Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.215.700ON1221122158990.0
Smik_9.225.700ON1230121850920.0
YIL147C (SLN1)5.700ON1220122149670.0
Suva_9.415.700ON1219121849520.0
NCAS0G002505.700ON1183124534180.0
KAFR0D022405.700ON1187120932130.0
Kpol_2001.745.700ON1113122731230.0
TPHA0D045905.700ON1127122328620.0
ZYRO0G06644g5.700ON116695526720.0
NDAI0F003105.700ON125973621710.0
KNAG0L021105.700ON120074120390.0
CAGL0H06567g5.700ON116977820210.0
KLTH0E01100g5.700ON117772519490.0
SAKL0E14872g5.700ON114072919130.0
KLLA0A00638g5.700ON115572919010.0
AFR284W5.700ON110371418060.0
TBLA0I016805.700ON121477318090.0
TDEL0B022105.700ON109549413951e-172
Kwal_55.197075.700ON114347013751e-169
Ecym_40205.700ON112548213071e-159
TBLA0E021005.700ON114071012741e-154
Kpol_1043.685.700ON104245512061e-146
TPHA0E002505.700ON106845611671e-140
Ecym_74744.385ON4961201649e-11
ADL388W4.385ON4821201649e-11
Ecym_50775.230ON7951721659e-11
KAFR0B069904.385ON5451201603e-10
CAGL0F09097g4.385ON6301171594e-10
KNAG0M001804.385ON6151351594e-10
NCAS0A064504.385ON6091201586e-10
SAKL0B12408g4.385ON4651201568e-10
TDEL0D003204.385ON5471351568e-10
ADR343C5.230ON7491641579e-10
TDEL0E039805.230ON7301431561e-09
KLLA0A10219g4.385ON4751201541e-09
Kpol_265.24.385ON5491331541e-09
ZYRO0G00484g4.385ON6471221542e-09
Kwal_33.152885.230ON5871741532e-09
KNAG0B051405.230ON6481291532e-09
KLTH0D17182g4.385ON4641201513e-09
CAGL0D02882g5.230ON6671491514e-09
YHR206W (SKN7)4.385ON6221461514e-09
NDAI0D034304.385ON5971171514e-09
TPHA0C001504.385ON5101441505e-09
KLTH0B02684g5.230ON5952211505e-09
Smik_8.2964.385ON6251221505e-09
Suva_15.4124.385ON6171221496e-09
ZYRO0A11154g5.230ON7761541497e-09
Skud_8.2734.385ON6231221497e-09
KAFR0J007005.230ON6201281462e-08
Kwal_47.167704.385ON4611221442e-08
Kpol_1004.45.230ON7141651434e-08
TBLA0A107004.385ON5871221407e-08
NCAS0D029005.230ON7621411409e-08
TPHA0N008505.230ON6701511381e-07
Suva_10.845.230ON6951491382e-07
Smik_12.685.230ON7121491362e-07
YLR006C (SSK1)5.230ON7121491353e-07
Skud_12.725.230ON7021491344e-07
NDAI0I020005.230ON8901451301e-06
KLLA0E09505g5.230ON635731301e-06
TBLA0D031705.230ON7651581202e-05
SAKL0G12100g5.230ON738731094e-04
KLLA0E04533g7.222ON42181840.29
TBLA0B015507.222ON39481820.54
SAKL0F08184g7.222ON41281800.92
TDEL0H022307.222ON430121801.0
Kwal_47.181517.222ON41481791.2
KNAG0D017507.222ON409109772.0
Ecym_14444.140ON53890772.3
TBLA0E049804.385ON79170763.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.21
         (1221 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...  2276   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...  1966   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...  1917   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...  1912   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...  1321   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...  1242   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...  1207   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...  1107   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1033   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   840   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   790   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   783   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   755   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...   741   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   736   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   700   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   701   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   541   e-172
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...   534   e-169
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   508   e-159
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   495   e-154
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   469   e-146
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   454   e-140
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    68   9e-11
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    68   9e-11
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    68   9e-11
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    66   3e-10
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    66   4e-10
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    66   4e-10
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    65   6e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    65   8e-10
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    65   8e-10
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    65   9e-10
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    65   1e-09
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    64   1e-09
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    64   1e-09
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    64   2e-09
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    64   2e-09
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    64   2e-09
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    63   3e-09
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    63   4e-09
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    63   4e-09
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     63   4e-09
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    62   5e-09
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    62   5e-09
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    62   5e-09
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    62   6e-09
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    62   7e-09
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    62   7e-09
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    61   2e-08
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    60   2e-08
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    60   4e-08
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    59   7e-08
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    59   9e-08
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    58   1e-07
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    58   2e-07
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    57   2e-07
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    57   3e-07
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    56   4e-07
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    55   1e-06
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    55   1e-06
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    51   2e-05
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    47   4e-04
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    37   0.29 
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    36   0.54 
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    35   0.92 
TDEL0H02230 Chr8 complement(375714..377006) [1293 bp, 430 aa] {O...    35   1.0  
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    35   1.2  
KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {O...    34   2.0  
Ecym_1444 Chr1 (922983..924599) [1617 bp, 538 aa] {ON} similar t...    34   2.3  
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    34   3.4  

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score = 2276 bits (5899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1128/1221 (92%), Positives = 1128/1221 (92%)

Query: 1    MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60
            MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120
            AAQLKSSQVDQTLN          SRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS
Sbjct: 61   AAQLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120

Query: 121  NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180
            NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV
Sbjct: 121  NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180

Query: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240
            NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT
Sbjct: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240

Query: 241  YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300
            YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA
Sbjct: 241  YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360
            LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTVXXXXXXXXXXXXXXTAPSSLLQFNTGEACSTTSAN 420
            IVRLQKATELITEGRGLRPSTPRTV              TAPSSLLQFNTGEACSTTSAN
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSAN 420

Query: 421  XXXXXXXXXXVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLA 480
                      VALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLA
Sbjct: 421  GHGSSGHGSGVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLA 480

Query: 481  PXXXXXXXXXXXXXXXHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYA 540
            P               HILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNSLRNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQ 660
            IRNNLKLIFRSG            FSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNNLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDS 720
            RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDS
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDS 720

Query: 721  SEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEE 780
            SEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEE
Sbjct: 721  SEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEE 780

Query: 781  ITKRNTAANENIYKKANDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKALDSDSDESGN 840
            ITKRNTAANENIYKKANDREK                   AIFNSQFNKALDSDSDESGN
Sbjct: 781  ITKRNTAANENIYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQFNKALDSDSDESGN 840

Query: 841  VGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQL 900
            VGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  VGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVA 960
            ANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVA
Sbjct: 901  ANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVA 960

Query: 961  KSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQ 1020
            KSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQ
Sbjct: 961  KSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQ 1020

Query: 1021 PQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQ 1080
            PQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQ
Sbjct: 1021 PQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQ 1080

Query: 1081 GGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYN 1140
            GGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYN
Sbjct: 1081 GGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYN 1140

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1201 PKLNTILSEFCAAYQGKKNKK 1221
            PKLNTILSEFCAAYQGKKNKK
Sbjct: 1201 PKLNTILSEFCAAYQGKKNKK 1221

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score = 1966 bits (5092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 978/1218 (80%), Positives = 1046/1218 (85%)

Query: 1    MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60
            MR RLPS+S+F PPFRIGIRAQLTALVSIVALVSL ILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRLRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120
            AAQLKSSQ+DQTLN          SRDALQSSLTS+VAGNKS DNWVDSLSVVQKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSS 120

Query: 121  NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180
            NLFYVA+VYDSSFTTVLNATNNGTGDLIPEDVLD+LFPLSTD PLPSSLETTGILTDP+V
Sbjct: 121  NLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVV 180

Query: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240
            NNTDYLMSMSLPIFANPSIILTDSRVYGYITI+MSAEGLKSVFNDTTALEKSNVAIISA 
Sbjct: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAL 240

Query: 241  YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300
            YN QG+ASGYHF+FPPYGT  ++TQ +F I+NNTFISS FRNGKGGSLK+TN+FG KNLA
Sbjct: 241  YNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360
            LGYSPCSFQLVNWVAVVSQPESVFLSPATKL KII GTVIAIGVFVILLTLPL HWAV+P
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTVXXXXXXXXXXXXXXTAPSSLLQFNTGEACSTTSAN 420
            IVRLQKATELITEGRGLRPSTPRTV              T PSSLLQFNTGE+ ST SA+
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGESGSTISAS 420

Query: 421  XXXXXXXXXXVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLA 480
                       A STESSMKSAINLG+EKL PSE+E KIPNN+ D K+SMDGSLNHDLLA
Sbjct: 421  GHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA 480

Query: 481  PXXXXXXXXXXXXXXXHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYA 540
            P               HILTTSANLTEARLPDY+RLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQ 660
            IRN+LKLIFRSG            FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDS 720
            RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKD 
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDL 720

Query: 721  SEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEE 780
            SEK+QFKEVHVK+GTEIT+  E  +K D+P S   RK+V+LESTT SITS RD S IQEE
Sbjct: 721  SEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEE 780

Query: 781  ITKRNTAANENIYKKANDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKALDSDSDESGN 840
            ITKRNTAANENIYK+ ND EK                   AIFNSQFNKA  SD DE GN
Sbjct: 781  ITKRNTAANENIYKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNSQFNKAPGSDEDEGGN 840

Query: 841  VGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQL 900
            +G+PIENPKTWVISIEVEDTGPGI+PSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVA 960
            ANMM+GTM+LES+VGVGSKFTFTLPL QTKEISFAN++FPFEDEFNPES+KNRRVKF+VA
Sbjct: 901  ANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVA 960

Query: 961  KSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQ 1020
            KSIKSRQSTSS+ TP TN ++L NDVL E  S +E ++++ +N   ++EG N  G+ +Q+
Sbjct: 961  KSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQK 1020

Query: 1021 PQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQ 1080
             QEKN K  + FSSAE S +KTV  K RS+EE+LGSVN+DRPFLQSTGTATSSRNVPT+Q
Sbjct: 1021 LQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPTIQ 1080

