Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.225.699ON53753723310.0
Smik_9.235.699ON52753719530.0
YIL146C (ATG32)5.699ON52953718860.0
Suva_9.435.699ON51343415470.0
ZYRO0G06666g5.699ON5035126996e-85
TDEL0B022205.699ON4895066691e-80
CAGL0H06545g5.699ON4922134201e-44
SAKL0E14850g5.699ON4704003971e-41
KAFR0D022505.699ON5563533842e-39
KNAG0L021005.699ON4445213687e-38
TBLA0E020905.699ON7491463451e-33
NCAS0G002605.699ON5103223242e-31
AFR283W5.699ON4523963194e-31
KLTH0E01122g5.699ON4723933179e-31
Kwal_55.197165.699ON4673873063e-29
Ecym_40215.699ON4594043027e-29
KLLA0A00660g5.699ON5244372579e-23
KLLA0F12562g8.171ON70463800.39
TPHA0D045805.699ON470152780.69
KLLA0B06952g3.240ON89455742.1
Ecym_23538.171ON69072732.9
KLLA0D06633g8.624ON102360723.4
KLTH0H08096g8.171ON68871723.5
SAKL0H19448g8.171ON69172723.8
Ecym_63511.264ON796124714.6
Kpol_2001.735.699ON411135705.5
AFR179C8.171ON70072706.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.22
         (537 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   902   0.0  
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   756   0.0  
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   731   0.0  
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   600   0.0  
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   273   6e-85
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   262   1e-80
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...   166   1e-44
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   157   1e-41
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...   152   2e-39
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....   146   7e-38
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...   137   1e-33
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...   129   2e-31
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   127   4e-31
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   126   9e-31
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   122   3e-29
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   120   7e-29
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...   103   9e-23
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    35   0.39 
TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON}             35   0.69 
KLLA0B06952g Chr2 (606694..609378) [2685 bp, 894 aa] {ON} some s...    33   2.1  
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    33   2.9  
KLLA0D06633g Chr4 complement(568539..571610) [3072 bp, 1023 aa] ...    32   3.4  
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    32   3.5  
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    32   3.8  
Ecym_6351 Chr6 complement(681995..684385) [2391 bp, 796 aa] {ON}...    32   4.6  
Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...    32   5.5  
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    32   6.4  

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/537 (84%), Positives = 453/537 (84%)

Query: 1   MVLDYPQRETKGXXXXXXXXXXXXXXIRPSSEVEAGEDKGLLDPHLSVLELLGKTGHSPS 60
           MVLDYPQRETKG              IRPSSEVEAGEDKGLLDPHLSVLELLGKTGHSPS
Sbjct: 1   MVLDYPQRETKGSSSKNMAPNSSSMNIRPSSEVEAGEDKGLLDPHLSVLELLGKTGHSPS 60

Query: 61  PMGHSLVTSIDISSHHYVNDSISGSWQAIHPLDLGASFVPERSSSQTTNGSILSSSDTSX 120
           PMGHSLVTSIDISSHHYVNDSISGSWQAIHPLDLGASFVPERSSSQTTNGSILSSSDTS 
Sbjct: 61  PMGHSLVTSIDISSHHYVNDSISGSWQAIHPLDLGASFVPERSSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQXXXXX 180
                  APAADIINIIKQGQEGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQ     
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQDDDDN 180

Query: 181 XXXXXXXXGAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP 240
                   GAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP
Sbjct: 181 NVDDDYDDGAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP 240

Query: 241 KEHQSLFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI 300
           KEHQSLFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI
Sbjct: 241 KEHQSLFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI 300

Query: 301 QVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYAXXXXXXXXXXXXXII 360
           QVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYA             II
Sbjct: 301 QVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYAEDGDNDDEDNDDEII 360

Query: 361 HTNSRSYYRXXXXXXXXXXXXXXXXXXXXXXQRSLTRWFTWGVSITIGISFGCCVTYFAT 420
           HTNSRSYYR                      QRSLTRWFTWGVSITIGISFGCCVTYFAT
Sbjct: 361 HTNSRSYYRNKKANSSKKKSFKSNKKPKKKKQRSLTRWFTWGVSITIGISFGCCVTYFAT 420

Query: 421 AAYDHQTGKSFNXXXXXXXXXXXXXXYHDTVNTPATTSTSSGEQFLWFDKGTLQINFHSD 480
           AAYDHQTGKSFN              YHDTVNTPATTSTSSGEQFLWFDKGTLQINFHSD
Sbjct: 421 AAYDHQTGKSFNLRSSILTSLLSLDSYHDTVNTPATTSTSSGEQFLWFDKGTLQINFHSD 480

Query: 481 GFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLENLNKNSDFSLDESNRILALGYILL 537
           GFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLENLNKNSDFSLDESNRILALGYILL
Sbjct: 481 GFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLENLNKNSDFSLDESNRILALGYILL 537

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/537 (72%), Positives = 411/537 (76%), Gaps = 10/537 (1%)

Query: 1   MVLDYPQRETKGXXXXXXXXXXXXXXIRPSSEVEAGEDKGLLDPHLSVLELLGKTGHSPS 60
           MVL+YPQRE K               I   S+ +A ED+GLLDPHLSVLELLGKTGHSPS
Sbjct: 1   MVLNYPQREIKESSSKDMAPTSSSMDICSRSDAQAEEDRGLLDPHLSVLELLGKTGHSPS 60

Query: 61  PMGHSLVTSIDISSHHYVNDSISGSWQAIHPLDLGASFVPERSSSQTTNGSILSSSDTSX 120
           PMG SLVTSIDIS H  VNDSISGSWQAI PLDLGASF+PER SSQTTNGSILSSSDTS 
Sbjct: 61  PMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQXXXXX 180
                  APAADIINIIKQGQEG +VTS S PFRQLHKVISLP+P++ +T Y EQ     
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGTNVTSSSHPFRQLHKVISLPIPSREKTPYKEQDINDD 180

Query: 181 XXXXXXXXGAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP 240
                   GAYEEDS TITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP
Sbjct: 181 ED------GAYEEDSVTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP 234

Query: 241 KEHQSLFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI 300
           KE+QSLFELPKYHDS  FPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI
Sbjct: 235 KEYQSLFELPKYHDSATFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI 294

