMLSPSNIIFSSNGLPIISELGSCSKADVEIKTAKQLNRLREWVDDNFNS-YMAPEFLD 307

Query: 216 LYRNSPIDEKSDIWALGVFLYKICYYTTPFEK-------SGEAAILHSRYQYPSFPQYSD 268
           L  NS +  K D+W+ G   Y + +   PFE+       S + AI   ++ +PS  +YSD
Sbjct: 308 LKTNSKLSTKVDVWSFGCICYALLFGMNPFEREEQLYGASIKYAISTGKFSFPSQSRYSD 367

Query: 269 RLKGLIHLMLMEVPSQRPNICQVLEEVSRLQN 300
            +  +I   L   PS+RP++  VL  + +LQ+
Sbjct: 368 SILDIIRSCLQVDPSERPSVSIVLNNLQQLQS 399

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 115  GLIDFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
            G ID  +    ++ + E E   I+ Q V GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1192 GCIDLFDLIEFKTNMTECEAKLIVKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1249

Query: 174  VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y   P     DIWA+
Sbjct: 1250 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGKP----QDIWAI 1294

Query: 232  GVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNI 288
            G+ LY + +   PF    E  IL    ++ +  + S+    LI  +L     +RP I
Sbjct: 1295 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTI 1349

>KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.140
           YGL179C
          Length = 896

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 84/347 (24%), Positives = 156/347 (44%), Gaps = 74/347 (21%)

Query: 5   QISL-YDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAE---------ISPPDPYSNANTAC 54
           QISL YDP +   V + + +II  L  G   +V  A+         I   D + N++ + 
Sbjct: 133 QISLTYDPVSKRKVLNTY-EIIGELGHGQHGKVKLAKDLLTNDLVAIKIVDRHENSSKSL 191

Query: 55  L---KRVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFC 111
               K++   DK     ++ E+  MK L ++KHVV  I+          + ++++++E+C
Sbjct: 192 FLSNKKIASNDK-----IKKEIAIMKKL-HHKHVVKLIEVLDDLK----SRKIYLVLEYC 241

Query: 112 ERGGLIDFMNTRLQSRLRESEIL------EIMSQTVQGIAAMHVLQPPLIHRDIKIENVL 165
             G  I + N  L+ + +   +L      EI+   + G+  +H     +IHRDIK  N+L
Sbjct: 242 SNGE-IKWCNDELEMKAKGPPVLSFQATREIIRGVIMGLEYLHY--QGIIHRDIKPANLL 298

Query: 166 ISHDGLYKVCDFG---SVSGVIRPPRNSQEFNYVQHDIL-------TNTTAQYRSPEMI- 214
           +  DG+ K+ DFG   + + +++   ++ + +  ++D +       T  T  + +PE+  
Sbjct: 299 VDEDGIVKISDFGVSLASTTIMQQSTHNLDDSKDENDNVDELELAKTAGTPAFFAPEICL 358

Query: 215 -------------DLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGE----AAILHSR 257
                        +L+  S +    DIWALGV LY + +   PF    E      I++  
Sbjct: 359 GDEVFEKYNFDRSELFSGSCVSLMIDIWALGVTLYCLLFGKLPFISDYELELFEKIVNDA 418

Query: 258 YQYPSFPQYS-------------DRLKGLIHLMLMEVPSQRPNICQV 291
             YP++ + +             D    L++ +L + PS+R  IC +
Sbjct: 419 VTYPTYDEIANNGISNVSGKEEYDMAIDLLNKLLEKDPSKRIRICDI 465

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 91/196 (46%), Gaps = 23/196 (11%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIE 162
           +V++ +E+C    L D++  +   R+   E  ++ +Q V  +   H LQ   +HRD+K+E
Sbjct: 102 KVWMALEYCPGNELYDYLLQK--QRIPLDETSKLFAQIVGAVFYAHSLQ--CVHRDLKLE 157

Query: 163 NVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPI 222
           N+L+   G   + DFG                  Q + +  TT  Y +PE+I   R S  
Sbjct: 158 NILLDKQGYAMLTDFGFTRECA---------TKTQLETICGTTV-YMAPELIK--RESYD 205

Query: 223 DEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSD-----RLKGLIHLM 277
             K D W+LG+ LY + +   PF++  E   L         P   D       K LI  +
Sbjct: 206 GYKVDTWSLGIILYTMLHGFMPFDE--EDPTLTGLKIMNEMPPIVDAYTNVHAKDLILKL 263

Query: 278 LMEVPSQRPNICQVLE 293
           L + PS+RP++ +VLE
Sbjct: 264 LRKTPSERPSLNKVLE 279

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 102/230 (44%), Gaps = 30/230 (13%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN 121
           D   +  ++ E+  +  LK   ++  Y  S+   +       ++++ME+C  G L   + 
Sbjct: 59  DSDEVEDVQREIQFLASLKQIHNITRYYGSYLKDT------SLWIIMEYCAGGSLRSLLR 112

Query: 122 TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H  +  +IHRDIK  NVLI+++G  K+CDFG  +
Sbjct: 113 ---PGKIDEKYIGVIMREVLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAA 167

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKIC 239
            V +     Q             T  + +PE+I   +Y     D K DIW+LG+  Y+I 
Sbjct: 168 QVNQTSLRRQTM---------AGTPYWMAPEVIMEGVY----YDTKVDIWSLGITTYEIA 214

Query: 240 YYTTPFEK----SGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQR 285
               P+ +         I+ S+        YS  LK  I L L E P +R
Sbjct: 215 TGNPPYCEVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 102/230 (44%), Gaps = 30/230 (13%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN 121
           D   +  ++ E+  +  LK   ++  Y  S+   +       ++++ME+C  G L   + 
Sbjct: 80  DSDEVEDVQREIQFLASLKQVPNITRYYGSYLQDT------NLWIIMEYCAGGSLRTLLR 133

Query: 122 TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
             +   + E  I  IM + +  +  +H  +  +IHRDIK  NVLI+++G  K+CDFG  +
Sbjct: 134 PGM---IDEKYIGVIMRELLTALQCIH--KDNVIHRDIKAANVLITNEGKVKLCDFGVAA 188

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKIC 239
            + +     Q             T  + +PE+I   +Y     D K DIW+LG+  Y+I 
Sbjct: 189 QLNQTSLRRQTM---------AGTPYWMAPEVIMEGVY----YDTKVDIWSLGITAYEIA 235

Query: 240 YYTTPFEK----SGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQR 285
               P+ +         I  S+       QYS  LK  I L L E P +R
Sbjct: 236 TGNPPYCEIEALRAMQLITKSKPARLEGRQYSSGLKEFIALCLDEDPKER 285

>Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 95/192 (49%), Gaps = 16/192 (8%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++++ME+C  G   D +     + L E ++  I+ Q   G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLH--EQRKIHRDIKAAN 141

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +L++ +G+ K+ DFG VSG +R       F           T  + +PE++    +   +
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHLRSTMKRDTF---------VGTPYWMAPEVVCCEVDG-YN 190

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFP-QYSDRLKGLIHLMLME 280
           EK+DIW+LG+  Y++     P  K     ++ +  + + P     +SD  K  +   L++
Sbjct: 191 EKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSDAAKEFVAGCLVK 250

Query: 281 VPSQRPNICQVL 292
           VP+ RP+   +L
Sbjct: 251 VPADRPSAYDLL 262

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 100/199 (50%), Gaps = 29/199 (14%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQ-SRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKI 161
           +V++ +E+C    L D +   LQ  R+   E +++ SQ V  +   H L    +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 162 ENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSP 221
           EN+L+  DG  K+ DFG     +           V  + +  TT  Y +PE+ +     P
Sbjct: 166 ENILLDKDGNAKLTDFGFTRECMEK---------VNLETICGTTV-YMAPELTE---RKP 212