Query: 1081 GGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYN 1140
              DK+ TSIKILVVEDNHVNQEVI+RMLNLEGI+NIELACDGQEAFDKVKELTSKG NYN
Sbjct: 1081 DNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYN 1140

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1201 PKLNTILSEFCAAYQGKK 1218
            PKL TIL+EFCAAYQGKK
Sbjct: 1201 PKLKTILTEFCAAYQGKK 1218

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score = 1917 bits (4967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 950/1221 (77%), Positives = 1025/1221 (83%), Gaps = 1/1221 (0%)

Query: 1    MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60
            MRF LPS+ +  PPFRIGIR QLTALVSIVAL SL ILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120
            AAQLKSSQ+DQTLN          SRDALQSSLTSYVAGNKS DNWVDSLSV+QKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSS 120

Query: 121  NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180
            NLFYVA+VYDSSF  VLNATNNGTGDLIPEDVLD+LFPLSTD PLPSSLET GILTDP++
Sbjct: 121  NLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVL 180

Query: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240
            N+TDYLMSMSLPIFANPSIILTDSRVYGYITI+MSAEGLKSVFNDTTALE S +AIISA 
Sbjct: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAV 240

Query: 241  YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300
            YN+QG+ASGYHFVFPPYG+   + Q++F I+N+TFISS FRNGKGGSLK+TN   T+N A
Sbjct: 241  YNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360
            LGYSPCSF LVNWVA+VSQPESVFLSPATKL KII GTVIAIGVFVILLTLPL HWAV+P
Sbjct: 301  LGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTVXXXXXXXXXXXXXXTAPSSLLQFNTGEACSTTSAN 420
            IVRLQKATELITEGRGLRPSTPRT+                PSSLLQFNT EA STTS +
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVS 420

Query: 421  XXXXXXXXXXVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLA 480
                       A S  SSMKSAINLG+EK+SP EEENKIPNNH D KISMDGSLNHDLL 
Sbjct: 421  GHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLG 480

Query: 481  PXXXXXXXXXXXXXXXHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYA 540
            P               HILTTSANLTEARLPDY+RLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLE+RVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQ 660
            IRN+LKLIFRSG            FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDS 720
            RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDK+ 
Sbjct: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKEL 720

Query: 721  SEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEE 780
            SEK+Q+KEV++KKGTE+T+ +E+ DK DLPT    RK V+LES+  S+ S RD S IQEE
Sbjct: 721  SEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEE 780

Query: 781  ITKRNTAANENIYKKANDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKALDSDSDESGN 840
            ITKRNT ANE+IYKK NDREK                   AIFNSQFNKA  SD +E GN
Sbjct: 781  ITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGN 840

Query: 841  VGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQL 900
            +GRPIENPKTWVISIEVEDTGPGI+PSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVA 960
            ANMMHGTMKLES+VGVGSKFTFTLPL+QTKEISFA++EFPFEDEFNPES+KNRRVKFSVA
Sbjct: 901  ANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVA 960

Query: 961  KSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQ 1020
            KSIKSRQSTSS+ TP TN ++L NDVL E RS  + E +   N    +E +N+NG   +Q
Sbjct: 961  KSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNG-GLEQ 1019

Query: 1021 PQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQ 1080
             QEKN K S+  + AE + Q ++SSK RS+ E LGSVN+DRPFLQSTGTATSSRN+PTV+
Sbjct: 1020 LQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVK 1079

Query: 1081 GGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYN 1140
              DK+ TS+KILVVEDNHVNQEVI+RMLNLEGI+NIELACDGQEAFDKVKELTSKGENYN
Sbjct: 1080 DDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYN 1139

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGY SPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1140 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1199

Query: 1201 PKLNTILSEFCAAYQGKKNKK 1221
            PKL TIL+EFCAAYQGKKN K
Sbjct: 1200 PKLKTILTEFCAAYQGKKNNK 1220

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score = 1912 bits (4952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 951/1218 (78%), Positives = 1032/1218 (84%)

Query: 1    MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60
            MRFRLPSRS F PPFRI IRAQLTALVSIVAL+SL ILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120
            AAQLKSSQ+DQTLN          SRDALQ+SLT YVAGNKS DNWVDS+S+VQKFLSSS
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120

Query: 121  NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180
            NLF+VA+VYDSSFTTVLNATNNGTGDLIP+D+ D LFPLSTD+ LPSSLETTGILTDPI+
Sbjct: 121  NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180

Query: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240
            N+TDYLMSMSLPIFANPSIILTDSRVYGYITI+MSAEGLKSVFNDTTALEKSNVAIISA 
Sbjct: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240

Query: 241  YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300
            YN Q +A  YHFVFPPYGT  SIT+ IFPI+NNTFISS F+NGKGGSLKKTN+FG KNLA
Sbjct: 241  YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360
            LGYSPCSFQLVNWVAVVSQPESVFLSP+TKL KII GTVIAIGVFVILLTLPL HWAV+P
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTVXXXXXXXXXXXXXXTAPSSLLQFNTGEACSTTSAN 420
            IVRLQKATELITEGRGLRPSTPRTV                PSSLLQFN+GEA STTSA+
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTSAS 420

Query: 421  XXXXXXXXXXVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLA 480
                        +ST+SSMKSA+N+G+EKLSP EEE + PN+HN+ KISMDGSLNHDLLA
Sbjct: 421  GHGCSGRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDLLA 480

Query: 481  PXXXXXXXXXXXXXXXHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYA 540
            P               HILTTSANLTEARLPDY+RLFSDELSDLTETFNTMTDALDQHYA
Sbjct: 481  PNALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYA 540

Query: 541  LLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600
            LLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEETDVNK
Sbjct: 541  LLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNK 600

Query: 601  IRNNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQ 660
            IRN+LKLIFRSG            FSKNVLQRTKLE+RDFCITDVALQIKSIFGKVAKDQ
Sbjct: 601  IRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQ 660

Query: 661  RVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDS 720
            RVRLSISLFPN IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTV+VRMKLLGEYDK+ 
Sbjct: 661  RVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKEL 720

Query: 721  SEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEE 780
            SEK+QFKEVHV+KGTEI + + +I+K D   S   +K ++ ESTT S+TS RD S IQEE
Sbjct: 721  SEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQEE 780

Query: 781  ITKRNTAANENIYKKANDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKALDSDSDESGN 840
            ITKRNTAANENIYKK  DREK                   AIFNSQFNKAL SD DE G+
Sbjct: 781  ITKRNTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKALGSDDDEGGD 840

Query: 841  VGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQL 900
            +G+PIENPKTW ISIEVEDTGPGI+PSLQESVF PFVQGDQTLSRQYGGTGLGLSICRQL
Sbjct: 841  LGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQL 900

Query: 901  ANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVA 960
            ANMMHGTMKLES+VGVGSKFTFTLPLHQTKEISFAN+ FPFEDEFNPES++NRRVKF+VA
Sbjct: 901  ANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVA 960

Query: 961  KSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQ 1020
            +SIKSRQS SS+ TP  N   L N++L ++RS++EEE  K  N  + KEG NE  +A QQ
Sbjct: 961  RSIKSRQSASSIATPTANRCGLTNEMLRKSRSNEEEEGRKIINIEEGKEGGNELDEAHQQ 1020

Query: 1021 PQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQ 1080
             QEKN K+S+SFSSA+ + QK+  S R S+EE++GSVN+DRPFLQSTGTATS+RN+PTV 
Sbjct: 1021 LQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVS 1080

Query: 1081 GGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYN 1140
              DK  +SIKILVVEDNHVNQEVI+RMLNLEGI+NIELACDGQ+AFDKVKELTS+GE+YN
Sbjct: 1081 NSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYN 1140

Query: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200
            MIFMDVQMPKVDGLLSTKMIRRDLGY SPIVALTAFADDSNIKECLESGMNGFLSKPIKR
Sbjct: 1141 MIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKR 1200

Query: 1201 PKLNTILSEFCAAYQGKK 1218
            PKL TIL EFCAAYQGKK
Sbjct: 1201 PKLKTILIEFCAAYQGKK 1218

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1183

 Score = 1321 bits (3418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 714/1245 (57%), Positives = 861/1245 (69%), Gaps = 100/1245 (8%)

Query: 1    MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60
            M+  L       PPFR+GIR QLT LVS+VAL SL ILA+TTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MKVNLSKWYVLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYI 60

Query: 61   AAQLKSSQVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120
            AAQLKSSQ+DQ LN          SRD LQ  LT+YVAGNK+ +NW DS  V+QKFL+S+
Sbjct: 61   AAQLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSN 120

Query: 121  NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180
            NLF  A++YDSSF  VL ATNNGTGDLIPE VL  L+PL+T+ PL SSLET GILTDP++
Sbjct: 121  NLFSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVL 180

Query: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240
            N + Y+MSMSLPIFANPSIILTDS+VYGYITIVMSAEGLK+VFNDTTALE+SNVAI+S  
Sbjct: 181  NGSTYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGV 240

Query: 241  YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300
            YN +   + YHFVF PYG    +    F I NN+F+++  R GKGGS+KKT  F TKN+A
Sbjct: 241  YNNESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIA 300

Query: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360
            +GYSPC+F  VNW+A+VSQ ESVFLSP+TKL KII+GTV+AIGVFV L+T PL HWAVKP
Sbjct: 301  VGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKP 360

Query: 361  IVRLQKATELITEGRGLRPSTPRTVXXXXXXXXXXXXXXTAPSSLLQFN--TGEACSTTS 418
            IVRLQKATEL++EGRGL+ +TP +                 PS+    +  +G+  STT+
Sbjct: 361  IVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTT 420

Query: 419  ANXXXXXXXXXXVALSTESSMKSAINLGHEKLS---PSEEENKIP--NNHNDVKISMDGS 473
                           +T+    S  N   E +S    S+  N I    +H D+       
Sbjct: 421  NGHLNQRGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDHTDL------- 473

Query: 474  LNHDLLAPXXXXXXXXXXXXXXXHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTD 533
                                     LTTSANL EAR+PDY+RLFSDELSDLT+TFN MTD
Sbjct: 474  -------------------SNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTD 514

Query: 534  ALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISM 593
            ALDQHYALLEDRVRARTKQL             KT+FIANISHELRTPLNGILGMTAISM
Sbjct: 515  ALDQHYALLEDRVRARTKQLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISM 574