Query: 301 QVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYAXXXXXXXXXXXXXII 360
           QVKNVLKSFLRNKLIKLL+PPVVVTNR+DLKKMFQRLQDLSLEYA               
Sbjct: 295 QVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRLQDLSLEYAEDENEEGDDDET--- 351

Query: 361 HTNSRSYYRXXXXXXXXXXXXXXXXXXXXXXQRSLTRWFTWGVSITIGISFGCCVTYFAT 420
            T SRSYYR                      QR  T WFTWG+SITIGISFGCCVTYF T
Sbjct: 352 -TKSRSYYRYKKANNSKRKSPKSNKKPKKKKQRFFTSWFTWGISITIGISFGCCVTYFVT 410

Query: 421 AAYDHQTGKSFNXXXXXXXXXXXXXXYHDTVNTPATTSTSSGEQFLWFDKGTLQINFHSD 480
           AAYDHQT KS +                DTVNTPAT S SS E FLWFDKGTLQINFH D
Sbjct: 411 AAYDHQTVKSLSLRSSLLTSMLSLDSSSDTVNTPATASPSSSEHFLWFDKGTLQINFHLD 470

Query: 481 GFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLENLNKNSDFSLDESNRILALGYILL 537
           G IMKSL+VIK+TW KMN FVL+ALSRPL+FLENLN++SDFS+DESNRILALGYILL
Sbjct: 471 GLIMKSLSVIKETWVKMNDFVLHALSRPLSFLENLNRSSDFSIDESNRILALGYILL 527

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/537 (70%), Positives = 410/537 (76%), Gaps = 8/537 (1%)

Query: 1   MVLDYPQRETKGXXXXXXXXXXXXXXIRPSSEVEAGEDKGLLDPHLSVLELLGKTGHSPS 60
           MVL+Y QRE KG              I   SE + GEDKGLLDPHLSVLELL KTGHSPS
Sbjct: 1   MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS 60

Query: 61  PMGHSLVTSIDISSHHYVNDSISGSWQAIHPLDLGASFVPERSSSQTTNGSILSSSDTSX 120
           PMG +LVTSIDIS +H VNDSISGSWQAI PLDLGASF+PER SSQTTNGSILSSSDTS 
Sbjct: 61  PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQXXXXX 180
                  APAADIINIIKQGQEGA+V SPS PF+QL K+ISLPLP K +T + EQ     
Sbjct: 121 EEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGD 180

Query: 181 XXXXXXXXGAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP 240
                    A+EEDS TITKSLTSSTNSFVMPKLSL+QKNPVFRLLILGRTGS+FYQSIP
Sbjct: 181 EDE------AFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIP 234

Query: 241 KEHQSLFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI 300
           KE+QSLFELPKYHDS  FPQYTGI+IIFQELREMVSLLNRIVQYSQGKP+IPICQPGQ I
Sbjct: 235 KEYQSLFELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVI 294

Query: 301 QVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYAXXXXXXXXXXXXXII 360
           QVKNVLKSFLRNKL+KLL+PPVVVTN+RDLKKMFQRLQDLSLEY               I
Sbjct: 295 QVKNVLKSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEA--I 352

Query: 361 HTNSRSYYRXXXXXXXXXXXXXXXXXXXXXXQRSLTRWFTWGVSITIGISFGCCVTYFAT 420
           HT SRSY R                      Q+  T WFTWG+SITIGISFGCCVTYF T
Sbjct: 353 HTKSRSYCRNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVT 412

Query: 421 AAYDHQTGKSFNXXXXXXXXXXXXXXYHDTVNTPATTSTSSGEQFLWFDKGTLQINFHSD 480
           AAY+HQT KS +                DT+NTPAT S SS EQFLWFDKGTLQINFHSD
Sbjct: 413 AAYEHQTVKSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSD 472

Query: 481 GFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLENLNKNSDFSLDESNRILALGYILL 537
           GFIMKSLT+IK+TW KMN FVL+ALS+PL FLENLNK+S+FS+DESNRILALGYILL
Sbjct: 473 GFIMKSLTIIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL 529

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/434 (71%), Positives = 329/434 (75%), Gaps = 3/434 (0%)

Query: 1   MVLDYPQRETKGXXXXXXXXXXXXXXIRPSSEVEAGEDKGLLDPHLSVLELLGKTGHSPS 60
           MVLDY  RETKG              IRP SE +A EDKGLLDPHLSVLELLGKTG SPS
Sbjct: 1   MVLDYQHRETKGSSSKNMAPNSSSMNIRPRSEGQAEEDKGLLDPHLSVLELLGKTGSSPS 60

Query: 61  PMGHSLVTSIDISSHHYVNDSISGSWQAIHPLDLGASFVPERSSSQTTNGSILSSSDTSX 120
           P+G SLVTSIDIS+HH V D+ISGSWQ I PLDLGASF+PER SSQTTNGSILSSSDTS 
Sbjct: 61  PLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGASFIPERCSSQTTNGSILSSSDTSE 120

Query: 121 XXXXXXXAPAADIINIIKQGQEGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQXXXXX 180
                  APAADIINIIKQGQ+G SVTSPS PF+QLH VISLP+P + RT YGEQ     
Sbjct: 121 EEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQLHTVISLPMPPRERTFYGEQEDVVC 180

Query: 181 XXXXXXXXGAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIP 240
                   G YEEDS TITKSLTSSTNSFVMPKLSLS+KNPVFRLLILGRTG+NFYQS P
Sbjct: 181 IDNDDDN-GMYEEDSVTITKSLTSSTNSFVMPKLSLSRKNPVFRLLILGRTGTNFYQSTP 239

Query: 241 KEHQSLFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTI 300
           KE+QSLFELPK HDST FPQYTGI+I+FQELREMVSLLNRIV+Y+QGKPIIPICQPGQTI
Sbjct: 240 KEYQSLFELPKSHDSTIFPQYTGIVIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTI 299

Query: 301 QVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYA--XXXXXXXXXXXXX 358
           QVKNVLKSFL+N LIKLLYPPVV TNR+DLKKMFQRLQDLSLEY                
Sbjct: 300 QVKNVLKSFLKNSLIKLLYPPVVATNRKDLKKMFQRLQDLSLEYVEDEKNEDEDEDNDDE 359