Query: 222 IDE-KSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQ-YPSFPQYSDRL-----KGLI 274
            D  K DIW+LGV LY +   + PF++  EA    ++++     P+Y+ +      + L+
Sbjct: 213 YDGFKIDIWSLGVILYTMLSGSMPFDEDDEAK---TKWKIINEEPEYNSKFMTAEGEDLV 269

Query: 275 HLMLMEVPSQRPNICQVLE 293
             +L +  + RP++ ++L+
Sbjct: 270 RKLLQKDSNLRPSVREILQ 288

>NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {ON}
           Anc_6.262 YPL236C
          Length = 406

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 76/153 (49%), Gaps = 9/153 (5%)

Query: 156 HRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMID 215
           HR+IK  N+L S DG   + D  S S      +  ++    +  I +  +  + SPE++D
Sbjct: 251 HRNIKPSNILFSSDGSQVISDLSSTSKSNIHLKTGKQILDFKEWIDSCCSVPFMSPELLD 310

Query: 216 LYRNSPIDEKSDIWALGVFLYKICYYTTPFE-------KSGEAAILHSRYQYP-SFPQYS 267
           L   S IDEK DIW+LG  +Y I    +PFE       KS    IL + + +P    +++
Sbjct: 311 LKMGSKIDEKVDIWSLGCTIYTIILGVSPFEREVQLTGKSIRMLILSANFTFPEGMERHA 370

Query: 268 DR-LKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299
            R L   I   L   P++RP I Q+L ++  LQ
Sbjct: 371 SRELIDTIKQCLQVDPTKRPTINQLLNDLQALQ 403

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 143/320 (44%), Gaps = 41/320 (12%)

Query: 12   GTVLTVGSHHAKIIKY-LTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLR 70
            G ++  GS  A  +   +T+G    V   E+     YS+ N A L  V          LR
Sbjct: 1178 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPK---YSSQNEAILSTV--------EALR 1226

Query: 71   AEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
            +EV  +K L ++ ++V Y+     ++ N I Y +F  +E+   G +   +  R+  R  E
Sbjct: 1227 SEVSTLKDL-DHLNIVQYL---GFENKNNI-YSLF--LEYVAGGSVGSLI--RMYGRFDE 1277

Query: 131  SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
              I  + +Q ++G+A +H     ++HRD+K +N+L+  DG+ K+ DFG +S      R S
Sbjct: 1278 PLIKHLTTQVLKGLAYLH--SKGILHRDMKADNLLLDQDGICKISDFG-IS------RKS 1328

Query: 191  QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGE 250
            ++  Y   D+    T  + +PEM+D  +      K DIW+LG  + ++     P+     
Sbjct: 1329 KDI-YSNSDMTMRGTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNLEV 1385

Query: 251  AAILHSRYQYPSFPQYSDRLKGLIHLM-------LMEV-PSQRPNICQVLEEVSRLQNEP 302
             A +    +  S P   +    LI  +         E+ P +RP   ++L       NE 
Sbjct: 1386 VAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPFSEVNET 1445

Query: 303  CPIRNFYLLRAMGQNAQLAS 322
               ++  L + +  N +L S
Sbjct: 1446 FNFKSTRLAKFIKSNDKLNS 1465

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 105/228 (46%), Gaps = 26/228 (11%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN 121
           D+  +  ++ EV  +  +K   ++  Y  S+   +       +++++E+C  G L   + 
Sbjct: 65  DEDEVEDVQREVQFLASMKQTPNITHYYGSYLKDTT------LWIIIEYCAGGSLRTLLR 118

Query: 122 TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
                ++ E  I  IM + +  IA  ++ +  +IHRDIK  NVLI+++G  K+CDFG  +
Sbjct: 119 ---PGKIDEKYIGIIMREVL--IALKYIHKDNVIHRDIKAANVLITNEGHVKLCDFGVAA 173

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYY 241
            + +     Q             T  + +PE+I        D K DIW+LG+  Y+I   
Sbjct: 174 QLNQSSLKRQTM---------AGTPYWMAPEVI--MEGVSYDTKVDIWSLGITTYEIATG 222

Query: 242 TTPF--EKSGEAAILHSRYQYPSFP--QYSDRLKGLIHLMLMEVPSQR 285
             P+   ++  A  L ++ + P      YS  LK  I L L E P +R
Sbjct: 223 NPPYCDVEALRAMQLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKER 270

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 93/201 (46%), Gaps = 33/201 (16%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIE 162
           E+++++E+ E G L D++ ++   +L ESE +    Q VQ +A  H     + HRD+K E
Sbjct: 148 ELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--ICHRDLKPE 203

Query: 163 NVLISHDGL-YKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA---QYRSPEMI--DL 216
           N+L+       K+ DFG  +                 D L  T+     Y SPE++    
Sbjct: 204 NLLLDKKKRSIKIADFGMAA-------------LETSDKLLETSCGSPHYASPEIVLGRK 250

Query: 217 YRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAIL----HSRYQYPSFPQYSDRLKG 272
           Y  SP    SD+W+ G+ L+ +     PF       +L      +YQ P +   S   K 
Sbjct: 251 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW--LSVEAKD 304

Query: 273 LIHLMLMEVPSQRPNICQVLE 293
           LI  +L+  P++R  I Q+L+
Sbjct: 305 LISRILVVDPNRRITIDQILQ 325

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 114/252 (45%), Gaps = 34/252 (13%)

Query: 31   GGFAQVYTAEISPPDPYSNANTACLKRVIVP-----DKQGLN---TLRAEVDAMKLLKNN 82
            G F  VY A        +      +K+V VP     D+  ++    L++EV  +K L N+
Sbjct: 1047 GSFGAVYLALN-----VTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDL-NH 1100

Query: 83   KHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQ 142
             ++V Y+     +  NGI Y +F  +E+   G +   +  R+  R  +  I  +  Q ++
Sbjct: 1101 VNIVQYL---GFEEKNGI-YSLF--LEYVAGGSVGSLI--RMYGRFDDQLIRHLTKQVLE 1152

Query: 143  GIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILT 202
            G+A +H     ++HRD+K +N+L+ +DG+ K+ DF    G+ R   N     Y   D+  
Sbjct: 1153 GLAYLHSKG--ILHRDMKADNLLLDNDGVCKISDF----GISRKSNNI----YSNSDMTM 1202

Query: 203  NTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPS 262
              T  + +PEM+D         K DIW+LG  + ++     P+      A +    +  +
Sbjct: 1203 RGTVFWMAPEMVDTAHG--YSAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSKT 1260

Query: 263  FPQYSDRLKGLI 274
             P   D  K L+
Sbjct: 1261 APPIPDDTKDLV 1272

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 82/180 (45%), Gaps = 22/180 (12%)

Query: 115  GLIDFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
            G ID  +    ++ + E E   I  Q V  I  +H     ++HRDIK ENV++   G  K
Sbjct: 1129 GCIDLFDLIEFKTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQGFIK 1186

Query: 174  VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y   P     DIWA+
Sbjct: 1187 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYVGKP----QDIWAI 1231

Query: 232  GVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            G+ LY I +   PF    E  IL +  ++ +     +    LI  +L   P++RP I ++
Sbjct: 1232 GILLYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDEI 1289

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 85/190 (44%), Gaps = 22/190 (11%)

Query: 112  ERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGL 171
            E G +  F    L++ + E E   I  Q   GI  +H     ++HRDIK EN+++ + G 
Sbjct: 1104 ETGSIDLFDLIELKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGF 1161

Query: 172  YKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIW 229
             K+ DFGS + V   P           D+   T   Y +PE++  D Y   P     DIW
Sbjct: 1162 VKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGDPYEGKP----QDIW 1206