Query: 594  EETDVNKIRNNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIF 653
            EETD+ KIR++LKLIFRSG            FSKNVL+RT LE+RDFCITDVALQIKSIF
Sbjct: 575  EETDIAKIRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIF 634

Query: 654  GKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLL 713
            GKVAKDQRVRLSI L PN+IRTM+L+GDSNRIIQIVMNLVSNALKFTPVDG V+VR+KL+
Sbjct: 635  GKVAKDQRVRLSIVLLPNIIRTMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLM 694

Query: 714  GEYDKDSSEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRD 773
            GEYD++ S +  FK+V VK GTE    +E+  K      LG  K  + +++T S+     
Sbjct: 695  GEYDENLSRESNFKKVLVKSGTEF---IETKAK----AILGAPKKDDPKTSTESVVQ--- 744

Query: 774  NSAIQEEITKRNTAANENIYKKANDREK------------------XXXXXXXXXXXXXX 815
               I+E +    ++++ +I    +D +K                                
Sbjct: 745  ---IKENLNSNTSSSSNDIISTTSDEKKYDEKEDEGEEDNSDNDNDDTSMETQSIVSTST 801

Query: 816  XXXXXAIFNSQFNKALDSDSDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQP 875
                 A+FN+QF K  +   DE GN+G  + NPKTWVI+IEV+DTGPGI+PSLQ+SVF+P
Sbjct: 802  SSYDDAVFNNQFKKTPELYEDEDGNLGIELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEP 861

Query: 876  FVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFA 935
            FVQGDQTLSRQYGGTGLGLSICRQLANMM+GTM+L+S+VGVGS FTFT+PL QT+E+   
Sbjct: 862  FVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELN 921

Query: 936  NIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDE 995
              + PFEDEFNP S+KNRRVKF +AKS++SR+S SS TT  + +N+L N         +E
Sbjct: 922  EDDHPFEDEFNPASRKNRRVKFKLAKSLRSRKSRSSTTT-FSTTNSLHN-------VQEE 973

Query: 996  EEVEKTKNFIKRKEGENENGKAQQQPQEKNTKHSVSFSSAERSSQKTVSSKRRSQEEN-- 1053
            +E +K  +  + K+G    GK +   QE+   H                   ++ E N  
Sbjct: 974  KEEDKLGDNEETKDG----GKEEDAHQERRHSHD------------------KNNEHNNH 1011

Query: 1054 -LGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEG 1112
             LG+VN+DRPFLQSTGTATS+R + TV      G   KILV EDNHVNQEVI+RMLNLEG
Sbjct: 1012 LLGTVNMDRPFLQSTGTATSTRTIQTVPDA---GKKFKILVAEDNHVNQEVIKRMLNLEG 1068

Query: 1113 IDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVA 1172
            ++NIELA DGQ+AF++VK +  +GE+++MIFMDVQMPKVDGLLSTKMIR DL Y  PIVA
Sbjct: 1069 VENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVA 1128

Query: 1173 LTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAYQGK 1217
            LTAFADDSNIKECLE+GMNGFLSKPIKRPK+ TIL E+C  +Q K
Sbjct: 1129 LTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEYCPNWQMK 1173

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score = 1242 bits (3213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/1209 (55%), Positives = 827/1209 (68%), Gaps = 78/1209 (6%)

Query: 13   PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72
            PP+RI IR QL A+VS+VA++SL ILAVTTGVYFTS+YKNLR++RLYIAAQLKSSQ+DQT
Sbjct: 25   PPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQT 84

Query: 73   LNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132
            L           +RD LQ SL ++VAGNKS  NW  + SV++KFLSSS+ F   +VYD +
Sbjct: 85   LTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDEN 144

Query: 133  FTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLP 192
            F TVL+ TNNGTG+ I  DVL+ LFPLST+IPL SSLETTGILTDP++N T YLMSMSLP
Sbjct: 145  FDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSLP 204

Query: 193  IFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHF 252
            +FANPSIIL+ SRVYGYITI+M+A+GL SVFNDTTA+EKSNVAI+SA YN Q     YH 
Sbjct: 205  VFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYHL 264

Query: 253  VFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLVN 312
              PPYG   S+T   F ++N++F++   + GKGGS+KKT+    K +A+GYSPCSF+L N
Sbjct: 265  ALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELAN 324

Query: 313  WVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELIT 372
            WV+VVSQ ESVF  P+TKLTKIIAG V+ I VFV+L+TLPL ++AVKPIVRL+KATE+IT
Sbjct: 325  WVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEIIT 384

Query: 373  EGRGLRPSTP--RTVXXXXXXXXXXXXXXTAPSSLLQFNTGEACSTTSANXXXXXXXXXX 430
            EGRGLRP+TP   +V              +  SS     TG   ++ S N          
Sbjct: 385  EGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATG---NSNSLNENSASLSSHP 441

Query: 431  VALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLAPXXXXXXXXX 490
            + L++E+ + +     H  LS      +IP N N   +    +   + L           
Sbjct: 442  MVLTSENVLVT----NHSGLS------RIPVNMNQELLDRASASTVNTLT----IDSNDR 487

Query: 491  XXXXXXHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRART 550
                  H++T + NLTEAR+P  ++LF DELSDLTETFNTMTDALD+HY LLEDRVRART
Sbjct: 488  LSERSKHLITFT-NLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRART 546

Query: 551  KQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFR 610
            KQL             KTVFIANISHELRTPLNGILGMTAISMEE D+ KIR++LKLIFR
Sbjct: 547  KQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFR 606

Query: 611  SGXXXXXXXXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFP 670
            SG            FSKNVLQRTKLE+R+FCITDVALQ+KSIFGKVAKDQ VRLSI L P
Sbjct: 607  SGELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSP 666

Query: 671  NLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVH 730
            N++RTMVL+GDSNRIIQ+VMNLVSNALKFTPVDG V V++KLLGEYD++SS+  +F++V+
Sbjct: 667  NIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVY 726

Query: 731  VKKGTEITDV---VESIDKRDLPTSLGRRKYV-----NLESTTASITSCRDNSAIQEEIT 782
            VK GTE T +   + ++ KR+                 L+   A++ +   +S    E T
Sbjct: 727  VKGGTEFTSIPAELAALSKRESTAGSHFSGSSSHIKEKLDGIPANVFASDSDSDDPSEGT 786

Query: 783  KRNTAANENIYKKANDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKALDSDSDESGNVG 842
              NT+      ++ +  E                    AIFNSQF K  D   DE GN+G
Sbjct: 787  TINTSQ-----QRTSSNED--YVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLG 839

Query: 843  RPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLAN 902
              +   KTWV  IEV DTGPGI+ SLQESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA 
Sbjct: 840  EELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAT 899

Query: 903  MMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKS 962
            MM+GTM LES VG GSKF FT+PL QT+ I     E P+EDEFNP+SK NR+VKF+VA+S
Sbjct: 900  MMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVARS 959

Query: 963  IKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQPQ 1022
            I SR+S SSL T  +NS+ +A        +  EE   +T++        N+N  A  QP 
Sbjct: 960  INSRRSRSSLIT--SNSSRIA--------TVREESRLETRSNHSDVSTSNKNESASPQP- 1008

Query: 1023 EKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQGG 1082
                                         E+  ++N+DRPFLQSTGTA SS NVPTV   
Sbjct: 1009 -----------------------------ESGSNLNLDRPFLQSTGTAISSANVPTVA-- 1037

Query: 1083 DKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMI 1142
               G ++ +LV EDNHVNQEVI+RML+LEG+ NI+LACDGQ+AFD VK L  +GE Y+MI
Sbjct: 1038 -TLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMI 1096

Query: 1143 FMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPK 1202
            FMDVQMPKVDGL +TKMIR DL Y+ PIVALTAFADDSNIKECL++GM+GFLSKPIKRP+
Sbjct: 1097 FMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQ 1156

Query: 1203 LNTILSEFC 1211
            L TIL E+C
Sbjct: 1157 LKTILLEYC 1165

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score = 1207 bits (3123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1227 (54%), Positives = 811/1227 (66%), Gaps = 141/1227 (11%)

Query: 3    FRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAA 62
             R   R  F PP+RI IRAQLTALVS+VA++SL ILAVTTGVYFT NYK LRS RL IAA
Sbjct: 1    MRQSWRKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAA 60

Query: 63   QLKSSQVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNL 122
            +LKSSQ+DQTLN          SRD LQ++L +Y AGNK+ +NW++S +VVQKFLSSS+L
Sbjct: 61   KLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDL 120

Query: 123  FYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNN 182
            FYVAR+YD +F  V+NATNNGTGDLIP +VL  LFPLST+  LPSSL   GILTDP++N 
Sbjct: 121  FYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNG 180

Query: 183  TDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYN 242
            + YLMSMSLPI  NPSIIL+ SRVYGYITIVMSA+GLK+V+ + TALE SNV +ISA YN
Sbjct: 181  SIYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYN 240

Query: 243  AQGRASGYHFVFP----PYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKN 298
             QG+  G+HFVF      + TL+      +PI+N T++SS    GK GS+KKT     + 
Sbjct: 241  DQGKVDGFHFVFEVENDDFSTLIE-----YPIQNGTYLSSALVEGKSGSIKKTKYPFNRE 295

Query: 299  LALGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAV 358
            LA+GYSPCSF L NWVA+V+QPE+VFLSP+TKL KII+GTV+AI VFV L+T PL+HWAV
Sbjct: 296  LAIGYSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAV 355

Query: 359  KPIVRLQKATELITEGRGLRPSTPRTVXXXXXXXXXXXXXXTAPSSLLQFNTGEACSTTS 418
            KPIVRLQKATELI++GRGL+P++                          F+ G++ S+TS
Sbjct: 356  KPIVRLQKATELISQGRGLKPTS-------------------------NFSNGDS-SSTS 389

Query: 419  ANXXXXXXXXXXVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDL 478
             N           +L      KS  N G  +L  +++ N+I     + + S + S   ++
Sbjct: 390  DNWRESVESHVRASLGI---FKSLRNNGSNELQSNDDMNEI-----NERSSKNNSTGDNI 441