Query: 359 IIHTNSRSYYRXXXXXXXXXXXXXXXXXXXXXXQRSLTRWFTWGVSITIGISFGCCVTYF 418
           II   SRSYYR                      QRS TRWFTWGVSITIGISFGCCVTYF
Sbjct: 360 IIQPYSRSYYRSKKGGSSKKKSSKSNKKSKKKKQRSSTRWFTWGVSITIGISFGCCVTYF 419

Query: 419 ATAAYDHQTGKSFN 432
            TAAYDHQT +S N
Sbjct: 420 VTAAYDHQTIRSLN 433

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  273 bits (699), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 182/512 (35%), Positives = 253/512 (49%), Gaps = 41/512 (8%)

Query: 37  EDKGLLDPHLSVLELLGKTGHS-PSPMGHSLVTSI---DISSHHYVNDSISGSWQAIHPL 92
           E + +LDPHLSVLELL +   + P       V+ I      +    N SIS SWQ IH  
Sbjct: 22  ERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAGTTGTGNGSISQSWQTIHRN 81

Query: 93  DLGASFVPERSSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGASVTSPSRP 152
           D   S VPER  SQ T   ILSSSDTS        +P+A  ++           T     
Sbjct: 82  DSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSA--VHQQLHATPPQKHTKSLED 139

Query: 153 FRQLHKVISLPLPAKGRTSYGEQXXXXXXXXXXXXXGAYEEDSGTITKSLTSSTNSFVMP 212
           +R L+  I L LP                          E+D+ TITKSL SS+NSF+MP
Sbjct: 140 YRSLNVGIPLVLPEDSNNIN-----NNNKNGSTTGSNGEEDDNDTITKSLNSSSNSFIMP 194

Query: 213 KLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTAFPQYTGIIIIFQELR 272
           KLSLSQK   FR+L+LGR G  FY SIPK++Q +FELP+ HD   F QYTGI+++FQEL+
Sbjct: 195 KLSLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELK 254

Query: 273 EMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKK 332
           EMVSLLNR+ Q +  +P+IP+CQ GQ  QV+N+L+S L+N+L+ LLYPPVVV N+ DL  
Sbjct: 255 EMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLG 314

Query: 333 MFQRLQDLSLEYAXXXXXXXXXXXXXIIHTNSRSYYRXXXXXXXXXXXXXXXXXXXXXXQ 392
           MF+ LQ+LS   +                   RS  R                       
Sbjct: 315 MFRFLQELSKTVSDNSDMDAEEPNNGSKRL-KRSLQRKKKKFIETSAERNGRPHKKRHNN 373

Query: 393 RSLTRWFTWGVSITIGISFGCCVTYFATAAYDHQTGKSFNXXXXXXXXXXXXXXYHDTVN 452
             + RW  WGVS+T+G+  G C+++  ++ +   T                         
Sbjct: 374 EKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLG-------------------- 413

Query: 453 TPATTSTSSGEQFLWFDKGTL---QINFHSDGFIMKSLTVIKDTWSKMNVFVLNALSRPL 509
            P    + S + F+ FD+  L   +++  SD     +L + K    + N+ V   L R L
Sbjct: 414 -PVDPESVSKDLFV-FDRQELKLGEMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHL 471

Query: 510 NFLENLNKNSDF----SLDESNRILALGYILL 537
           + +E +   +      S + +NR+LALGY++L
Sbjct: 472 SCMERIGPANCLEWPTSDEHTNRVLALGYVML 503

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  262 bits (669), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 189/506 (37%), Positives = 265/506 (52%), Gaps = 38/506 (7%)

Query: 32  EVEAGEDKGLLDPHLSVLELLGKTGHSPSPMGHSLVTSIDISSHHYVNDSISGSWQAIHP 91
           E  A E K LLDPHLSVLELL +TG +   +G  +  + D+++     +SIS SWQAIH 
Sbjct: 22  ETTAFEKKSLLDPHLSVLELLERTGDTQR-VGRGVEKADDMAN---TTNSISSSWQAIHR 77

Query: 92  LDLGASFVPERSSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGASVTSPSR 151
            D   + VPER SSQ     ILSSSDTS        +P         Q Q+      P  
Sbjct: 78  NDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQ-----PPRL 132

Query: 152 PFRQLHKVISLPLPAKGRTSYGEQXXXXXXXXXXXXXGAYEEDSGTITKSLTSSTNSFVM 211
           PF+    VI   LPA+ +   G+                 E D  T+TKSL++S+NSFVM
Sbjct: 133 PFKLDVPVI---LPARDQEPSGQTQTPDNDD---------ERDDETLTKSLSNSSNSFVM 180

Query: 212 PKLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTAFPQYTGIIIIFQEL 271
           PKLSLSQK+   R+LILGR G  FYQSIPK +Q  FEL +  D + F Q+TGI+I+FQEL
Sbjct: 181 PKLSLSQKSHKLRILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEFRQFTGILIVFQEL 240

Query: 272 REMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNRRDLK 331
           +EMVSLLNR+ Q +  +P+IP+CQ GQ  QV+NVL+S L++KLI LLYPPVV++N  DL 
Sbjct: 241 KEMVSLLNRVCQCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLN 300

Query: 332 KMFQRLQDLSLEYAXXXXXXXXXXXXXIIHTNSRSYYRXXXXXXXXXXXXXXXXXXXXXX 391
            M++ L DLS   +             ++    +  ++                      
Sbjct: 301 NMYRFLLDLSKTISDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKRRSKE 360

Query: 392 QRSLTRWFTWGVSITIGISFGCCVTYFATAAYDHQTGKSFNXXXXXXXXXXXXXXYHDTV 451
            + + +W  WG+S+T+G+  G C++YFA++     + KS                 +D V
Sbjct: 361 TK-INKWIVWGISLTVGVGVGYCMSYFASSGLISMSAKSI--------ASINGCRPNDNV 411

Query: 452 NTPATTSTSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSKMNVFVLNALSRPLNF 511
                +S   GE    +D   L+  F    +++K  T+ +  W+ M  F++  L  P + 
Sbjct: 412 VVFDDSSLGMGE----YDHD-LENPFAHALYLLKQ-TLKQWNWA-MKQFLMKHLHLPESS 464