Query: 230  ALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNIC 289
            A+GV LY I +   PF    E  IL    +  S    S+    LI  +L     +RP I 
Sbjct: 1207 AIGVLLYTIIFKENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIE 1264

Query: 290  QVLEEVSRLQ 299
            ++  + S LQ
Sbjct: 1265 EIYND-SWLQ 1273

>ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1111

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 94/195 (48%), Gaps = 18/195 (9%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++ L+E+   G  +  M  +    L E       +Q +  I  +H  Q  +IHRDIK EN
Sbjct: 244 LYFLLEYAPNGDFLSIM--KKYGSLNEECTCYYSAQIIDAIKFLH--QRGIIHRDIKPEN 299

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNT-----TAQYRSPEMIDLYR 218
           +L+  +   K+ DFG+   +    + S E     +D+ T +     TA+Y SPE+++   
Sbjct: 300 ILLDKEMKVKLTDFGTAKLLDGKSQASGE----TYDLHTRSKSFVGTAEYVSPELLN--- 352

Query: 219 NSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFPQYSDRLKGLIHL 276
           ++ +D + DIWA G  ++++     PF+ + E        + QY     +   ++ L+  
Sbjct: 353 DNWVDYRCDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVVVRDLVKR 412

Query: 277 MLMEVPSQRPNICQV 291
           +L+  P QR +I Q+
Sbjct: 413 ILLRQPDQRLSIPQI 427

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 82/181 (45%), Gaps = 19/181 (10%)

Query: 112  ERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGL 171
            E G +  F     ++ + E E   +  Q V G+  +H     ++HRDIK EN+++   G 
Sbjct: 1166 ETGSIDLFDLIEFKTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGF 1223

Query: 172  YKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEK-SDIWA 230
             K+ DFGS + V   P           D+   T   Y +PE++     SP + K  DIWA
Sbjct: 1224 VKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLG---GSPYEGKPQDIWA 1269

Query: 231  LGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQ 290
            +G+ LY I +   PF    E  IL    ++ S    S++   LI  +L     +RP I  
Sbjct: 1270 IGILLYTIVFKENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTIDD 1327

Query: 291  V 291
            +
Sbjct: 1328 I 1328

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 80/290 (27%), Positives = 137/290 (47%), Gaps = 51/290 (17%)

Query: 14  VLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVP--DKQGLNTLRA 71
           ++ VG++  +I+K +  G F +VY A   P            ++V++   DK   N +R 
Sbjct: 35  LIEVGNY--RILKQIGEGSFGKVYLALHRPTH----------RKVVLKTSDKNDPNIVR- 81

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYE--VFVLMEFCERGGLIDFMNTRLQSRLR 129
                ++  + +    YI     K    I  E  V++ +E+C    L D +      R+ 
Sbjct: 82  -----EVFYHRQFDYPYI----TKVYEIIVTETKVWMALEYCPGKELYDHL--LFSKRIP 130

Query: 130 ESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRN 189
            +E  E+ +Q V  +   H L    +HRD+K+EN+L+   G  K+ DFG     +   R+
Sbjct: 131 IAECTELFAQIVGAVYYAHSLN--CVHRDLKLENILLDKHGRAKLTDFGFTRECM--TRS 186

Query: 190 SQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSG 249
           + E        +  TT  Y +PE+I+  R S    K DIWALGV LY + Y   PF++  
Sbjct: 187 TLE-------TVCGTTV-YMAPELIE--RKSYDGFKIDIWALGVILYTMIYGAMPFDEDD 236

Query: 250 EAAILHSRYQY----PSFPQ--YSDRLKGLIHLMLMEVPSQRPNICQVLE 293
           E   + ++++     P F     S+ +K LI  +L + P++RP I ++L+
Sbjct: 237 E---VKTKWKIVNEDPDFTNNISSNDVKDLIKKLLKKDPTERPTIREILK 283

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 93/195 (47%), Gaps = 20/195 (10%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++ L+E+   G  +  M  R  + L E       +Q +  I  +H  +  +IHRD+K EN
Sbjct: 276 LYFLLEYAPNGDFLSVMK-RFGT-LSEECTKYYGAQILDAIHHLH--KQGIIHRDVKPEN 331

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNT-----TAQYRSPEMIDLYR 218
           +L+      K+ DFG+   + R   N        +D+ T +     TA+Y SPE+++   
Sbjct: 332 ILLDKTMKIKLTDFGTAKLIGREDENK------PYDLNTRSKSFVGTAEYVSPELLN--- 382

Query: 219 NSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFPQYSDRLKGLIHL 276
           ++ +D + DIWA G  L+++     PF+ + E        R QY     +   L+ LI  
Sbjct: 383 DNYVDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMILRDLIKQ 442

Query: 277 MLMEVPSQRPNICQV 291
           +L++ P QR  I Q+
Sbjct: 443 LLVKKPEQRLTILQI 457

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 132/276 (47%), Gaps = 31/276 (11%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPD-KQGLNTLRAEVDAMKLLKN 81
           +I++ +  G F  VY A        +      +K V + D  + ++ L  E+  +  L++
Sbjct: 21  EILQCIGRGNFGDVYKARY-----LATNEIVAIKVVNLEDTDEPIDLLAQEIFFLSELRS 75

Query: 82  NKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTV 141
                 YI ++  K+   +   ++++ME+C  G   + +    + +L E +   I+S+ +
Sbjct: 76  -----PYITNY--KTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVL 128

Query: 142 QGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDIL 201
            G+  +H  +   IHRDIK  N+L++ +G  K+ DFG VSG +   R    F        
Sbjct: 129 VGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF-------- 177

Query: 202 TNTTAQYRSPEMIDLYRNSP-IDEKSDIWALGVFLYKICYYTTPFEK--SGEAAILHSRY 258
              T  + +PE+ID  RN    +E +DIW+LG+ + ++     P +K  + +A +   + 
Sbjct: 178 -VGTPFWMAPEVID--RNKKGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKR 234

Query: 259 QYPSF-PQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
             P    ++S   K  +   L++ PSQRP   ++L+
Sbjct: 235 DPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 58/183 (31%), Positives = 83/183 (45%), Gaps = 24/183 (13%)

Query: 112  ERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGL 171
            E G +  F    L++ + E E   +  Q   G+  +H     ++HRDIK ENV++ + G 
Sbjct: 1155 ETGSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGC 1212

Query: 172  YKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIW 229
             K+ DFGS + V R P           D+   T   Y +PE++  D Y   P     DIW
Sbjct: 1213 VKLIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLEGDPYEGKP----QDIW 1257

Query: 230  ALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRP--- 286
            A+GV LY I Y   PF    E  IL    +       S+    LI ++L    S+RP   
Sbjct: 1258 AIGVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTVD 1315

Query: 287  NIC 289
            +IC
Sbjct: 1316 DIC 1318

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 74.3 bits (181), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 104/230 (45%), Gaps = 30/230 (13%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN 121
           D   +  ++ E+  +  LK   ++  Y  S+   +       ++++ME+C  G L   + 
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDT------SLWIIMEYCAGGSLRSLLR 112

Query: 122 TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H  +  +IHRDIK  NVLI+++G  K+CDFG  +
Sbjct: 113 ---PGKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAA 167

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKIC 239
            V +     Q             T  + +PE+I   +Y     D K DIW+LG+  Y+I 
Sbjct: 168 QVNQTSLRRQTM---------AGTPYWMAPEVIMEGVY----YDTKVDIWSLGITTYEIA 214

Query: 240 YYTTPF--EKSGEAAILHSRYQYPSFP--QYSDRLKGLIHLMLMEVPSQR 285
               P+   ++  A  L  + + P      YS  LK  I L L E P +R
Sbjct: 215 TGNPPYCDVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W
           (REAL)
          Length = 655