Query: 479  LAPXXXXXXXXXXXXXXXHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQH 538
             +                    T++NL +AR+P Y R   DELS+LT+TFN MT+ALDQH
Sbjct: 442  KSSDNDSSSSFQRY--------TTSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQH 493

Query: 539  YALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDV 598
            Y LLEDRVRARTKQL             KTVFIANISHELRTPLNGILGMTAISMEE D 
Sbjct: 494  YTLLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDS 553

Query: 599  NKIRNNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAK 658
            +KI+ NLKLIFRSG            FSKNVL+RT LE+RDFCIT++ALQIKSIFGKVA+
Sbjct: 554  DKIKENLKLIFRSGELLLHILTELLTFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVAR 613

Query: 659  DQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDK 718
            DQ V+L I L PN IR+MVLWGDSNRIIQIVMNLVSNALKFTP+DG VDVR+KLLGEYD+
Sbjct: 614  DQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDE 673

Query: 719  DSSEKRQFKEVHVKKGTEI-------TDVVESIDKRDLPTSLGRRKYVNLESTTASITSC 771
            + S    +KEV++K GTE+       TD+V     R     L  +  +  E  TAS  S 
Sbjct: 674  ERSMNDDYKEVYIKSGTELPIGNGKKTDMV-----RKKIQELSEKDCI--EGDTASSGSH 726

Query: 772  -----RDNSAIQEEITKRNTAANENIYKKANDREKXXXXXXXXXXXXXXXXXXXAIFNSQ 826
                 + +  I++E  K + + NE+     ND E                    A    Q
Sbjct: 727  MSGSSKIDKLIEDE-EKNSFSDNEDT---NNDIE------ILSMTTSSTRSYDDAALQRQ 776

Query: 827  FNKALDSDSDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQ 886
            F K  D D D+   +G  +  PKTWVIS+EVEDTGPGIEP LQE+VF+PFVQGDQ LSRQ
Sbjct: 777  FKKTPDLD-DKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQ 835

Query: 887  YGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFN 946
            YGGTGLGLSICRQLA MMHGTMKLES VGVGSKF FT+PL QT+EI F + +  FEDEFN
Sbjct: 836  YGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHFDDEK--FEDEFN 893

Query: 947  PESKKNRRVKFSVAKSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNF-I 1005
             ESKKNRR+KF +  S KS  S               ND        DEE ++ +++   
Sbjct: 894  AESKKNRRIKFKIYDSSKSHDS---------------ND-------EDEEGIKSSRDIDS 931

Query: 1006 KRKEGENENGKAQQQPQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQ 1065
               E ++ENG                                 +  +N   V +DRPFLQ
Sbjct: 932  SNNEHKDENG---------------------------------TSPDNHSKVRLDRPFLQ 958

Query: 1066 STGTATSSRNVPTVQGGDKDGT--SIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQ 1123
            STGTATSS+ +PT+   +      SI+ILV EDNHVNQEVI+RMLNLE IDNI+LACDGQ
Sbjct: 959  STGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQ 1018

Query: 1124 EAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIK 1183
            +AFDKVK L    E Y++IFMDVQMPKVDGL+STKMIR+DL YK PIVALTAFA+D NIK
Sbjct: 1019 DAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIK 1078

Query: 1184 ECLESGMNGFLSKPIKRPKLNTILSEF 1210
            ECL++GM+GFL KPIKRPKL  IL E+
Sbjct: 1079 ECLDAGMDGFLGKPIKRPKLKQILQEY 1105

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score = 1107 bits (2862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1223 (51%), Positives = 779/1223 (63%), Gaps = 126/1223 (10%)

Query: 13   PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72
            PP+RI IRAQLTALVS+VA++SL ILAVT GVYFT+NYKNL++ RLYIAAQLK+SQ+DQT
Sbjct: 11   PPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKASQIDQT 70

Query: 73   LNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132
            LN          S + LQ+SL SY AGN S  NW +S  V++KFL+SS+LF VAR+YD++
Sbjct: 71   LNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDTN 130

Query: 133  FTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLP 192
            F  ++NATNN +G+ +PE V+D LF LS +I LPSSLET GI TDP++N +++LMSMSLP
Sbjct: 131  FNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSLP 190

Query: 193  IFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHF 252
            IFANPSIIL+DSR+YGY++++MSAEGLKSVFNDTTALE S V +ISA Y+       ++F
Sbjct: 191  IFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFNF 250

Query: 253  VFP-PYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLV 311
            +F   Y          + I+N+TF+ +   NGKGG++KKTN F     A+GYS CSF LV
Sbjct: 251  LFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSLV 310

Query: 312  NWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELI 371
            NW+A+V+QPE+ F   ATKL +II+G V+A+ VFV LLT PL+HWAV+P++RLQKATE I
Sbjct: 311  NWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQKATERI 370

Query: 372  TEGRGLR---PSTPRTVXXXXXXXXXXXXXXTAPSSLLQFNTGEACSTTSANXXXXXXXX 428
             EGRGLR   P+   +V                 SSL  FN  +                
Sbjct: 371  AEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSL-GFNANK---------------- 413

Query: 429  XXVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLAPXXXXXXX 488
                LS   S+ +     +   S S   + I  N+N    SM  + + DL          
Sbjct: 414  ----LSDSGSITANNFKNNTSSSNSITSSHIYGNNNSSHSSMGINPDDDL---------- 459

Query: 489  XXXXXXXXHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRA 548
                        TSANL EAR+P Y RL  DELS+LT+TFNTMTDALDQHY LLE+RVRA
Sbjct: 460  ----SSSSQKYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRA 515

Query: 549  RTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLI 608
            RTKQL             KTVFIANISHELRTPLNGILGMTAISMEE DV+KIR NLKLI
Sbjct: 516  RTKQLEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLI 575

Query: 609  FRSGXXXXXXXXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISL 668
            FRSG            FSKNVLQRTKLE+RDFCIT+VALQIKSIFGK+AKDQ V+LSI L
Sbjct: 576  FRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIIL 635

Query: 669  FPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKE 728
             PN++R+ VLWGDSNRIIQ+VMNLVSNALKFTPVDG VDVR+ LLGEYD++ S+   +K+
Sbjct: 636  MPNILRSYVLWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKK 695

Query: 729  VHVKKGTEITDVVESIDKRDLPTSLGRRKYV-NLESTTASITSCRDNSAIQEEITKRNTA 787
            V+VK+GTE            LP ++   K   N + +  S T   ++      I+K +TA
Sbjct: 696  VYVKQGTE------------LPLNISHLKTEENNDISRKSETELNNDENETHTISKDDTA 743

Query: 788  ------ANENIYKKANDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKALDSDSDESGNV 841
                   NE++     D+                          Q  K+ D D DE+  +
Sbjct: 744  DSSIKIGNEDVEISEVDK-----MGMASLVTTSSKSYDDTALMKQLIKSTDLDDDEN-KL 797

Query: 842  GRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLA 901
            G  ++  KTWVIS+EV+DTG GI+P LQESVF+PFVQGDQ LSRQYGGTGLGLSIC+QL+
Sbjct: 798  GVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQGDQALSRQYGGTGLGLSICKQLS 857

Query: 902  NMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAK 961
             MM+GTM+LES+VGVGSKF FTLPL QT+EIS  + E  F DEFN  SKKNR+V      
Sbjct: 858  TMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDEL-FNDEFNAVSKKNRKV------ 910

Query: 962  SIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQP 1021
              K + S SS    +   N++ + +                                   
Sbjct: 911  --KFKFSGSSSAKSIKTRNSIGSSL----------------------------------- 933

Query: 1022 QEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQG 1081
               N +HS +   +  S      + R S      SV ++RPFLQSTGTATS++NVPT+  
Sbjct: 934  ---NNRHSTTSIDSSSSDSDEEDNVRPS------SVRLNRPFLQSTGTATSTQNVPTLNA 984

Query: 1082 GDKDGTS---------IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKEL 1132
               D +          I ILV EDNHVNQEVI+RML LEGI+NI+LA DGQ+AFDK K L
Sbjct: 985  HTDDKSKNKVLNKMDLIYILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKML 1044

Query: 1133 TSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNG 1192
            +    NY++IFMDVQMP++DGL +TKMIR +L Y  PIVAL+AF  + N+KECL+ GMN 
Sbjct: 1045 SENNGNYDIIFMDVQMPRLDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMND 1104

Query: 1193 FLSKPIKRPKLNTILSEFCAAYQ 1215
            FLSKPIKRP L  IL ++   +Q
Sbjct: 1105 FLSKPIKRPDLKIILKKYIEDFQ 1127

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1166

 Score = 1033 bits (2672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/955 (57%), Positives = 662/955 (69%), Gaps = 52/955 (5%)

Query: 11  FIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVD 70
           F  P R+GIRAQLTALVSIVALVSL ILAV+TGVYFT NYKNLRS+RLY+AAQLKS+Q+D
Sbjct: 11  FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70

Query: 71  QTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYD 130
           Q LN          SRD LQ +L +YVAGNK+  NWVDS +V+QKFL+SS LF VA +YD
Sbjct: 71  QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130

Query: 131 SSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMS 190
           ++FT VL+ATNNGTG+ IPE  LD L PLS + PLPSSL++ GILT+P++N T YLMSMS
Sbjct: 131 ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNGTSYLMSMS 190

Query: 191 LPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGY 250
           LPIFANPSIILT S VYGYITIVMSA+ LK+VF+DTTALEKSNVAI+SA Y+     S Y
Sbjct: 191 LPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETLSSY 250

Query: 251 HFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQL 310
           +FVF P G   SI     PI+N TF+SS  R GKGG+L++T    TK +A+GYSPCS   
Sbjct: 251 NFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVGYSPCSVVF 310

Query: 311 VNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATEL 370
           VNW+AVV Q E+VF+ PATKLTKII+GTV+ IGVFV L+T PL HWAVKPIVRLQKATEL
Sbjct: 311 VNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATEL 370