Query: 512 LENLNKNSDFSLDESNRILALGYILL 537
             + N     + D SNR+LALGYILL
Sbjct: 465 -SSTNYKEWGAEDNSNRVLALGYILL 489

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score =  166 bits (420), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/213 (38%), Positives = 120/213 (56%), Gaps = 12/213 (5%)

Query: 209 FVMPKLSLSQK-NPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTAFPQYTGIIII 267
           FVMPKLSL+ K +   +LL++GR    F+Q IP+E++  F + +  D + F  Y GI+I+
Sbjct: 195 FVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIV 254

Query: 268 FQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNR 327
           FQEL+E V++LNRIVQY+  KPIIPICQPGQ I+VKN+LKSFL+N  I L YPPV + N 
Sbjct: 255 FQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIANE 314

Query: 328 RDLKKMFQRLQDLSLEYAXXXXXXXXXXXXXIIHTNSRSYYRXXXXXXXXXXXXXXXXXX 387
           + ++K+F+    L  +                +   +  Y +                  
Sbjct: 315 KSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSDETSGYRKNNRRKKHGGKPST----- 369

Query: 388 XXXXQRSLTRWFTWGVSITIGISFGCCVTYFAT 420
                 + ++W TWG+S+TIG+S G   TY  T
Sbjct: 370 ------NYSKWITWGISLTIGVSIGYYATYMIT 396

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  157 bits (397), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 117/400 (29%), Positives = 189/400 (47%), Gaps = 70/400 (17%)

Query: 37  EDKGLLDPHLSVLELLGKTG--------HSPSPMGHSLVTSID--ISSH----HYVNDSI 82
           + + +LDPH SVL+LL + G         + S +   L ++ +  +S H      +N SI
Sbjct: 27  QKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQSI 86

Query: 83  SGSWQAIHPLDLGA-SFVPERSSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQ 141
           S SWQ+I  +D    + + + SSSQ     ILSSSDTS                     +
Sbjct: 87  SDSWQSIKMVDYSILNSLHDTSSSQAVG--ILSSSDTSE--------------------E 124

Query: 142 EGASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQXXXXXXXXXXXXXGAYEEDSG-TITK 200
           E   + SPS   +Q+        P     S+  Q             G  EED   T+T 
Sbjct: 125 ELDHLNSPSPSSQQV-------FPNGPPISFQTQAGVLTASATLPNPGVLEEDDNETVTV 177

Query: 201 SLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTA--F 258
           SL +S+NSFVMP+LSLSQ++  F +L++G+    F+ ++PK +Q +F++  +   +A   
Sbjct: 178 SLAASSNSFVMPQLSLSQRSHRFEILVVGKPARKFWNNVPKMYQKMFDIGDFESISAPKV 237

Query: 259 PQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLL 318
             YT ++IIFQ+ +E+  +L+ +V    GK IIPICQ GQ  Q+ ++L+ F++ K I+L+
Sbjct: 238 SHYTAVMIIFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLM 297

Query: 319 YPPVVVTNRRDLKKMFQRLQDLSLEYAXXXXXXXXXXXXXIIHTNSRSYYRXXXXXXXXX 378
           + P V++N +++ K+ + L  LS E                      S Y          
Sbjct: 298 FQPTVMSNHQEIHKLLRYLHRLSTEI--------------------DSGYETDETHLKVR 337

Query: 379 XXXXXXXXXXXXXQRSLTRWFTWGVSITIGISFGCCVTYF 418
                             RW  WG+S+T+G+  GCC+++ 
Sbjct: 338 KRKKTHKKKSKGTS---NRWVIWGLSLTVGVGIGCCISFI 374

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score =  152 bits (384), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/353 (27%), Positives = 170/353 (48%), Gaps = 44/353 (12%)

Query: 209 FVMPKLSLSQKNP------VFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTAFPQYT 262
           F+MP+LSL++K         FR+LI+GR  S  ++ IP + Q+LF+L K +D   + ++T
Sbjct: 224 FIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQNLFQLQKSYDINEYQKFT 283

Query: 263 GIIIIFQELREMVSLLNRIVQYSQGK-PIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPP 321
            I+++ QE RE++SLLNRI +  + K P+I IC+    +Q KNVLKS+LRN LI LLY P
Sbjct: 284 AILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDLITLLYQP 343

Query: 322 VVVTNRRDLKKMFQRLQDLSLEYAXXXXXXXXXXXXXIIHTNSRSY-------------- 367
            V++N  +L +M   L++ S+++              + +  +R+               
Sbjct: 344 FVISNTEELDRMLVFLKETSIKFYEQAYNPKIQIKEKVPNDGNRNAPTSSDLTLSKDRVK 403

Query: 368 ---YRXXXXXXXXXXXXXXXXXXXXXXQRSLTRWFTWGVSITIGISFGCCVTYFATAAYD 424
              +R                           +W  WG+S++IG+  G C++YF ++ + 
Sbjct: 404 NDKHRHTKGDGSGGSKKGNEHDRKPKENEEYNKWIIWGISLSIGVGIGYCISYFGSSPWS 463

Query: 425 HQTGKSFNXXXXXXXXXXXXXXYHDTVNTPATTSTSSGEQFLWFDKGTLQINFHSDGFIM 484
               + FN                D+++       S+    L  D      +  +  +  
Sbjct: 464 SLV-QYFNPES-------------DSISATVPVPLSNESFVLLHDSDN---DSETKKYFF 506

Query: 485 KSLTVIKDTWSKMNVFVLNALSRPLNFLENLNKNSDFSLDESNRILALGYILL 537
           KS+  +K + +K+ V + + + +PLN    LN     + D+++ +LALGYIL+
Sbjct: 507 KSINFLKYSINKVKVIIKDTIRKPLNAFSYLN---GLNTDDASSLLALGYILI 556

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score =  146 bits (368), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 139/521 (26%), Positives = 231/521 (44%), Gaps = 96/521 (18%)

Query: 35  AGEDKGLLDPHLSVLELLGKT----GHSPSPMGHSLVTSIDISSHHYVNDSISGSWQAIH 90
           +G    +LDPHLSVLELL K+    GH+ +P       +  I         +S SW  + 
Sbjct: 2   SGHANSVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQ--------LSESWCTVE 53