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 86/169 (50%), Gaps = 27/169 (15%)

Query: 90  DSHAAKSVNGI-AY-----EVFVLMEFCERGGLIDFMNTRL-------QSRLRESEILEI 136
           DSH    VN + AY     E++V+ME+ E G L D ++  +        S L ES+I  I
Sbjct: 428 DSHHENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAAVGSNDGKKSSALNESQISYI 487

Query: 137 MSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYV 196
           + +T QG+  +H     +IHRDIK +N+L++  GL K+ DFG    V    + S+    V
Sbjct: 488 VRETCQGLKFLH--GNNIIHRDIKSDNILLNSRGLVKITDFGFC--VELTEKRSKRATMV 543

Query: 197 QHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
                   T  + +PE+++       DEK D+W+LG+ L ++     P+
Sbjct: 544 -------GTPYWMAPEIVN---QKQYDEKVDVWSLGIMLIEMVEGEPPY 582

>YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}
           SPS1Putative protein serine/threonine kinase expressed
           at the end of meiosis and localized to the prospore
           membrane, required for correct localization of enzymes
           involved in spore wall synthesis
          Length = 490

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 97/196 (49%), Gaps = 24/196 (12%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++++ME+C  G   D +     + L E ++  I+ +   G+  +H  +   IHRDIK  N
Sbjct: 89  MWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLH--EQRKIHRDIKAAN 146

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +L++ +G+ K+ DFG VSG IR        + ++ D     T  + +PE++    +   +
Sbjct: 147 ILLNEEGMVKLGDFG-VSGHIR--------STLKRDTFVG-TPYWMAPEVVCCEVDG-YN 195

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHS-------RYQYPSFPQYSDRLKGLIHL 276
           EK+DIW+LG+  Y++     P  K     ++ +       + Q P    +SD  K  +  
Sbjct: 196 EKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGP----FSDAAKDFVAG 251

Query: 277 MLMEVPSQRPNICQVL 292
            L++ P+ RP+   +L
Sbjct: 252 CLVKTPADRPSAYNLL 267

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/278 (26%), Positives = 123/278 (44%), Gaps = 42/278 (15%)

Query: 31   GGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLN--TLRAEVDAMKL----LKNNKH 84
            G F  V+ A        +      +K+V VP K GL   T+   VDA++L    LK+  H
Sbjct: 1149 GSFGAVFLAM-----NITTGEMMAVKQVEVP-KYGLQNETVVNTVDALRLEVSTLKDLDH 1202

Query: 85   --VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQ 142
              +V Y+   A    NGI Y +F  +E+   G +   +  R+  R  +  I  +  Q +Q
Sbjct: 1203 LNIVQYLGFEAK---NGI-YSLF--LEYVAGGSVGSLI--RMYGRFDDILIRHLTIQVLQ 1254

Query: 143  GIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILT 202
            G++ +H     ++HRD+K +N+L+  DG+ K+ DFG +S      R S +  Y   ++  
Sbjct: 1255 GLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDFG-IS------RKSNDI-YSNSEMTM 1304

Query: 203  NTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPS 262
              T  + +PEM+D  +      K DIW+LG  + ++     P+      A +    Q  S
Sbjct: 1305 KGTVFWMAPEMVDTKQG--YSAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGQAKS 1362

Query: 263  --------FPQYSDRLKGLIHLMLMEVPSQRPNICQVL 292
                     P  S+  K  +       P +RP   ++L
Sbjct: 1363 APPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON}
            SSK22MAP kinase kinase kinase of the HOG1
            mitogen-activated signaling pathway; functionally
            redundant with, and homologous to, Ssk2p; interacts with
            and is activated by Ssk1p; phosphorylates Pbs2p
          Length = 1331

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 135/290 (46%), Gaps = 47/290 (16%)

Query: 27   YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPD----KQGLNTLRAEVDAMKLLKNN 82
            ++  G F QVY+A         N     +K + + D    K+    ++ E+  +++L N+
Sbjct: 1039 FIGGGTFGQVYSA-----INLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEML-NH 1092

Query: 83   KHVVSY--IDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMS-Q 139
             ++V Y  ++ H  K        V + ME+CE G L   ++     R+ +  + ++ + +
Sbjct: 1093 PNIVQYYGVEVHRDK--------VNIFMEYCEGGSLASLLD---HGRIEDEMVTQVYTFE 1141

Query: 140  TVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVI----RPPRNS--QEF 193
             ++G+A +H  Q  ++HRDIK EN+L+  +G+ K  DFG+   V+    R  RN+  Q+F
Sbjct: 1142 LLEGLAYLH--QSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDF 1199

Query: 194  NYVQHDILTNT--TAQYRSPEMIDLYRNSPIDEK---SDIWALGVFLYKICYYTTPFEK- 247
              V+   L     T  Y +PE I     S +  K    D+WALG  + ++     P+   
Sbjct: 1200 G-VETKSLNEMMGTPMYMAPETIS---GSAVKGKLGADDVWALGCVVLEMATGRRPWSNL 1255

Query: 248  SGEAAILHSRY-----QYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVL 292
              E AI++        Q P+  + +   +  +   L++ P+ R    ++L
Sbjct: 1256 DNEWAIMYHVAAGRIPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVELL 1305

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 127/274 (46%), Gaps = 30/274 (10%)

Query: 27  YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKHVV 86
           +L  GGFA+ +  +      ++    A   ++ +  ++    L +E+   K +++  ++V
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHF-NIV 139

Query: 87  SYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAA 146
            +ID     +       V++L+E C  G L+D +  R    L E E+    +Q V  +  
Sbjct: 140 QFIDCFEDDT------NVYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVKY 191

Query: 147 MHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTA 206
           MH  +  +IHRD+K+ N+        K+ DFG ++ V+    N +E  Y         T 
Sbjct: 192 MHSRR--VIHRDLKLGNIFFDKHYNLKIGDFG-LAAVL---ANDRERKYT-----VCGTP 240

Query: 207 QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSR-----YQYP 261
            Y +PE++   +++    + DIW+ GV +Y +     PF+ + E  I++ R     Y +P
Sbjct: 241 NYIAPEVLT-GKHTGHSYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGDYVFP 298

Query: 262 SFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEV 295
                S     LI  +L   P +RP++ ++++ V
Sbjct: 299 RDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 94/193 (48%), Gaps = 19/193 (9%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIE 162
           +V++  E+C    L D +   LQ R+  S  +E+ +Q V  +   H L    +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 163 NVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPI 222
           N+L+  +G  K+ DFG     +              + +  TT  Y +PE+I   R S  
Sbjct: 159 NILLDKNGNAKLTDFGFTRECM---------TKTSLETICGTTV-YMAPELIK--RESYD 206

Query: 223 DEKSDIWALGVFLYKICYYTTPFEKSGEAAI-LHSRYQYPSFPQ--YSDRLKGLIHLMLM 279
             K DIW+LGV LY +   + PF++  E         + P F     S+  K L+  +L 
Sbjct: 207 GFKIDIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLIKLLS 266

Query: 280 EVPSQRPNICQVL 292
           + P++RP++ ++L
Sbjct: 267 KDPNERPSMQEIL 279

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 118/269 (43%), Gaps = 28/269 (10%)

Query: 28  LTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDKQGLNTLRAEVDAMKLLKNNKH--- 84
           L  G ++ VY A +        A   C K+ I+ + + +  +  E + + LL +  H   
Sbjct: 16  LGHGSYSTVYKA-VDRSTGQLFAIKVCSKKHIISENK-VKYVTIEKNTLNLLAHGNHPGI 73