Query: 371 ITEGRGLRPSTPRTVXXXXXXXXXXXXXXTAPSSLLQFNTGEACSTTSANXXXXXXXXXX 430
           ITEGRGLR S+P                 +  SS   F+    C                
Sbjct: 371 ITEGRGLRASSP----------GAGSSNVSRRSSF--FHRPSNCG--------------- 403

Query: 431 VALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLAPXXXXXXXXX 490
                 SS++S +   H +        +I +       +M+GS+NH L A          
Sbjct: 404 ------SSIRSRVTDNHNEKGHDLHGEQIQHGF----FAMNGSINHSLAASIASSGNEAL 453

Query: 491 XXXXXXHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRART 550
                   LTTSANL EAR+P Y+R FSDELS+LT+TFNTMTDALDQHYALLEDRVRART
Sbjct: 454 SDKSKG--LTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRART 511

Query: 551 KQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFR 610
           +QL             KTVFIANISHELRTPLNGILGMTAISMEE D++KI+N+LKLIFR
Sbjct: 512 RQLEAAKIDAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFR 571

Query: 611 SGXXXXXXXXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFP 670
           SG            FSKNVL+RTKLE+R+F +TDVALQIKSIFGKVAKDQRVRLSI+L+P
Sbjct: 572 SGELLLHILTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYP 631

Query: 671 NLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVH 730
           NLIRTMVL+GDSNRIIQIVMNLVSNALKFTPVDG V+V M LLGEYD + SE    K+V+
Sbjct: 632 NLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVY 691

Query: 731 VKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANE 790
           V  GTE     +  D++D    +  ++  ++E+T    +S   NS+ +   T+     N+
Sbjct: 692 VIPGTE----PKGNDEKD-KGGIEEKERFSIENTPNDTSS---NSSNKHSDTETTPGLND 743

Query: 791 NIYKKAND-----REKXXXXXXXXXXXXXXXXXXXAIFNSQFNKALDSDSDESGNVGRPI 845
              K+A+D      E                     +F+SQF K      D S  +G  +
Sbjct: 744 TDEKQASDDMDGGEEDVEDADEVSSFSTSTSSYNDTVFHSQFKKTPKVCDDSSEELGVEV 803

Query: 846 ENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMH 905
           ++ K WVISI VEDTGPGI+ SL ESVF+PFVQGDQ LSRQYGGTGLGLSICRQLA MM+
Sbjct: 804 KDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMN 863

Query: 906 GTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVA 960
           GTM L+S++GVGS+FTFT+PL QT+EI+F +I   FEDEFNP+SKKNR+VKF +A
Sbjct: 864 GTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFKIA 918

 Score =  235 bits (600), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 132/166 (79%), Gaps = 6/166 (3%)

Query: 1056 SVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDN 1115
            SV +DRPFLQSTGTA+S+ N+ T        T  KILV EDN VNQEVI+RMLNLEG+ N
Sbjct: 955  SVRLDRPFLQSTGTASSNTNLGTTS------TINKILVAEDNDVNQEVIKRMLNLEGVHN 1008

Query: 1116 IELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTA 1175
            IEL CDGQEA DKVK+L   GE+YN+IFMDVQMPK+DGLLSTKMIRRDL Y  PIVALTA
Sbjct: 1009 IELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTA 1068

Query: 1176 FADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAYQGKKNKK 1221
            FADDSNI+ECL++GM+GFL+KPIKR +L  I+ EFC   Q ++  K
Sbjct: 1069 FADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEFCPDKQPQEQDK 1114

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1259

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/736 (60%), Positives = 530/736 (72%), Gaps = 19/736 (2%)

Query: 499  LTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXX 558
            LTTSANL EAR+PDY+RLFSDELSDLT+TFNTMTDALDQHYALLEDRVRARTKQL     
Sbjct: 520  LTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKI 579

Query: 559  XXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXX 618
                    KTVFIANISHELRTPLNGILGMTAISMEETD++KIR++LKLIFRSG      
Sbjct: 580  EAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSGELLLHI 639

Query: 619  XXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVL 678
                  FSKNVL+RT LE+RDFCITDVALQIKSIFGKVAKDQRV+LSI+L PN IRTMVL
Sbjct: 640  LTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVL 699

Query: 679  WGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEIT 738
            +GDSNRIIQIVMNLVSNALKFTPVDG V+V++KL+GEYD+  S K  FKEV+VK+GTE+ 
Sbjct: 700  YGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELL 759

Query: 739  DVVESIDKRDLPTSLGRRKYVNLESTTA------SITSCRDNSA---IQEEITKRNTAAN 789
                 I+K +      + +  N  STT+      S TS  D  +   + +E      A N
Sbjct: 760  GCSNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDEKSADDLDDEKIATKDAEN 819

Query: 790  ENIYKKAN-DREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKALD-SDSDESGNVGRPIEN 847
            EN     N D +                    AIFNSQF K+    D DE+ + G  IE+
Sbjct: 820  ENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIED 879

Query: 848  PKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGT 907
            PKTWVI I VEDTGPGI+ +LQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGT
Sbjct: 880  PKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGT 939

Query: 908  MKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQ 967
            MKL+S+VGVGS FTFT+PL QT+EI+F ++E PFEDEFNPES+KNR+VKF +A+SI+S++
Sbjct: 940  MKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKLARSIRSKK 999

Query: 968  STSSLTT--PVTNSNTLA-NDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQPQEK 1024
            S +S  T   VT+ N +  N+  I+  S        + +    +   + N          
Sbjct: 1000 SRASTVTFGTVTDLNHVPENEEEIKNGSQASVGSSGSSSSDGEESNNSNNSTTHHSEDRT 1059

Query: 1025 NTKHSVSFSSAERSSQKTVSSKRRSQEENLGS--VNIDRPFLQSTGTATSSRNVPTVQGG 1082
            NT  + + ++      K       +   N G   V++DRPFLQSTGTATSSRNVP +   
Sbjct: 1060 NTSENTNNNNIHEKEHKHKHEHTHNHSHNHGDYPVSLDRPFLQSTGTATSSRNVPVLSES 1119

Query: 1083 DKD---GTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENY 1139
            +KD     +IKILV EDNHVNQEVI+RMLNLEG++ I+LACDGQEAFDKVK L+ + ++Y
Sbjct: 1120 NKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSY 1179

Query: 1140 NMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIK 1199
            N+IFMDVQMPKVDGLLSTKMIR+DL Y  PIVALTAFADDSNIKECLESGMNGFLSKPIK
Sbjct: 1180 NIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIK 1239

Query: 1200 RPKLNTILSEFCAAYQ 1215
            RPKL TI+ E+C  ++
Sbjct: 1240 RPKLRTIIKEYCPGWK 1255

 Score =  556 bits (1432), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 267/380 (70%), Positives = 310/380 (81%)

Query: 3   FRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAA 62
            ++P +    PPFRIGIRAQLTALVSIVA VSL ILA+TTGVYFT+NYKNLRSDRLYIAA
Sbjct: 1   MKIPDKFVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAA 60

Query: 63  QLKSSQVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNL 122
           QLKSSQ+DQTLN          SRD LQ +LT+YVAGNKS +NW DS S++QKFLSSSNL
Sbjct: 61  QLKSSQIDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNL 120

Query: 123 FYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNN 182
           F VA+VYD+SFTTVLN TNNGTGD IP+ +L  L PLST+IPL SSLETTGILTDP++N+
Sbjct: 121 FSVAKVYDASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNS 180

Query: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYN 242
           + YLMSMSLPIFANPS+IL +SRVYGY+T+VMSAEGL++VFNDTTALEKSNVAI+SA YN
Sbjct: 181 STYLMSMSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYN 240

Query: 243 AQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALG 302
                + Y FVF P G    I    + + N +F+SS  R GKGGSLK T  F +KN+A+G
Sbjct: 241 NVSALTAYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIG 300

Query: 303 YSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIV 362
           YSPC+F  VNWVAVVSQ ESVFLSP+TKL KIIAGTV+AIGVFV ++T PL HWAVKPIV
Sbjct: 301 YSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIV 360

Query: 363 RLQKATELITEGRGLRPSTP 382
           RLQKATELI+EGRGL+ + P
Sbjct: 361 RLQKATELISEGRGLKSTNP 380

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/741 (57%), Positives = 505/741 (68%), Gaps = 56/741 (7%)

Query: 500  TTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXX 559
            TT+ NL +AR+P Y+ LF DELSDLTETFNTMTDALDQHYALLE+RVRARTKQL      
Sbjct: 476  TTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIE 535

Query: 560  XXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXXX 619
                   KTVFIANISHELRTPLNGILGMTAISMEETD++KIRN+LKLIFRSG       
Sbjct: 536  AETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHIL 595

Query: 620  XXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLW 679
                 FSKNVL+RTKLE+R+FCITDVALQIKSIFGKVAKDQ VRLSI L PN+IR+MVL+
Sbjct: 596  TELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLY 655

Query: 680  GDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITD 739
            GDSNRIIQIVMNLVSNALKFTPVDG VDVRMK+LG YD+  SEK    +V+VK GTEITD
Sbjct: 656  GDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITD 715

Query: 740  VVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANENIYKKANDR 799
               S++ +      G+ K+    S TAS  +   ++A     T    A   +      D 
Sbjct: 716  STPSLNVKS--EGQGKDKFT---SDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDN 770

Query: 800  EKXXXXXXXXXXXXXXXXXXXAIFNSQFNKALD-SDSDESGNVGRPIENPKTWVISIEVE 858
            E                    AIFNSQF K  +  D D+   +G  +E PKTWVIS EVE
Sbjct: 771  E--------SMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVE 822

Query: 859  DTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGS 918
            D+GPGI+  LQESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MM G M LES+VGVGS
Sbjct: 823  DSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGS 882

Query: 919  KFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQSTSSLTTPVTN 978
            KFTFTLPL QT+EI+FAN+E PFEDEFN +SKKNR+VKF +A+S+ SR+S SS+ T   +
Sbjct: 883  KFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGAS 942

Query: 979  SNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQPQEKNTKHSVSFSSAERS 1038
            S+       +  R+  +    K    +  +   N        P+   T  +++F S    
Sbjct: 943  SHH-----SVHTRTPTKSPRLKCDRSVSDRVVIN-------SPER--TGENITFRSESDD 988