Query: 91  PLDLGASFVPERSSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGASVTSPS 150
             +L A    ERS+SQ TN  +LSSSDTS        +P       +         T  +
Sbjct: 54  RDELSAM---ERSASQQTNNGVLSSSDTSEEGEPEQGSPGDGEGGGVAD-------TRMA 103

Query: 151 RPFRQLHKVISLPLPAKGRTSYGEQXXXXXXXXXXXXXGAYEEDSGTITKSLTSSTNSFV 210
           RP   L    S                              ++DS T++KSLTSS+NSF+
Sbjct: 104 RPAMSLQSTSS-------------------------TLDGVDDDSATVSKSLTSSSNSFI 138

Query: 211 MPKL-----------SLSQKNPVFRLLILGRTGSNFYQ-SIPKEHQSLFELPK-YHDSTA 257
           MPKL           S + +   F++ +LGR    F Q ++P++ +  FEL    HD   
Sbjct: 139 MPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQ 198

Query: 258 FPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKL 317
                GI+I+ QE+RE++SLLNR+       P++ +    + +QVKNVL++F R +L+ L
Sbjct: 199 CADRQGILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRLVSL 258

Query: 318 LYPPVVVTNRRDLKKMFQRLQDLSLEYAXXXXXXXXXXXXXIIHTNSRSYYRXXXXXXXX 377
           L+PPV ++N   L KMF  + +L+ +               +IH + ++           
Sbjct: 259 LHPPVPLSNNEALDKMFHFVDNLARQ----------QEPAGVIHNDPQT-----TQEQHP 303

Query: 378 XXXXXXXXXXXXXXQRSLTRWFTWGVSITIGISFG-CCVTYFATAAYDHQTGKSFNXXXX 436
                         + +  RW  WGVSI++GI  G  CV+Y  +++        FN    
Sbjct: 304 DHNEDDPHRGPSKPEGTFKRWLLWGVSISLGIGAGYYCVSYVVSSSM---CVSCFN---- 356

Query: 437 XXXXXXXXXXYHDTVNTPATTSTSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSK 496
                     +  T +T A T++++           +  +  S   +   L+++K++  +
Sbjct: 357 ----------FRHTDHTLAATTSTAAAAAAAATPSGIDHDADSHTTLRHCLSIVKNSLKR 406

Query: 497 MNVFVLNALSRPLNFLENLNKNSDFSLDESNRILALGYILL 537
              FV  A+ +P ++   ++++ ++ L + NR L LGY ++
Sbjct: 407 ATAFVKQAMHKPFHY---IDRSQEWHLHDPNRFLQLGYAVI 444

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score =  137 bits (345), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/146 (47%), Positives = 98/146 (67%), Gaps = 2/146 (1%)

Query: 198 ITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGS-NFYQSIPKEHQSLFELPKYHDST 256
           +TKS+TSS+NSF+MPKLS +     FR+LILG   +  FYQ+IP  ++ LFELP  +   
Sbjct: 325 LTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELPPNNFDY 384

Query: 257 AFPQYTGIIIIFQELREMVSLLNRIVQYSQGK-PIIPICQPGQTIQVKNVLKSFLRNKLI 315
            F  Y GI I+  +L +  S+LN+I +YS  K PIIPIC+ GQ  +VKN+LK +++ K +
Sbjct: 385 NFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKTKDL 444

Query: 316 KLLYPPVVVTNRRDLKKMFQRLQDLS 341
            LLYPP+V TNR  +  ++  L DLS
Sbjct: 445 SLLYPPIVGTNRDGMNTLYLHLNDLS 470

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 9/31 (29%), Positives = 20/31 (64%)

Query: 393 RSLTRWFTWGVSITIGISFGCCVTYFATAAY 423
           + L +   W VS+++G+  G C++Y+A+  +
Sbjct: 608 KKLKKIIYWTVSLSVGVGLGFCLSYYASTIF 638

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 161/322 (50%), Gaps = 66/322 (20%)

Query: 39  KGLLDPHLSVLELLGKTGHSPSPMGHSLVTSIDISSHHYVNDSISGSWQAIH-PLDLGAS 97
           K LLDPHLSVLE+L +  +          T ++ SS       IS SWQ I  P D  + 
Sbjct: 36  KSLLDPHLSVLEMLERKDND---------TVMEASSR------ISRSWQNIESPAD--SK 78

Query: 98  FVPERSSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGAS--VTSPSRPFRQ 155
            +    SSQ +N   + SS +             D IN +    EG+S    +PS     
Sbjct: 79  QLLSAKSSQVSNLVSILSSSSDTSD------EEVDRINSLNSAGEGSSKNYNNPS----P 128

Query: 156 LHKVISLPLPAKGRTSYGEQXXXXXXXXXXXXXGAYEEDSG---TITKSLTSST---NSF 209
           L   I LP                          A + D G   TITKSLTSS+   NSF
Sbjct: 129 LQNPIYLP--------------------EFTDVTAGDNDDGIASTITKSLTSSSTISNSF 168

Query: 210 VMPKLSLSQKNPV---FRLLILGRTGSNFYQSIPKEHQSLFELPKYHDS---TAFPQYTG 263
           VMP LSLS        F++LI GR G +FY++IPK++Q LF +P   ++        +T 
Sbjct: 169 VMPTLSLSSSQSQQRKFQILIFGRLGPSFYRTIPKQYQYLFHVPNQLNTLTRNEMDNFTA 228

Query: 264 IIIIFQELREMVSLLNRIVQYSQGKPIIPI----CQPGQTIQVKNVLKSFLRNKLIKLLY 319
            +IIF+EL+E+VSLLNRI +    K + P     CQPGQ I+VK++LK FL+N  + LL 
Sbjct: 229 FLIIFEELKELVSLLNRISEELSFKKVPPPIIPICQPGQKIKVKSILKYFLKNNFVTLLS 288

Query: 320 PPVVVTNRRDLKKMFQRLQDLS 341
           P +++ + R L KMF+ +Q +S
Sbjct: 289 PIIIINDERALLKMFKTMQSIS 310

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 60/147 (40%), Gaps = 23/147 (15%)

Query: 397 RWFTWGVSITIGISFGCCVTYFATAAYDHQTGKSFNXXXXXXXXXXXXXXYHDTVNTPAT 456
           +W  W +S+T+G   G  ++Y             FN               H T   P +
Sbjct: 381 KWVVWSISLTVGAGMGYIISYCV-----------FNSSKRLPLEKIA----HQTRPGPLS 425