Query: 85  VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGI 144
           +  Y   H ++++       + +++F   G L+  + T  Q R  E+     M Q +  +
Sbjct: 74  IKLYYTFHDSENL-------YFVLDFAPGGELLQLLQT--QGRFNEAWTKHFMCQLIDAL 124

Query: 145 AAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNT 204
             +H  +  ++HRD+K EN+L+S +G   + DFG  S +      S   ++V        
Sbjct: 125 EYIHGCK--VVHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSSTSSFV-------G 175

Query: 205 TAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPS 262
           TA+Y SPE+  L +N   +  SDIWA+G  LY+    T PF    E A         Y  
Sbjct: 176 TAEYVSPEL--LLQNKS-NFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHW 232

Query: 263 FPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
               S  +  L+  +L+  P  R  + Q+
Sbjct: 233 IYMVSQHITDLVSKILVLDPDSRYTLPQI 261

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 81/180 (45%), Gaps = 22/180 (12%)

Query: 115  GLIDFMN-TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
            G ID  +    ++ + E E   I  Q V GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1245

Query: 174  VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWAL 231
            + DFGS + V   P           D+   T   Y +PE++  + Y   P     DIWA+
Sbjct: 1246 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAI 1290

Query: 232  GVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQV 291
            G+ LY + +   PF    E  IL    ++ +  + S+    LI  +L     +RP I  +
Sbjct: 1291 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1348

>Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W
           (REAL)
          Length = 1082

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 106/229 (46%), Gaps = 23/229 (10%)

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRES 131
           E  A++ L N+  VV    +   +S       ++ L+E+   G  +  M  +    L E+
Sbjct: 229 EKTALQKLNNSHSVVRLFSTFQDES------SLYFLLEYAPNGDFLSLM--KKNGSLDEN 280

Query: 132 EILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQ 191
                 +Q +  I  +H     +IHRDIK EN+L+  +   K+ DFG+   +     ++ 
Sbjct: 281 CACYYGAQIIDAIDYLH--SNGIIHRDIKPENILLDEEMRIKLTDFGTAKLLDSTVSSTS 338

Query: 192 EFNYVQHDILTNT-----TAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFE 246
           +  Y   D+ T +     TA+Y SPE+++   +S  D + DIWA G  L+++     PF+
Sbjct: 339 KQKY---DLSTRSKSFVGTAEYVSPELLN---DSFTDYRCDIWAFGCILFQMIAGKPPFK 392

Query: 247 KSGEAAILHS--RYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
            + E        + QY   P +   ++ L+  +L++   QR  I Q+ E
Sbjct: 393 ATNEYLTFQKVMKVQYAFTPGFPLIIRDLVKKILIKNLDQRLTISQIKE 441

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 96/196 (48%), Gaps = 24/196 (12%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++++ME+C  G L   +      ++ E  I  IM + +  +  +H  +  +IHRDIK  N
Sbjct: 88  LWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKVIH--KDNVIHRDIKAAN 142

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSP 221
           VLI+++G  K+CDFG  + + +     Q             T  + +PE+I   +Y    
Sbjct: 143 VLITNEGQVKLCDFGVAAQLNQTSLRRQTM---------AGTPYWMAPEVIMEGVY---- 189

Query: 222 IDEKSDIWALGVFLYKICYYTTPF--EKSGEAAILHSRYQYPSFPQ--YSDRLKGLIHLM 277
            D K DIW+LG+  Y+I     P+   ++  A  L  + + P   +  Y+ +LK  I L 
Sbjct: 190 YDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALC 249

Query: 278 LMEVPSQRPNICQVLE 293
           L E P +R +  ++L+
Sbjct: 250 LDEDPQERLSAEELLK 265

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 93/175 (53%), Gaps = 25/175 (14%)

Query: 73  VDAMKLLKNNKH--VVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRE 130
           ++ + ++K ++H  +V++IDS+  K       +++V+ME+ E G L D +   +   L E
Sbjct: 721 INEIIVMKGSRHENIVNFIDSYLMKG------DLWVVMEYMEGGSLTDVVTHCI---LTE 771

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
            +I  +  +T+ G+A +H     +IHRDIK +N+L+S +G  K+ DFG  + +       
Sbjct: 772 GQIGTVCKETLGGLAFLH--SKGVIHRDIKSDNILLSMNGDIKLTDFGFCAQI------- 822

Query: 191 QEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
            E +  +  ++   T  + +PE++      P   K DIW+LG+ + ++     P+
Sbjct: 823 NEVHLKRTTMV--GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 872

>KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} similar to
            uniprot|P53599 Saccharomyces cerevisiae YNR031C SSK2
            Suppressor of Sensor Kinase (SLN1) A MAP kinase kinase
            kinase activator of Pbs2p
          Length = 1551

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/311 (24%), Positives = 139/311 (44%), Gaps = 49/311 (15%)

Query: 27   YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPD----KQGLNTLRAEVDAMKLLKNN 82
            ++ SG F  VY+A           +   +K + + D    KQ   +L+ E+  M++L N+
Sbjct: 1264 FIGSGSFGTVYSAV-----NLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEIL-NH 1317

Query: 83   KHVVSY--IDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMS-Q 139
             ++V Y  ++ H  K        V + MEFCE   L   +      R+ +  + ++ + Q
Sbjct: 1318 PNIVQYYGVEVHRDK--------VNIFMEFCEGSSLASLLE---HGRIEDEMVTQVYTLQ 1366

Query: 140  TVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSV-----SGVIRPPRNSQEFN 194
             ++G+A +H  Q  ++HRDIK EN+L+  +G+ K  DFG+      +G  R   ++   +
Sbjct: 1367 LLEGLACLH--QSGVVHRDIKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKS 1424

Query: 195  YVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEK-SGEAAI 253
                D++   T  Y +PE +    +       DIW+LG  + ++     P+     E AI
Sbjct: 1425 TGGKDMI--GTPMYMAPETVTGQGHGKFG-SDDIWSLGCVVLEMVTGRRPWANLDNEWAI 1481

Query: 254  LHSRY-----QYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEPCPIRNF 308
            ++        Q+P+  + S   +  I   L++  ++R    ++L     L      IRN 
Sbjct: 1482 MYHVAAGHLPQFPTKSEISSAGRKFISRCLIQDANKRATAMELL-----LDPWISQIRNI 1536

Query: 309  YLLRAMGQNAQ 319
                A G NA+
Sbjct: 1537 ----AFGGNAE 1543

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/321 (23%), Positives = 139/321 (43%), Gaps = 66/321 (20%)

Query: 15  LTVGSHHAKIIKYLTSGGFAQVYTAEI----------SPPDPYSNANTACLKRVIVPDKQ 64
           +T+G     I K +  G FA V+ A +          SPP    N     + R  + +K+
Sbjct: 30  ITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSPP---LNFAIKIVSRSKLKNKK 86

Query: 65  GLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRL 124
            L  L  E+  +K + N+ H+V  ID     +      + +++ME+C  G L  F+  + 
Sbjct: 87  LLENLEIEIAILKKI-NHPHIVKLIDCERTTT------DFYLIMEYCALGDLT-FLIKKR 138

Query: 125 QSRLRESEILE--------------------IMSQTVQGIAAMHVLQPP-LIHRDIKIEN 163
              ++   +LE                    I++   Q  +A+  L+   L+HRDIK +N
Sbjct: 139 HELIKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRSKNLVHRDIKPQN 198

Query: 164 VL-----ISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQ--------YRS 210
           +L     I+++        G +     P     +F + +   L NT+          Y +
Sbjct: 199 LLLLTPLINYNDSKAFKKLGFIGIYELPILKIADFGFAR--FLPNTSMAETLCGSPLYMA 256