Query: 1039 SQKTVSSKRRSQEENLGSVN----IDRPFLQSTGTATSSRNVP----------------- 1077
                +   R    E L + N    +DRPFLQSTGTATS+R++P                 
Sbjct: 989  HLSHMHRNRDKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNV 1048

Query: 1078 ------TVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKE 1131
                  T +  + +G + KILV EDNHVNQEVI+RML LEG+ +I+LACDGQ+AFDKVK+
Sbjct: 1049 SSSAEQTKKTSEGNG-AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQ 1107

Query: 1132 LTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMN 1191
            L  KG  YN+IFMDVQMPKVDGL STKMIR DL    PIVALTAFADDSNIKECL++GM+
Sbjct: 1108 LQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMD 1167

Query: 1192 GFLSKPIKRPKLNTILSEFCA 1212
            GFLSKPIKR KL TIL EFC+
Sbjct: 1168 GFLSKPIKRTKLKTILKEFCS 1188

 Score =  555 bits (1430), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 271/382 (70%), Positives = 308/382 (80%), Gaps = 1/382 (0%)

Query: 1   MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60
           M FRL S +   PP+R+GIRAQLT LVSIVA++SL ILAVTTGVYFTSNYKNLRSDRLYI
Sbjct: 1   MWFRLRSFTP-KPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYI 59

Query: 61  AAQLKSSQVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120
           AAQLKSSQ+DQ LN          SRD LQ+ L +YVAGNKS+ NW+DS SV++KFL SS
Sbjct: 60  AAQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSS 119

Query: 121 NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180
           NLF VARVYDSSFTTVLN TNN TGDLIPEDVL  L PLST++PLPSSLET GI+T+P+ 
Sbjct: 120 NLFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVK 179

Query: 181 NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240
           N + YLMSMSLPIFANPSIILTDSRVYGY+T+VMSAEGL SVFNDTTALE+S VAI+SA 
Sbjct: 180 NGSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAV 239

Query: 241 YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300
           Y    +   Y FVFPP+G+  SI    FP+ NNTF+SS  R GKGG+LK T  F    LA
Sbjct: 240 YTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLA 299

Query: 301 LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360
           +GYSP +  L NWVA+V+Q ESVF+SPATKL KIIAGTV+ IGVF +L+T PL HWAVKP
Sbjct: 300 VGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKP 359

Query: 361 IVRLQKATELITEGRGLRPSTP 382
           IVRLQKATELITE RGLRP+TP
Sbjct: 360 IVRLQKATELITESRGLRPTTP 381

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/778 (56%), Positives = 525/778 (67%), Gaps = 50/778 (6%)

Query: 455  EENKIP--NNHNDVKISMDGSLNHDL-LAPXXXXXXXXXXXXXXXHILTTSANLTEARLP 511
            E+N  P  ++ +D   + DGSL+HDL  +                  LTTS NL EARLP
Sbjct: 415  EKNHRPAYDSASDSNYATDGSLSHDLQTSQASNRPSDNDRSSSRSRFLTTSTNLNEARLP 474

Query: 512  DYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFI 571
            DY+RLFSDELSDLT TFN MTDALDQHYALLEDRVRARTKQL             KTVFI
Sbjct: 475  DYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFI 534

Query: 572  ANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXXXXXXXXFSKNVLQ 631
            ANISHELRTPLNGILGMTAISMEETD+ KIRN+LKLIFRSG            FSKNVL+
Sbjct: 535  ANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLK 594

Query: 632  RTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMN 691
            RT LE+R+FCITDVALQIKSIFGKVAKDQ VRLSISL PN+IRTMVLWGDSNRIIQIVMN
Sbjct: 595  RTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMN 654

Query: 692  LVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDVVESIDKRDLPT 751
            LVSNALKFTPVDG V+VR+KLLGEYD+++++   FK++H         + +S   +  P 
Sbjct: 655  LVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHT--------IADSDAHQQHPV 706

Query: 752  SLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANENIYKKANDREKXXXXXXXXXX 811
            S          S    +      S+        +   NE  Y + +D             
Sbjct: 707  S---------SSPNGVLVKHLSTSSDSNSNLSDSDKYNEKTYDEDDDEHSITNISDHSDD 757

Query: 812  XXXXXXXXX-----AIFNSQFNKALDSDSDESGNVGRPIENPKTWVISIEVEDTGPGIEP 866
                          A+FN+QF K  D   D +  +G  + + KTWV +IEVEDTGPGI+P
Sbjct: 758  LSSLVSSSTSSYDNALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDP 817

Query: 867  SLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLPL 926
             L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MMHGTMKLES+VGVGSKFTFT+PL
Sbjct: 818  KLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPL 877

Query: 927  HQTKEISFANIEFPFEDEFNPESKKNRRVKF-SVAKSIKSRQSTSSLTTPVTNSNTLAND 985
             QT+ I F   E  FEDEFNPESKKNRRVKF    +S+ SR+S +S+   +TN       
Sbjct: 878  KQTRVIKFDEEEDLFEDEFNPESKKNRRVKFKDSTRSLHSRRSRTSVDR-ITN------- 929

Query: 986  VLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQPQEKNTKHSVSFSSAERSSQKTVSS 1045
                  S D++  E      K  E ++E+   +Q P+  N       + ++ SS  + S 
Sbjct: 930  -----HSGDKQSSEGHSTSFKISEVKDED--IEQSPEPDNLPKVGDENDSKASSSSSKSD 982

Query: 1046 KRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGT-SIKILVVEDNHVNQEVI 1104
              + +EE    V++DRPFLQSTGTATSSRNVPT+     D T   KILV EDNHVNQEVI
Sbjct: 983  NIKEKEE---KVHLDRPFLQSTGTATSSRNVPTMA----DVTMRFKILVAEDNHVNQEVI 1035

Query: 1105 RRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDL 1164
            +RMLNLEGI+NI+LACDGQ+AFDKV+ L  + ++Y+MIFMD+QMPKVDGLLSTKMIRRDL
Sbjct: 1036 KRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDL 1095

Query: 1165 GYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAY-QGKKNKK 1221
             YK  IVALTAFADDSNIKEC+E+GMNGFLSKPIKRPKL  IL E+C  + + KK+K+
Sbjct: 1096 NYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWIEMKKSKE 1153

 Score =  551 bits (1420), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 265/375 (70%), Positives = 307/375 (81%), Gaps = 1/375 (0%)

Query: 6   PSRSDFI-PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQL 64
           P R  F+ PPFRIGIRAQLTALVSIVA +SL ILAVTTGVYFTSNYKNLRSDRLYIAAQL
Sbjct: 8   PRRRRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQL 67

Query: 65  KSSQVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFY 124
           KSSQ+DQ LN          SRD LQ++L SYVAGNK+E+NW +S +V+QKFLSSSNLF+
Sbjct: 68  KSSQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFF 127

Query: 125 VARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTD 184
           ++RVYD  F  VLN TNNGTGD +PE + + LFPLSTD+PLPSSL T G+LTDP++N TD
Sbjct: 128 LSRVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTD 187

Query: 185 YLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQ 244
           YLMSMSLPIFANPSII +D +VYGYIT+VMSAEGL+SVFNDTTALEKSNVAI+SA Y+  
Sbjct: 188 YLMSMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNY 247

Query: 245 GRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYS 304
            +   Y FVFPPYG   SI  R F +++++F++  F+  KGGS+KKT  F TK++A+GY 
Sbjct: 248 TKIDSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYY 307

Query: 305 PCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRL 364
           PCSF  VNWVAVVSQ ESVFLSP+TKLTKII+GTV+ I VFV LLT PL  WAVKPIVRL
Sbjct: 308 PCSFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRL 367

Query: 365 QKATELITEGRGLRP 379
           QKATELI EGRGLRP
Sbjct: 368 QKATELIAEGRGLRP 382

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/725 (53%), Positives = 497/725 (68%), Gaps = 39/725 (5%)

Query: 13  PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72
           PPF I IR QLTALV +VAL+SL ILAV TGVYFTS++K++R++RLY+A+QLK+SQ+DQ 
Sbjct: 19  PPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKASQIDQN 78

Query: 73  LNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132
           L           +RD LQ++LT Y+AGN + +NW D+++ + KFL SSNLF +ARVYDSS
Sbjct: 79  LYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYDSS 138

Query: 133 FTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLP 192
           F  VLNA+NN +G+L+PE VL  LFPLST++ LPSSLE  G+LTDP++N+T YLMSMSLP
Sbjct: 139 FQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSLP 198

Query: 193 IFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHF 252
           IFANPSIIL+ S+VYGYIT+V+SAEGLK+VFNDTTALE S+V ++S  Y+ +  A GYH 
Sbjct: 199 IFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDNRELA-GYHL 257

Query: 253 VFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLVN 312
           VFPPYG    I  + + I N++F+   F+  KGGS+K T+   +K +A+GYSPCS  LV 
Sbjct: 258 VFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLVQ 317

Query: 313 WVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELIT 372
           WVA+++QPES FL P+T+L +II GT +AI V    +T PL+HWAV+PIVRLQKATE+IT
Sbjct: 318 WVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEIIT 377

Query: 373 EGRGLRPSTPRTVXXXXXXXXXXXXXXTAPSSLLQFNTGEACSTTSANXXXXXXXXXXVA 432
            GRGLR     T+                        +  A S +SA           VA
Sbjct: 378 AGRGLRSDNGSTLYSHK-------------------RSSTAESFSSALHPASIRRSGSVA 418

Query: 433 LSTE-----SSMKSAINLG-HEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLAPXXXXX 486
            S++      S K  +N    E++ P    + I NN        D +L   + +P     
Sbjct: 419 RSSKHKYIPESAKGTLNKNDFEEIQP----DGIENNE-------DAAL-QKVHSPTPGSL 466

Query: 487 XXXXXXXXXXHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRV 546
                       +T++ NL EAR+P Y RLFSDELS+LTETFNTMTD LD+HYALLEDRV
Sbjct: 467 FSEQRSARSERYITST-NLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRV 525

Query: 547 RARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLK 606
           RART+QL             KTVFIANISHELRTPLNGILGMTAI+M E D+ K++++LK
Sbjct: 526 RARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLK 585

Query: 607 LIFRSGXXXXXXXXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSI 666
           LIFRSG            FSKNVL+RTKLE RDF + ++ALQ++SIFGK+AKDQ V L+I
Sbjct: 586 LIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTI 645

Query: 667 SLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQF 726
           S+ PN++RTMVLWGDSNRI+QIVMNLVSNALKFTPVDG V+V+  LLGEYD+  +    F
Sbjct: 646 SIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCF 705

Query: 727 KEVHV 731
               V
Sbjct: 706 DRAAV 710

 Score =  232 bits (592), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 138/174 (79%), Gaps = 7/174 (4%)

Query: 1051 EENLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNL 1110
            E ++GSV +DRPFLQSTGTA S+R+V T    +K     K+LV EDN+VNQEVI+RMLNL
Sbjct: 1003 EVSVGSVRVDRPFLQSTGTALSTRSVTTTSVANK----CKVLVAEDNNVNQEVIKRMLNL 1058

Query: 1111 EGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPI 1170
            EG+D+++LACDGQ+AFDKVK     G+ Y++IFMDVQMP+VDGL +T+MIR +L Y  PI
Sbjct: 1059 EGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPI 1118

Query: 1171 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAY---QGKKNKK 1221
            VALTA+ADD NIKEC+++GMNGFL+KPI+RPK+  ILSE+C  Y    G+K  K
Sbjct: 1119 VALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKADGEKKGK 1172

 Score =  210 bits (534), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 119/141 (84%), Gaps = 4/141 (2%)

Query: 821 AIFNSQFNKALDSDSDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGD 880
           AIF+S+  K    ++++    GRP+E+P+   I++EV+DTGPGIEP+LQESVF+PFVQGD
Sbjct: 840 AIFHSRLRKGNSGENED----GRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFVQGD 895

Query: 881 QTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFP 940
           QTLSRQYGGTGLGLSICRQLA MM+G+M L+S+VGVGSKFTFT+PL QTKE+ F   E P
Sbjct: 896 QTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELCFEEDENP 955

Query: 941 FEDEFNPESKKNRRVKFSVAK 961
           FEDEFNP+SKKNR+VKF V+K
Sbjct: 956 FEDEFNPDSKKNRKVKFKVSK 976

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/729 (55%), Positives = 486/729 (66%), Gaps = 78/729 (10%)

Query: 502  SANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXX 561
            S NL +AR+P Y RLFSDELS+LT+TFNTMTD LD+HYALLEDRVRARTKQL        
Sbjct: 474  STNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAE 533

Query: 562  XXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXXXXX 621
                 KTVFIANISHELRTPLNGILGMTAISM E D+ K++N+LKLIFRSG         
Sbjct: 534  AANEAKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTE 593

Query: 622  XXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGD 681
               FSKNVLQRTKLE R+F I DVALQ+KSIFGK+AKDQ V LSI L PN+IRTM+LWGD
Sbjct: 594  LLTFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGD 653

Query: 682  SNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDVV 741
            SNRIIQIVMNLVSNALKF+PVDG V VR+KLLGEYD   S+   + +V +K GTEI D  
Sbjct: 654  SNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDAS 713

Query: 742  ESIDKRDLPTSLGRRKYVNLESTTASITS-CRDNSAIQEE-ITKRNTAANENIYKKAND- 798
             S       +SL   +Y  +++    + S   D+  ++EE I   + ++++   +   D 
Sbjct: 714  AS------KSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADT 767

Query: 799  ------REKXXXXXXXXXXXXXXXXXXXAIFNSQFNK--ALDSDSDESGNVGRPIENPKT 850
                  R                     AI ++Q  K  +  +  D   ++GR +E  KT
Sbjct: 768  DTDTDKRSNSEISDSLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKT 827

Query: 851  WVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKL 910
            WVI+IEVEDTGPGIEP+L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MM GTMKL
Sbjct: 828  WVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKL 887

Query: 911  ESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQSTS 970
            ES+VGVGSKFTFT+PL QT+E+SF ++E PFEDEFN  SKKNR+VKF + K+    +S  
Sbjct: 888  ESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFKMNKNSGGSKSRP 947

Query: 971  SLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQPQEKNTKHSV 1030
            S+ T + NS T   D   E  +  E EV                                
Sbjct: 948  SVNTSL-NSGT---DSTAEKMALSESEV-------------------------------- 971

Query: 1031 SFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSIK 1090
                       +V S R           +DRPFLQSTGTATS+R++ TV+  ++     K
Sbjct: 972  -----------SVGSVR-----------VDRPFLQSTGTATSTRSITTVKSLER---PFK 1006

Query: 1091 ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1150
            ILV EDN+VNQEV++RMLNLEG+ +I+LACDGQEAFDKVK L    ++Y +IFMDVQMP+
Sbjct: 1007 ILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPR 1066

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            VDGLLSTKMIR++L Y  PIVALTAFADDSNIK CL+SGMNGFLSKPIKRPKL ++LSEF
Sbjct: 1067 VDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEF 1126

Query: 1211 CAAYQGKKN 1219
            C  +  K+N
Sbjct: 1127 CPDFVEKRN 1135

 Score =  494 bits (1272), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 237/371 (63%), Positives = 294/371 (79%)

Query: 8   RSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           RS   PPF++GIR QL ALV +VAL+SL ILAVTTGVYFT+NYK+LR+DRL++AAQLKSS
Sbjct: 8   RSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSS 67

Query: 68  QVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVAR 127
           Q+DQ LN          +RD LQ SL  Y AGN +++NW ++  V++KFL SS+LF VAR
Sbjct: 68  QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127

Query: 128 VYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLM 187
           +YDS+F TVLNATNNG+G+L+PE VL NLFPLSTD PL SSL+T+GILTDP++N+T Y+M
Sbjct: 128 IYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVM 187

Query: 188 SMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRA 247
           SMSLPIFA+PSI+LT+S + GYIT+VMSAE LK VFNDTTAL+KS+VAI+SA Y+ Q   
Sbjct: 188 SMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLP 247

Query: 248 SGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCS 307
             YHFVFPP+G    I    F IEN +FI S F + K GS+K+T+ F  K++A+GYSPC 
Sbjct: 248 VSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCL 307

Query: 308 FQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKA 367
           F+ V WVAV+SQPE+VFLSP+T+LT II GT + I VF+ L+T PL HWAVKPIVRLQKA
Sbjct: 308 FKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKA 367

Query: 368 TELITEGRGLR 378
           TE+IT  RGLR
Sbjct: 368 TEIITARRGLR 378

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/729 (54%), Positives = 493/729 (67%), Gaps = 75/729 (10%)

Query: 502  SANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXX 561
            S NL EA +P Y+R F DELS+LT+TFNTMTD LD+HYALLE+RVRARTKQL        
Sbjct: 488  STNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAE 547

Query: 562  XXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXXXXX 621
                 KTVFIANISHELRTPLNGILGMTAI+M ETD+ K++N+LKLIFRSG         
Sbjct: 548  SANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTE 607

Query: 622  XXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGD 681
               FSKNVL+RTKLE RDF + D+ALQIKSIFGK+AKDQ V+LSI+L PN IRT+VLWGD
Sbjct: 608  LLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGD 667

Query: 682  SNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDVV 741
            SNRIIQIVMNLVSNALKFTPVDG VDVR+KLLGEYD   SE   ++EV V  G+E  D  
Sbjct: 668  SNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDF 727

Query: 742  E----SIDKRDLP--TSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANEN---- 791
            E    S     LP  +S G       + +T+  T  ++ S IQ E ++ +T  N+N    
Sbjct: 728  EFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGS-IQVE-SETSTEGNDNDESS 785

Query: 792  -IYKKANDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNKALDS-DSDESGNVGRPIENPK 849
             + +  ++  +                   AIF+SQF K L S DSD   N  R ++ PK
Sbjct: 786  IVLESKHEENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPK 845

Query: 850  TWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMK 909
            TWVIS+EVEDTG GI+PSLQESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MM GTMK
Sbjct: 846  TWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMK 905

Query: 910  LESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQST 969
            L+S+VGVGSKF FT+PL QTKEI F   E  FEDEFN  S+KNR+VKF +  S KS Q+ 
Sbjct: 906  LDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQT- 964

Query: 970  SSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQPQEKNTKHS 1029
                                         +K+K+ I   +G ++N              +
Sbjct: 965  -----------------------------KKSKSSI---DGHSDN--------------N 978

Query: 1030 VSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSI 1089
            VS   A  S++ +V           G+V +DRPFLQSTGTATS+R++ +V     + T  
Sbjct: 979  VSERKASNSTENSV-----------GNVRVDRPFLQSTGTATSTRSISSVAS---EVTRH 1024

Query: 1090 KILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMP 1149
            ++LV EDN+VNQEVI+RML LEG+ ++++ACDGQEA++KV+E+   GE+Y+MIFMDVQMP
Sbjct: 1025 RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMP 1084

Query: 1150 KVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSE 1209
            +VDGLL+TKMIR DL YK PIVALTA+ADDSNIK CLESGM+GFL KPIKRP L  I+++
Sbjct: 1085 RVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKRPLLKKIIAQ 1144

Query: 1210 FCAAYQGKK 1218
            +C+  + ++
Sbjct: 1145 YCSKKEKQR 1153

 Score =  455 bits (1171), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 219/371 (59%), Positives = 279/371 (75%)

Query: 8   RSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           R  F PPF +G+R QL  LV  + ++SLTI+ VTTGVYFT+NYK++R++RL +AAQLKSS
Sbjct: 15  RERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSS 74

Query: 68  QVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVAR 127
           QVDQ LN          +RD LQ +L ++ AGN S DNW  +   ++KFL SS LF  AR
Sbjct: 75  QVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAAR 134

Query: 128 VYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLM 187
           VYD+SF TV+N+TNNG+GD IPE+VL  LFPLS   PL SSL TTGI+TDP+ N T+YL+
Sbjct: 135 VYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLL 194

Query: 188 SMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRA 247
           SMSLP+  NPSIIL  + + GYIT++ SAE LK+V NDT AL+KS+V+I+SA +++    
Sbjct: 195 SMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSL 254