Query: 457 T--STSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSKMNVFVLNALSRPLNFLEN 514
           +     S +  L+ ++ T   N +S  +   +    K+T +++N      + +P    EN
Sbjct: 426 SLIHLKSNKNLLYLERTT--PNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAMFEN 483

Query: 515 LNKNS----DFSLDESNRILALGYILL 537
           L   +    D+  DE +RILAL Y+LL
Sbjct: 484 LITTTINSKDWKFDEQDRILALCYLLL 510

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  127 bits (319), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 104/396 (26%), Positives = 169/396 (42%), Gaps = 70/396 (17%)

Query: 37  EDKGLLDPHLSVLELLGKT-GHSPSPMGHSLVTSI-----DISSHHYVNDSISGSWQAIH 90
           + KG+LDPHLSVLE+L +  G     +    V ++     + S HH    SIS SWQAI 
Sbjct: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHH----SISESWQAIK 82

Query: 91  PLDLGASFVPERSSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGASVTSPS 150
             D           +  ++  ILSSSDTS        +    +         G+S+ SP 
Sbjct: 83  RSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEMRPSAHGTV-------HLGSSLASP- 134

Query: 151 RPFRQLHKVISLPLPAKGRTSYGEQXXXXXXXXXXXXXGAYEEDSGTITKSLTSSTNSFV 210
              RQL                                 A E+D  T+T S+ SS+ S V
Sbjct: 135 --MRQL-------------------------LVEEDNSCAEEDDCQTVTISMPSSSTSLV 167

Query: 211 MPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTAFP---QYTGIIII 267
           MPKLSLSQ+    +LL++G+    F+ +IPK +Q LF++      T +    +Y  ++++
Sbjct: 168 MPKLSLSQRLGEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVV 227

Query: 268 FQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNR 327
           F ++ +   LL+ + + +    +IP+CQ GQ   +  +LK +   K I++   P++++N 
Sbjct: 228 FHDIAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNH 287

Query: 328 RDLKKMFQRLQDLSLEYAXXXXXXXXXXXXXIIHTNSRSYYRXXXXXXXXXXXXXXXXXX 387
            +  ++ + L +L  E                +   S+  +R                  
Sbjct: 288 HEKHRLLKHLHNLCNESESGYETE--------LTVKSKKQHRRPRKKDAGPV-------- 331

Query: 388 XXXXQRSLTRWFTWGVSITIGISFGCCVTYFATAAY 423
                 +L  W  W  S TIGI  GCC++  AT  +
Sbjct: 332 ------ALRHWAIWTASFTIGIGIGCCISLMATTRF 361

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  126 bits (317), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 106/393 (26%), Positives = 169/393 (43%), Gaps = 55/393 (13%)

Query: 30  SSEVEAGEDKGLLDPHLSVLELLGKTG--HSPSPMGHSLVTSIDI---SSHHYVNDSISG 84
           +S V   +   +LDPHLSVL+LL +       S + H  +        S    VN SIS 
Sbjct: 29  TSSVPLNQRNSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISE 88

Query: 85  SWQAIHPLDLGASFVPERSSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGA 144
           SWQ+I   D   S V  +  +   +  ILSSSDTS        +P+ +           A
Sbjct: 89  SWQSIKHTD--CSMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAF----PNSA 142

Query: 145 SVTSPSRPFRQLHKVISLPLPAKGRTSYGEQXXXXXXXXXXXXXGAYEEDSGTITKSLTS 204
           +   P  P           L A     Y                   E D+ T+T SL +
Sbjct: 143 TSIFPEAPHN---------LEASSLREYQNSEIANPRE---------ENDNETVTMSLMN 184

Query: 205 STNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPK--YHDSTAFPQYT 262
           S+NSFVMPKLSL Q++  F +LI+G+    FY+ IP+ +  +FE+    +       +Y+
Sbjct: 185 SSNSFVMPKLSLIQQSQKFCILIVGKPAQRFYRDIPRAYHKMFEVRDVGHLSPREMNKYS 244

Query: 263 GIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPV 322
            +++IF E +E   LL ++  ++    II +CQ GQ  Q+ N+L  + ++  I+L+Y   
Sbjct: 245 AVMVIFGEPKEGKELLEKVAAHNSN--IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLT 302

Query: 323 VVTNRRDLKKMFQRLQDLSLEYAXXXXXXXXXXXXXIIHTNSRSYYRXXXXXXXXXXXXX 382
           V+++ +D+ ++ + L  LS E                      S Y              
Sbjct: 303 VMSDHQDVHRLLRYLNTLSTEVD--------------------SGYE--TEVGSRKIRKR 340

Query: 383 XXXXXXXXXQRSLTRWFTWGVSITIGISFGCCV 415
                    Q ++ RW  W +S+T+G+  G C+
Sbjct: 341 RKSSKKRSPQITVNRWVIWSISLTVGVGLGYCI 373

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  122 bits (306), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 108/387 (27%), Positives = 167/387 (43%), Gaps = 59/387 (15%)

Query: 40  GLLDPHLSVLELLGKTG-HS-PSPMGHSLVTS---IDISSHHYVNDSISGSWQAIHPLDL 94
            +LDPHLSVL+LL +   HS P    HS + S   +  SS   +  SIS SWQ+I   D 
Sbjct: 30  SILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIRHTDY 89

Query: 95  GASFVPERSSSQTTNGSILSSSDTSXXXXXXXXAPAADIINIIKQGQEGASVTSPSRPFR 154
               +   +S Q     ILSSSDTS        +P+ +                    F 
Sbjct: 90  SILNLIGETSHQP--AGILSSSDTSEDEPDHFLSPSPN-----------------EYAFA 130

Query: 155 QLHKVISLPLPAKGRTSYGEQXXXXXXXXXXXXXGAYEEDSGTITKSLTSSTNSFVMPKL 214
              K +    P       G                A + D+ T+T SL +S+NSFVMPKL
Sbjct: 131 NGAKTV---FPEASHAPEGPSLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKL 187

Query: 215 SLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTAFP-----QYTGIIIIFQ 269
           SL+Q    F +LI+G+    FY+ IP+ +Q +FE+    D+ +F      Q++ I++IF 
Sbjct: 188 SLAQPLRKFSILIVGKPAQRFYRDIPRAYQKMFEVC---DAESFKTRDVDQFSAIMVIFT 244