Query: 211 PEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAAIL------HSRYQYPSFP 264
           PE+++  +    + K+D+W++G  LY++CY T PF+ S    +       +++  +P++ 
Sbjct: 257 PEILNYQK---YNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNYI 313

Query: 265 QYSDRLKGLIHLMLMEVPSQR 285
           Q  + +K LI  +L   P +R
Sbjct: 314 QIQNDMKILISKLLTFDPQRR 334

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 100/199 (50%), Gaps = 29/199 (14%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIE 162
           +V++ +E+C    L D++   +  R+   E   + +Q V  +   H L    +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 163 NVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPI 222
           N+L+   G  K+ DFG         +N       Q + +  TT  Y +PE+  L R++  
Sbjct: 158 NILLDMQGNAKLADFGFTREC--ATKN-------QLETICGTTV-YMAPEL--LRRDTYD 205

Query: 223 DEKSDIWALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSF---PQYSDRLKG-----LI 274
             K DIW+LGV LY +   + PF++  E     +R ++      P Y++++       LI
Sbjct: 206 GFKIDIWSLGVILYTLINGSMPFDEEDE-----TRTEWKIINEEPDYNEKIFNANSIELI 260

Query: 275 HLMLMEVPSQRPNICQVLE 293
             +L++ P +RP++ ++L+
Sbjct: 261 KSLLIKDPKKRPSMTEILK 279

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 101/221 (45%), Gaps = 26/221 (11%)

Query: 69  LRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRL 128
           ++ EV  +  LK   +++ Y  S+   +       ++++M++C  G +   +      ++
Sbjct: 89  VQREVQFLSSLKQFPNIIRYFGSYLKDT------NLWIIMDYCAGGSIRTLLR---PGKI 139

Query: 129 RESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPR 188
            E  I  IM + +  IA  ++ +  +IHRDIK  NVL++++G  K+CDFG  + + +   
Sbjct: 140 DEKYIGIIMREIL--IALQYIHKDNVIHRDIKAANVLVTNEGKVKLCDFGVAAQLNQTKL 197

Query: 189 NSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEK- 247
             Q             T  + +PE+I     +  D K+DIW+LG+  Y+I     P+ + 
Sbjct: 198 RRQTM---------AGTPYWMAPEVI--MEGAYYDTKADIWSLGITAYEIATGNPPYCEI 246

Query: 248 ---SGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQR 285
                   I  S+        YS  LK  I L L E P +R
Sbjct: 247 EALRAMQLITKSKPARLEGRSYSTSLKEFIALCLDEDPKER 287

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 98/203 (48%), Gaps = 23/203 (11%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           V++LME+   G L   +  R      +      + Q    +  +H  Q  +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLL--RSHGPFNDVIASRFVFQIADALNYLHDKQ--IIHRDLKPEN 219

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +LI  + + K+ DFG     I  PR       V+   L  T   Y SPEMI   R+   D
Sbjct: 220 ILIGFNNVIKLTDFG---WSIINPRG------VKRKTLCGTI-DYLSPEMI---RSREYD 266

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAA----ILHSRYQYPSFPQYSDRLKGLIHLMLM 279
           +K D+WALGV  Y++   + PFE+  +      IL +  ++P     S  +K LI  +L 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPE--TVSHDVKDLISKLLK 324

Query: 280 EVPSQRPNICQVLEEVSRLQNEP 302
             PS+R ++  V++    ++N+P
Sbjct: 325 YNPSERISMRDVMKHPWIIRNKP 347

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 80/185 (43%), Gaps = 21/185 (11%)

Query: 112  ERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGL 171
            E G +  F     +  + E E   +  Q V  I  +H     ++HRDIK ENV++   G 
Sbjct: 931  ETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGF 988

Query: 172  YKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIW 229
             K+ DFGS + +   P           D+    T  Y +PE++    Y+  P     DIW
Sbjct: 989  VKLIDFGSAAYIKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIW 1033

Query: 230  ALGVFLYKICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNIC 289
            ALGV LY I Y   P+    E  IL    ++      S+    LI  +L     +RP I 
Sbjct: 1034 ALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTID 1091

Query: 290  QVLEE 294
            ++ E+
Sbjct: 1092 EIYED 1096

>Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W
           (REAL)
          Length = 660

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 78/150 (52%), Gaps = 21/150 (14%)

Query: 103 EVFVLMEFCERGGLIDFMNTRLQSR-------LRESEILEIMSQTVQGIAAMHVLQPPLI 155
           E++V+ME+ E G L D ++   +S        L ES++  I+ +T QG+  +H     +I
Sbjct: 452 ELWVIMEYMEGGCLTDILDAAAESSNGNKLSPLNESQMAYIVRETCQGLKFLH--NNKII 509

Query: 156 HRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMID 215
           HRDIK +N+L++  GL K+ DFG    +    + S+    V        T  + +PE+++
Sbjct: 510 HRDIKSDNILLNSQGLVKITDFGFCVELTE--KRSKRATMV-------GTPYWMAPEIVN 560

Query: 216 LYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
                  DEK D+W+LG+ L ++     P+
Sbjct: 561 ---QKGYDEKVDVWSLGIMLIEMIEGEPPY 587

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 130/299 (43%), Gaps = 37/299 (12%)

Query: 5   QISLYDPGTVLTVGSHHAKII-KYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDK 63
           +I  +  G++L  GS    ++ ++ T+G  A V     S     +  N++ +     PD 
Sbjct: 22  KIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGSNDPDL 81

Query: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTR 123
                 R E+  MKLL N+ +V+   D    KS       +++++E+ E+G L + +  R
Sbjct: 82  LPYGIER-EIIIMKLL-NHTNVLRLYDVWETKS------NLYMVLEYVEKGELFNLLVER 133

Query: 124 LQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGV 183
               L E+E +    Q + GI+  H L   ++HRD+K EN+L+ H    K+ DFG  +  
Sbjct: 134 --GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGMAA-- 187

Query: 184 IRPPRNSQEFNYVQHDILTNTTA---QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICY 240
                          D L  T+     Y +PE++        +  SD+W+ GV LY +  
Sbjct: 188 -----------LESKDKLLETSCGSPHYAAPEIVSGLPYHGFE--SDVWSCGVILYALLT 234

Query: 241 YTTPFE------KSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
              PF+      +S    +    Y+ P   + S   + LI  +L   P +R    ++L+
Sbjct: 235 GRLPFDEDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILK 293

>NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa]
           {ON} Anc_3.60
          Length = 790

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 116/244 (47%), Gaps = 31/244 (12%)

Query: 13  TVLTVGSHHAKIIKYLTSGGFAQVYTAE--ISPPDPYSN----ANTACLKRVIVPDKQGL 66
           T+ T  S + ++I+    G    VY AE    PP  +       +   +K++I+  +   
Sbjct: 493 TINTDPSPYFQMIEKAGQGASGSVYLAERIAIPPGEFDETPEVGDKVAIKQMILSKQPRK 552

Query: 67  NTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRL-- 124
             +  E+  MK  ++ K++V++++++          +++V+MEF E G L D +      
Sbjct: 553 ELIVNEILVMKDSRH-KNIVNFLEAYLKTE-----DDLWVVMEFMEGGSLTDIIENSPAT 606

Query: 125 ---QSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
               S L E +I  I+ +T QG+  +H     +IHRDIK +NVL+ ++   K+ DFG  +
Sbjct: 607 GSSSSPLTEPQIAYIVRETCQGLKFLHDKH--IIHRDIKSDNVLLDNNARVKITDFGFCA 664

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYY 241
            +    + S+    V        T  + +PE++   +    DEK D+W+LG+   ++   
Sbjct: 665 KLTD--QRSKRATMV-------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLES 712

Query: 242 TTPF 245
             P+
Sbjct: 713 EPPY 716

>NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa]
           {ON} Anc_3.60
          Length = 819

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 25/167 (14%)

Query: 90  DSHAAKSVNGI-AY-----EVFVLMEFCERGGLIDFM-----NTRLQSRLRESEILEIMS 138
           DSH    VN + AY     +++V+MEF E G L D +     +    S L ES+I  I+ 
Sbjct: 593 DSHHKNIVNFLEAYLKTEDDLWVVMEFMEGGSLTDIIENSPVDDTSHSPLTESQIAYIVR 652

Query: 139 QTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQH 198
           +T QG+  +H     +IHRDIK +NVL+  +G  K+ DFG  + +    + S+    V  
Sbjct: 653 ETCQGLKFLHDKH--IIHRDIKSDNVLLDMNGRVKITDFGFCAKLTD--QRSKRATMV-- 706

Query: 199 DILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
                 T  + +PE++   +    DEK D+W+LG+   ++     P+
Sbjct: 707 -----GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLESEPPY 745

>AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR073C
            (SSK22) and YNR031C (SSK2)
          Length = 1483

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 125/279 (44%), Gaps = 33/279 (11%)

Query: 27   YLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPD----KQGLNTLRAEVDAMKLLKNN 82
            ++  G F  VY+A           +   +K +   D    KQ   ++R E+  +++L N+
Sbjct: 1196 FIGGGSFGSVYSAV-----NLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEML-NH 1249

Query: 83   KHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMS-QTV 141
             +VV Y      +        V + ME+CE G L   +      R+ +  + ++ S Q +
Sbjct: 1250 PNVVQYYGVEVHRD------RVNIFMEYCEGGSLASLLA---HGRIEDEMVTQVYSLQML 1300

Query: 142  QGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDIL 201
            +G+A +H  +  + HRDIK EN+L+  +G+ K  DFG+    +     S++ N  QH   
Sbjct: 1301 EGLAYLH--ESGVDHRDIKPENILLDFNGIIKYVDFGAAK--VLASNGSKKLNLEQHMEG 1356

Query: 202  TNT--TAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEK-SGEAAILH--S 256
                 T  Y SPE I            DIW+LG  + ++     P+     + AI++  +
Sbjct: 1357 EKMIGTPMYMSPEAISGTGYGKFG-SDDIWSLGCVILEMVTGRRPWANLDNQWAIIYQVA 1415

Query: 257  RYQYPSFPQYSDRLKGLIHLM---LMEVPSQRPNICQVL 292
              Q P FP  ++  +  I  +   L++ P+QR    ++L
Sbjct: 1416 AGQIPMFPSKNEMSQAGIKFLSRCLIQDPNQRSTAVELL 1454

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 135/276 (48%), Gaps = 31/276 (11%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPD-KQGLNTLRAEVDAMKLLKN 81
           +I++ +  G F  VY A     D  SN   A +K V + D  + ++ L  E+  +  L++
Sbjct: 21  EILQCIGRGNFGDVYKAR----DLTSNEIVA-IKVVNLEDTDEPIDLLAQEIFFLSELRS 75

Query: 82  NKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTV 141
                 YI ++  K+   +   ++++ME+C  G   + +    + ++ E +   I+S+ +
Sbjct: 76  -----PYITNY--KTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVL 128

Query: 142 QGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDIL 201
            G+  +H  +   IHRDIK  N+L++ +G  K+ DFG VSG +   R    F        
Sbjct: 129 IGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF-------- 177

Query: 202 TNTTAQYRSPEMIDLYRNSP-IDEKSDIWALGVFLYKICYYTTPFEK--SGEAAILHSRY 258
              T  + +PE+ID  RN    +E +DIW+LG+ + ++     P +K  + +A +   + 
Sbjct: 178 -VGTPFWMAPEVID--RNKQGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKR 234

Query: 259 QYPSF-PQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
             P    ++S   +  +   L++ PSQRP   ++L+
Sbjct: 235 DPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {ON}
           Anc_3.60 YNL298W
          Length = 885

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 115/239 (48%), Gaps = 36/239 (15%)

Query: 23  KIIKYLTSGGFAQVYTAEIS--PP---------DPYSNANTACLKRVIVPDKQGLNTLRA 71
           ++I+    G    VY A+ S  PP         +P    +   +K++++  +     +  
Sbjct: 593 EMIEKAGQGASGSVYLAKRSALPPKEDKINQYDEPAKIGDKVAIKQMMLSKQPRKELIVN 652

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFM-----NTRLQS 126
           E+  MK  ++ K++V++++++          +++V+ME+ E G L D +     +  + S
Sbjct: 653 EILVMKDSRH-KNIVNFLEAYLKTE-----DDLWVVMEYMEGGSLTDIIENSPADESINS 706

Query: 127 RLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRP 186
            L ES+I  I+ +T QG+  +H     +IHRDIK +NVL+   G  K+ DFG  + +   
Sbjct: 707 PLTESQIAYIVRETCQGLKFLHDRH--IIHRDIKSDNVLLDTQGRVKITDFGFCAKLTD- 763

Query: 187 PRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF 245
            + S+    V        T  + +PE++   +    DEK D+W+LG+   ++     P+
Sbjct: 764 -QRSKRATMV-------GTPYWMAPEVV---KQREYDEKVDVWSLGIMTIEMLEGEPPY 811

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 101/202 (50%), Gaps = 27/202 (13%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           + +++E+   G    ++  + + RL+ES    + SQ V G+  MH     L+HRD+K+EN
Sbjct: 152 IGIVLEYASGGEFYKYI--QKKRRLKESVASNLFSQLVSGVYYMHCKG--LVHRDLKLEN 207

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQ-YRSPEMIDLYRNSPI 222
           +L+   G   + DFG V+          EF+     + T+  +  Y +PE++   R  P 
Sbjct: 208 LLLDKYGNLIITDFGFVN----------EFSKFSELMKTSCGSPCYAAPELVISTR--PY 255

Query: 223 D-EKSDIWALGVFLYKICYYTTPFE---KSGEAAILHSRYQYPS-----FPQY-SDRLKG 272
           +  K+DIW+ G+ L+ +     P++   K+ +   +   Y+Y +     FP+Y S   + 
Sbjct: 256 EARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYITTTPLKFPEYISPMARD 315

Query: 273 LIHLMLMEVPSQRPNICQVLEE 294
           L+  +L+  P +R  + Q+L+ 
Sbjct: 316 LLRNILIPYPQKRATLKQILKH 337

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 113/238 (47%), Gaps = 30/238 (12%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN 121
           D+  +  ++ EV  +  +K   ++  Y  S+   +       +++++E+C  G L   + 
Sbjct: 62  DEDEVEDVQREVQFLASMKQVPNITQYYGSYLKDTT------LWIIIEYCAGGSLRTLLR 115

Query: 122 TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H  +  +IHRD+K  NVLI++DG  K+CDFG  +
Sbjct: 116 ---PGKIDEKYIGVIMRELLIALKFIH--RDNVIHRDLKAANVLITNDGQVKLCDFGVAA 170

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKIC 239
            +        + N  +H +    T  + +PE+I   +Y     D K DIW+LG+  Y+  
Sbjct: 171 QL-------NQSNSRRHTMA--GTPYWMAPEVIMEGVY----YDTKVDIWSLGITTYEAA 217

Query: 240 YYTTPF--EKSGEAAILHSRYQYPSFP--QYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
               P+   ++  A  L ++ + P      YS  LK  I L L E P +R +  ++L+
Sbjct: 218 TGNPPYCEVEALRAMQLITKSKPPRLEGRSYSPLLKEFIALCLDEDPKERLSAEELLK 275

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 105/231 (45%), Gaps = 35/231 (15%)