Query: 270 ELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNRRD 329
           + +   SLL  +   S    II +CQ GQ  Q+ N+L  F +   ++L+Y   V+++ +D
Sbjct: 245 DPKNGQSLLEMVTGRSSN--IIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQD 302

Query: 330 LKKMFQRLQDLSLEYAXXXXXXXXXXXXXIIHTNSRSYYRXXXXXXXXXXXXXXXXXXXX 389
           + ++ + L  LS E                      S Y                     
Sbjct: 303 VHRLLRYLYTLSNEID--------------------SEYDTEVGPRKVRKRRKSYKKRET 342

Query: 390 XXQRSLTRWFTWGVSITIGISFGCCVT 416
               ++ RW  W +S+T+G+  G C++
Sbjct: 343 PA--AVNRWVIWSISLTVGVGIGYCIS 367

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  120 bits (302), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 115/404 (28%), Positives = 166/404 (41%), Gaps = 78/404 (19%)

Query: 39  KGLLDPHLSVLELL-GK---TGHSPSPM-GHSLVTSIDISSHHYVNDSISGSWQAIHPLD 93
           + +LDPHLSVLE+L GK       P  + G S V+         ++ SIS SWQ+I   D
Sbjct: 25  RSILDPHLSVLEILEGKELNKVEGPHELSGASRVSGKQFEGERVLHHSISESWQSIKSTD 84

Query: 94  -LGASFVPERSSSQTTNGSILSSSDTSXXXXXXXXAPA----------ADIINIIKQGQE 142
            L  S   + S  Q +   ILSSSDTS        +P           + IINI   GQ 
Sbjct: 85  YLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHPSPPPPNSASSAFDSRIINI--AGQA 142

Query: 143 GASVTSPSRPFRQLHKVISLPLPAKGRTSYGEQXXXXXXXXXXXXXGAYEEDSGTITKSL 202
            ++  S  R   +                                    ++D  T+T SL
Sbjct: 143 FSATLSHLRSEDE------------------------------------DDDGETVTVSL 166

Query: 203 TSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFE---LPKYHDSTAFP 259
            ++  S VMPKLSLS +    ++LI+G+    F+ SIPK +Q +FE   L    D     
Sbjct: 167 PNTMTSLVMPKLSLSDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDE 226

Query: 260 QYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLY 319
           +Y+ I++IF ++     LL+RI        IIPICQ GQ   + ++LK ++    IKL  
Sbjct: 227 KYSTIMVIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFC 286

Query: 320 PPVVVTNRRDLKKMFQRLQDLSLEYAXXXXXXXXXXXXXIIHTNSRSYYRXXXXXXXXXX 379
            P+V++N  +  ++ + L  LS                    + S S Y           
Sbjct: 287 NPIVMSNHHEKHRLLKHLHQLS--------------------SGSDSGYETEVTVEPVKK 326

Query: 380 XXXXXXXXXXXXQRSLTRWFTWGVSITIGISFGCCVTYFATAAY 423
                         +   W  W  SITIGI  GCCV+   +  Y
Sbjct: 327 LPRKAKKRPSKPS-TFRDWVVWTASITIGIGIGCCVSLMVSTRY 369

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score =  103 bits (257), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 105/437 (24%), Positives = 181/437 (41%), Gaps = 97/437 (22%)

Query: 41  LLDPHLSVLELLGKTGHSPSPMGHSLVTSIDISS---------HHYVN-----DSISGSW 86
           +LDPH SV++LL   G         L+ + D+           H+ +N       ++ SW
Sbjct: 41  ILDPHDSVMDLL--NGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSW 98

Query: 87  QAIHP-----LDLGASFVPERSSSQTTN---GSILSSSDTSXXXXXXXXAPAADIINIIK 138
           QAI       L+ G       +S+   N   G +LSS DTS        AP         
Sbjct: 99  QAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSS-DTSEEEVEINAAP--------- 148

Query: 139 QGQEGASVTSPSRPFRQLH-KVISLPLPAKGRTSYGEQXXXXXX---------------- 181
                    SP+    Q H + ++ PL + G   +G+Q                      
Sbjct: 149 ---------SPNLSASQQHNQFLAYPLSSTG---FGDQGNSETTVHQFSDGDPVKSTKTG 196

Query: 182 --XXXXXXXGAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLIL--GRTGSNFYQ 237
                    G  E+++  +    + + + FVMPKLSLS+    F++LIL  G + ++FY 
Sbjct: 197 QFSKAELGAGTGEDETIMVNLGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYN 256

Query: 238 SIPKEHQSLFELPKYHDSTAFP--QYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQ 295
            + + H+ +F++ K ++++     +YT  +IIF + +++ ++LNR+ +      +IPICQ
Sbjct: 257 RLSRYHRLMFDVGKLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQ 316

Query: 296 PGQTIQVKNVLKSFLRNKLIKLLYPPVVVTNRRDLKKMFQRLQDLSLEYAXXXXXXXXXX 355
            GQ   V   +K+F  +  IKL+  PVV+++  ++  + + L  L +E            
Sbjct: 317 KGQKQSVTEKVKTFANSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEV----------- 365

Query: 356 XXXIIHTNSRSYYRXXXXXXXXXXXXXXXXXXXXXXQRSLTRWFTWGVSITIGISFGCCV 415
                     S Y                       +    RW+ W +SI +G+  GCCV
Sbjct: 366 ---------DSDYETDIPKKTKPRKGAKKKPAPHLAK----RWWFWPISIALGVGIGCCV 412

Query: 416 TY----FATAAYDHQTG 428
           T+    F T++Y+   G
Sbjct: 413 TFYFSKFETSSYNSSVG 429

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 456 TTSTSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSK-----MNVFVLNALSRPLN 510
           +T  S G QFL FD+    +    DG + K++ V KD W+      +++  LN L R LN
Sbjct: 240 STEGSKGPQFLKFDRVLCDVPCSGDGTMRKNVNVWKD-WNTGSGLGLHIVQLNILERGLN 298

Query: 511 FLE 513
            L+
Sbjct: 299 LLK 301

>TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON} 
          Length = 470