Query: 72  EVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRES 131
           E+  MKLL N+ +V+   D      V   A ++++++E+ E+G L + +  R    L E+
Sbjct: 78  EIIIMKLL-NHPNVLRLYD------VWETAQDLYMVLEYVEKGELFNLLVQR--GPLPEN 128

Query: 132 EILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQ 191
           E +    Q + GI+  H L   ++HRD+K EN+L+ H    K+ DFG  +          
Sbjct: 129 EAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKLADFGMAA---------- 176

Query: 192 EFNYVQHDILTNTTA---QYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPF-EK 247
                  D L  T+     Y +PE++        +  SD+W+ GV LY +     PF E+
Sbjct: 177 ---LESKDKLLETSCGSPHYAAPEIVSGLPYHGFE--SDVWSCGVILYALLTGRLPFDEE 231

Query: 248 SGEA-----AILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLE 293
            G        +   +Y+ P   + S   + LI  +L   P QR    ++L+
Sbjct: 232 DGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282

>Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {ON}
           YDR523C (REAL)
          Length = 485

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 94/192 (48%), Gaps = 16/192 (8%)

Query: 104 VFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIEN 163
           ++++ME+C  G   D +     + L E ++  I+ Q   G+  +H  +   IHRDIK  N
Sbjct: 84  MWIVMEYCGGGSCSDLLKRNYVNGLPEEKVSFIIHQVTLGLKYLH--EQRKIHRDIKAAN 141

Query: 164 VLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPID 223
           +L++ +G+ K+ DFG VSG IR       F           T  + +PE++    +   +
Sbjct: 142 ILLNEEGMVKLGDFG-VSGHIRSTMKRDTF---------VGTPYWMAPEVVCCEVDG-YN 190

Query: 224 EKSDIWALGVFLYKICYYTTPFEKSGEAAILHS--RYQYPSFP-QYSDRLKGLIHLMLME 280
           EK+DIW+LG+  Y++     P  K     ++ +  + + P     +S+  K  +   L++
Sbjct: 191 EKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGSFSEAAKEFVAGCLVK 250

Query: 281 VPSQRPNICQVL 292
            P+ RP+   +L
Sbjct: 251 APADRPSAYDLL 262

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 120/288 (41%), Gaps = 40/288 (13%)

Query: 23  KIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVI----VPDKQGLNTLRAEVDAMKL 78
           +I + L  G F +VY     P      +   C  +V+    + +       + E+D    
Sbjct: 119 EIGRKLGKGKFGKVYCVRHKP------SGLICALKVMNKMEIVNFNVQKQFKREIDIQYH 172

Query: 79  LKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMNTRLQSRLRESEILEIMS 138
           L +      Y   H +K+V       +++ME+   G L   +  +    + +      + 
Sbjct: 173 LNHKNLTKLYAFFHDSKNV-------YLVMEYLIGGELYKLL--KKNGPMNDITASNYVY 223

Query: 139 QTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNSQEFNYVQH 198
           Q    +  MH  +  +IHRD+K EN+LI  +   K+ DFG     I  P N +       
Sbjct: 224 QMTDALNYMH--KRKIIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNNQKRKTLC-- 276

Query: 199 DILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYTTPFEKSGEAA----IL 254
                 T  Y SPE+I    +   DE  D+WALG+  Y++     PFE+  +      I 
Sbjct: 277 -----GTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIA 328

Query: 255 HSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEP 302
            S  ++P  P  S   + LI  +L  VPS+R N+ QV+      +N+P
Sbjct: 329 KSDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVMNHPWIEKNKP 374

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 106/230 (46%), Gaps = 30/230 (13%)

Query: 62  DKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCERGGLIDFMN 121
           D+  +  ++ EV  +  LK   ++  Y  S+   +       ++++ME+C  G L   + 
Sbjct: 73  DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDT------SLWIIMEYCAGGSLRSLLR 126

Query: 122 TRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVS 181
                ++ E  I  IM + +  +  +H  +  +IHRDIK  NVLI+++G  K+CDFG  +
Sbjct: 127 ---PGKIDEKYIGVIMRELLVALKYIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVAA 181

Query: 182 GVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMI--DLYRNSPIDEKSDIWALGVFLYKIC 239
            + +     Q             T  + +PE+I   +Y     D K DIW+LG+  Y+I 
Sbjct: 182 QLNQSTLRRQTM---------AGTPYWMAPEVIMEGVY----YDTKVDIWSLGITAYEIA 228

Query: 240 YYTTPF--EKSGEAAILHSRYQYPSFP--QYSDRLKGLIHLMLMEVPSQR 285
               P+   ++  A  L ++ + P      Y+  LK  I L L E P +R
Sbjct: 229 TGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 91/203 (44%), Gaps = 27/203 (13%)

Query: 56  KRVIVPDKQGLNTLRAEVDAMKLL--KNNKHVVSYIDSHAAKSVNGIAYEVFVLMEFCER 113
           K+V  P+K+    +  E++  K++   ++ H+V+  D+       G    +++++++C  
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHHNHIVALRDAFQW----GKESCIYMILDYCSN 125

Query: 114 GGLIDFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYK 173
             L   +  R    L E E  E+M Q   GI  +H+    +IH D+K+ N+L       K
Sbjct: 126 NSLQSILQYR--GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQLK 181

Query: 174 VCDFGSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRN--------SPIDEK 225
           +CDFGS       PR   E            T  Y +PE +  ++N          I   
Sbjct: 182 ICDFGSSFIATSSPRGPGEI---------MGTPYYLAPETVYTHKNINKSGMAILLISFP 232

Query: 226 SDIWALGVFLYKICYYTTPFEKS 248
            DIW++G+ LY + Y   PF KS
Sbjct: 233 IDIWSMGIVLYSLLYGINPFIKS 255

>Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054W
           (REAL)
          Length = 398

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/227 (28%), Positives = 106/227 (46%), Gaps = 32/227 (14%)

Query: 21  HAKIIKYLTSGGFAQVYTAEI---SPPDPYSNANTACLKRVIVPDKQGL--NTLRAEVDA 75
           + +II++L  G +  V + +    +PP     A  A  K   + +K+ L    +R E+  
Sbjct: 45  YYEIIQFLGKGAYGTVCSVKFKGQTPP-----AKIAVKKISNIFNKEILLKRAIR-ELKF 98

Query: 76  MKLLKNNKHVVSYIDSHAAKS--VNGIAYEVFVLMEFCERGGLIDFMNTRL---QSRLRE 130
           M   K +K++V+ ID     S   +G+         +C +  LID+   ++     +L E
Sbjct: 99  MNFFKGHKNIVNLIDLEIVSSSPYDGL---------YCYQE-LIDYDLAKVIHSSVQLSE 148

Query: 131 SEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSGVIRPPRNS 190
             I   + Q + G+  +H     +IHRD+K  N+L + +G  K+CDFG   G+       
Sbjct: 149 FHIKYFLYQILCGLKYIH--SADVIHRDLKPGNILCTLNGCLKICDFGLARGIHTEFFQC 206

Query: 191 QEFNYVQHDILTNTTA--QYRSPEMIDLYRNSPIDEKSDIWALGVFL 235
           Q  N      +TN  A   YR+PE+  L  N P D+  DIWA+G  L
Sbjct: 207 QTTNSAVQPHITNYVATRWYRAPEL--LLSNQPYDKAIDIWAVGCIL 251

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,993,284
Number of extensions: 3438784
Number of successful extensions: 13240
Number of sequences better than 10.0: 1884
Number of HSP's gapped: 12454
Number of HSP's successfully gapped: 1927
Length of query: 809
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 691
Effective length of database: 39,950,811
Effective search space: 27606010401
Effective search space used: 27606010401
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)