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 70/152 (46%), Gaps = 22/152 (14%)

Query: 189 GAYEEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLL-ILGRTGSNFYQSIPK--EHQS 245
            AY       + S TSS+N FVMP+LS S+K    + + ++G    +FYQ   +    + 
Sbjct: 100 SAYSHSYFDQSASDTSSSNQFVMPRLSYSKKEGSLKAISVVGSHADSFYQEYLQVSTGEY 159

Query: 246 LFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPIC-----QPGQTI 300
            F L    D++        +++ Q   E++ +L    ++S+   ++ I      + G  +
Sbjct: 160 CFMLDVSTDNSVS------LLVVQNHLELLDIL----RHSRDITVVAIVLSLDHRRGDNL 209

Query: 301 Q-VKN---VLKSFLRNKLIKLLYPPVVVTNRR 328
           + +KN   VL S    K   L YP +++ + R
Sbjct: 210 EIIKNCNKVLSSMKERKWPMLYYPNLIIIHER 241

>KLLA0B06952g Chr2 (606694..609378) [2685 bp, 894 aa] {ON} some
           similarities with uniprot|Q7LGR2 Saccharomyces
           cerevisiae YDR017C KCS1 Inositol hexaphosphate kinase
           phosphorylates inositol hexakisphosphate (InsP6) to
           diphosphoinositol polyphosphates required for proper
           vacuole morphology and involved in salt stress response
           contains two leucine heptad repeats
          Length = 894

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 8/55 (14%)

Query: 228 LGRTGSNFYQSIPKEHQSLFELPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIV 282
           L  T +N+Y++I KEHQ L +          P+Y G++ + Q        L  IV
Sbjct: 315 LVNTENNWYETIEKEHQELLQF--------MPRYIGVLNVRQHFHTKEDFLEEIV 361

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 448 HDTVNTPATTSTSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSK-----MNVFVL 502
           HD    P   ++   + FL FD+    +    DG + K++ V KD W+      ++   +
Sbjct: 228 HDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSGDGTMRKNINVWKD-WATASGLGLHTVQV 286

Query: 503 NALSRPLNFLEN 514
           N L+R LN L++
Sbjct: 287 NILNRGLNLLKD 298

>KLLA0D06633g Chr4 complement(568539..571610) [3072 bp, 1023 aa]
           {ON} similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1023

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 43  DPHLSVLELLG-----KTGHSPSPMGHSLVTSIDISSHHYVNDSISGSWQAIHPLDLGAS 97
           DP L  + LLG     KTG +P  +   ++ SI + S   +N+S SG  +  H  D  +S
Sbjct: 894 DPKLKKIHLLGISSLLKTGATPYLLEFKVILSIWVESLEEINESFSGDCEKYHLSDPDSS 953

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 6/71 (8%)

Query: 448 HDTVNTPATTSTSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSK-----MNVFVL 502
           HD    P   +     QFL FD+    +    DG + K++ V KD W       ++   L
Sbjct: 228 HDAQFFPRVKTDKETNQFLKFDRILCDVPCSGDGTMRKNVNVWKD-WGTASGLGLHTVQL 286

Query: 503 NALSRPLNFLE 513
           N L R LN L+
Sbjct: 287 NILKRGLNLLK 297

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 6/72 (8%)

Query: 448 HDTVNTPATTSTSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSK-----MNVFVL 502
           HD    P   S    ++FL FD+    +    DG + K++ V +D W       ++   L
Sbjct: 228 HDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSGDGTMRKNVNVWRD-WGTASGLGLHTVQL 286

Query: 503 NALSRPLNFLEN 514
           N L+R LN L++
Sbjct: 287 NILNRGLNLLKD 298

>Ecym_6351 Chr6 complement(681995..684385) [2391 bp, 796 aa] {ON}
           similar to Ashbya gossypii AFR085W
          Length = 796

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 61/124 (49%), Gaps = 9/124 (7%)

Query: 192 EEDSGTITKSLTSSTNSFVMPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEH---QSLFE 248
           ++D G + + L+S+ N+ +   LS+  ++     L LG T ++F +   +++        
Sbjct: 678 QQDLGNVVQDLSSARNANI---LSIEDEHDWGSNLNLGNTSNSFNEIAKRQYLPSDPTLL 734

Query: 249 LPKYHDSTAFPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKS 308
           L K ++     Q   +I     LREMVS +N++   ++G+  I +   G  +  ++ ++ 
Sbjct: 735 LAKINEEA---QINKVIRARAPLREMVSYMNKLRMLTKGRGSIHMDYWGMELASQDRIRD 791

Query: 309 FLRN 312
            LR+
Sbjct: 792 ILRD 795

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
           (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 65/135 (48%), Gaps = 16/135 (11%)

Query: 208 SFVMPKLSLSQK-------NPVFRLLILGRTGSNFYQSI-PKEHQSLFELPKYHDSTAFP 259
           +F+MPKL +SQ        N   R LI+G     FY  I P  ++  F++   +   +  
Sbjct: 76  TFIMPKLIVSQNLWDTNNDNNNNRFLIVGNNSLFFYNEILPINYKKFFKIWCLNKLDS-- 133

Query: 260 QYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLY 319
             + +III  +  E+ ++L +I+  S  K    I       +  N++ +  R K IKL+ 
Sbjct: 134 --SNLIIIINDHNELFNILQKILLNSNRKSCFNIIIILIIEKFNNLITN--RRK-IKLIK 188

Query: 320 PPVVVTNRR-DLKKM 333
             + + N++ +LKK+
Sbjct: 189 NSINIINKQFNLKKI 203

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query: 448 HDTVNTPATTSTSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSK-----MNVFVL 502
           HD    P   +    + FL FD+    +    DG + K++ V KD W       ++   L
Sbjct: 229 HDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGTMRKNINVWKD-WGTGSGLGLHTVQL 287

Query: 503 NALSRPLNFLEN 514
           N L+R L  L+N
Sbjct: 288 NILNRGLTLLKN 299

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,747,329
Number of extensions: 1767682
Number of successful extensions: 4977
Number of sequences better than 10.0: 31
Number of HSP's gapped: 5035
Number of HSP's successfully gapped: 52
Length of query: 537
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 423
Effective length of database: 40,409,475
Effective search space: 17093207925
Effective search space used: 17093207925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)