Query: 248 SGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCS 307
           +GYHFVFPP+GT    ++  FPI+N TFI+  F NGK GS+ KTN    +N+A+GYSP +
Sbjct: 255 TGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPT 314

Query: 308 FQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKA 367
           F+LVNWVAVV+QPE VFLSP  +L KIIAGTV AI VF+ LLT P+ HWAV+PIVRLQKA
Sbjct: 315 FKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKA 374

Query: 368 TELITEGRGLR 378
           TE+IT GR L+
Sbjct: 375 TEIITSGRDLK 385

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/714 (53%), Positives = 466/714 (65%), Gaps = 92/714 (12%)

Query: 500  TTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXX 559
            T++ N  + R+P Y+RLF+DELS+LT+TFNTMTD LD+ Y +LEDRVRARTKQL      
Sbjct: 471  TSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAKIQ 530

Query: 560  XXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXXX 619
                   KTVFIANI HELRTPLNGILGMTAI+M E D  KI+N+LKLIFRSG       
Sbjct: 531  AEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLHIL 590

Query: 620  XXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLW 679
                 FSKNVL+RTKLE R F I D+ALQ+KSIFGK+AKDQ V+LSI L PN IRTMVLW
Sbjct: 591  TELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLW 650

Query: 680  GDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITD 739
            GDSNRIIQIVMNLVSNALKFTPVDG VDVR+KL+GEYD   SE   F EV++  GTE+T+
Sbjct: 651  GDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTN 710

Query: 740  VVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANENIYKKANDR 799
               S++  ++PT +   +    E  TA  T  R                      K  D 
Sbjct: 711  --SSVN--NIPTVVEEEEKACEEEPTADDTPER----------------------KKKDS 744

Query: 800  EKXXXXXXXXXXXXXXXXXXXAIFNSQFNKA---LD-SDSDESGNVGRPIENPKTWVISI 855
            E                    A+ ++Q  K    +D  DSD +  + + +E P++WVI I
Sbjct: 745  ETVDDADAISISSSVATSYDDAVLHAQLKKIPTFIDLEDSDNNVTMSK-LEKPRSWVIVI 803

Query: 856  EVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVG 915
            EV+DTGPGIEPSL ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MM GTMKLES+VG
Sbjct: 804  EVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVG 863

Query: 916  VGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQSTSSLTTP 975
             GSKFTFT+PL QT  + F + +  FEDEFN  SKKNR+VKF + +S KSR+        
Sbjct: 864  SGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSRKG------K 917

Query: 976  VTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQPQEKNTKHSVSFSSA 1035
            + NSN         A S  E  +E                               SF  +
Sbjct: 918  MNNSNG--------AGSIAESAIE-------------------------------SFGKS 938

Query: 1036 ERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVE 1095
            E              E + GSV +DRPFLQSTGTATS+R+VPT+   +   +S++ILV E
Sbjct: 939  E-------------SEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAE---SSLRILVAE 982

Query: 1096 DNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLL 1155
            DN+VNQEVI+RML+LEG  NI+LACDG++A+ KV  L  +GE+Y++IFMDVQMP++DGLL
Sbjct: 983  DNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLL 1042

Query: 1156 STKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSE 1209
            +TK++R+ L Y+ PIVALTAFADDSNIKECLESGMN FL+KPIKRP L  IL E
Sbjct: 1043 TTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096

 Score =  318 bits (816), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 176/374 (47%), Positives = 239/374 (63%), Gaps = 12/374 (3%)

Query: 13  PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72
           PPF+ G+R QLT LV I+AL SL ILA TTGVYFTSNY+ LR+DRL++AA+L SSQVDQ+
Sbjct: 15  PPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAARLMSSQVDQS 74

Query: 73  LNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132
           L           ++D +Q++L+ Y AGN+S +NW+++  ++  FL  S  FY+A +YD  
Sbjct: 75  LTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYDEM 134

Query: 133 FTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLP 192
           +  VL+  NN T   + E+ L  L PL  D    +      + T P  N T  LMSM+LP
Sbjct: 135 YQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTLNLMSMTLP 193

Query: 193 IFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHF 252
           + A  S I+    V G++TIVMSA+ + +V NDT+ L +S V+I++   N +G    Y F
Sbjct: 194 VEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKGNLVKYRF 250

Query: 253 VFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTN---NFGT-----KNLALGYS 304
           VFPP  T  S+T+  +PI+N +F+   F N     +  T+   +FG      K +A+GYS
Sbjct: 251 VFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKVAVGYS 310

Query: 305 PCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRL 364
            C F+ ++WVAVVSQ ESVFLSPA KLTKII GTV+ + VF+ ++T  L  WAVKPIVRL
Sbjct: 311 ACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVKPIVRL 370

Query: 365 QKATELITEGRGLR 378
           QKATE I  GRGLR
Sbjct: 371 QKATEFIAAGRGLR 384

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/773 (51%), Positives = 481/773 (62%), Gaps = 95/773 (12%)

Query: 503  ANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXX 562
            + + E ++P Y+RLF DELS+LT+TFNTM+DALDQHYALLE+RVRARTKQL         
Sbjct: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 563  XXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXXXXXX 622
                KTVFIANISHELRTPLNGILGMTAISMEE D++ I+++LKLIFRSG          
Sbjct: 532  ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 623  XXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDS 682
              FSKNVLQRTKLE RDFCITDVALQIKSIFGKVAKDQ V+LSI L PN IRT+VLWGDS
Sbjct: 592  LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 683  NRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTE----IT 738
            NRIIQIVMNLVSNALKFTP+DG V VRM LLGEYDK+ S+   +KEV VK GTE     +
Sbjct: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYS 711

Query: 739  DVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANENIYKKAND 798
             +++ ++   L  +   R   N E     I     N  I       NT  + +I+ +  D
Sbjct: 712  KILQKLNTEKLIATRSARSCDNEERHNELIG--EKNDIISNNHQSSNTTFDISIHNRTRD 769

Query: 799  REKXXXXXXXXXXXXXXXXXXXAIFNSQFNKALDSDSDESGNVGRPIENPKTWVISIEVE 858
                                   +FN QF K       +   +G  I+ PKTWVI IEVE
Sbjct: 770  DTLSLLSTSTSSYDE-------TVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIEVE 822

Query: 859  DTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGS 918
            DTGPGI P+LQESVF+PFVQGDQ LSRQYGGTGLGLSICRQLA MM+GTM LES+VG GS
Sbjct: 823  DTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGS 882

Query: 919  KFTFTLPLHQTKEISFA---NIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQSTSSLTTP 975
            KFTFT+PL QT+EI      +I   F+DEFN  SKKNR+VKF++               P
Sbjct: 883  KFTFTVPLTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKFAI---------------P 927

Query: 976  VTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQPQEKNTKHSVSFSSA 1035
             +   TLAN  L   +S          +F+   +  NE         E++  +S   +S+
Sbjct: 928  SSPGTTLANSSLKSRKSKGS----LNSSFVGEIQNVNE--------AEEDAYNSKDINSS 975

Query: 1036 ERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQG-------------- 1081
                 + +S+   S   N    ++DRPFLQSTGTATS+  +P ++               
Sbjct: 976  GELKIRHIST---STSNNNSIPSLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDE 1032

Query: 1082 --------GDKDGTSIK----------------------ILVVEDNHVNQEVIRRMLNLE 1111
                    G+  GT I+                      ILV EDNHVNQEVI+RML LE
Sbjct: 1033 GKSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEEDEGIRILVTEDNHVNQEVIKRMLKLE 1092

Query: 1112 GIDNIELACDGQEAFDKVKELTS-----KGENYNMIFMDVQMPKVDGLLSTKMIRRDLGY 1166
             + NI+LACDG+EA+ KVKE+TS     K   Y++IFMDVQMP++DGL STK+IR +L Y
Sbjct: 1093 KLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKY 1152

Query: 1167 KSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAYQGKKN 1219
              PIVALTAFAD+SNIKECL+ GM+GFLSKPIKRPKL  IL+EFC  Y  + N
Sbjct: 1153 TKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFCPGYHLQNN 1205

 Score =  494 bits (1273), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 240/379 (63%), Positives = 292/379 (77%), Gaps = 1/379 (0%)

Query: 8   RSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 67
           RS   PP  IGIR QLTALV  VA VSL ILAV TG+YFT NYK++R DRL IAA+LKSS
Sbjct: 8   RSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSS 67

Query: 68  QVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVAR 127
           QVDQTLN           RD LQ+++ +Y AGNKS   W DS  VV+KFLSSS++F ++R
Sbjct: 68  QVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISR 127

Query: 128 VYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLM 187
           +YD++F  V+NATNNGTG+++P DVL  L PLS+  PLP+SL ++G+LTDP++N+T YLM
Sbjct: 128 LYDANFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTTYLM 187

Query: 188 SMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATY-NAQGR 246
           SMSLPI ANPSIILTDS+VYGYITI+MSAE L SV+NDTTALEKSNVAI+S  Y +    
Sbjct: 188 SMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSAS 247

Query: 247 ASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPC 306
            + YHFVFPPYG    I    +P++N +F+     N K GS+ KT  F   ++A+GYSPC
Sbjct: 248 LTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPC 307

Query: 307 SFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQK 366
           SF LV+WVA+VSQPESVFLSP+TKLT+IIAGTV+AI VFV  +T PL+HWAVKPIVRLQK
Sbjct: 308 SFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQK 367

Query: 367 ATELITEGRGLRPSTPRTV 385
           ATELI EGRGLR S+ RT+
Sbjct: 368 ATELIAEGRGLRSSSNRTL 386

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1095

 Score =  541 bits (1395), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 290/494 (58%), Positives = 337/494 (68%), Gaps = 18/494 (3%)

Query: 467 KISMDGSLNHDLLAPXXXXXXXXXXXXXXXHILTTSANLTEARLPDYKRLFSDELSDLTE 526
           + S +GS N+D   P               ++  TS+NL EAR+P Y+  FSDE S+LT+
Sbjct: 418 RASTEGSFNYDQAVPSLNSNAEISSDRTRKYM--TSSNLVEARVPVYRIFFSDEFSELTD 475

Query: 527 TFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGIL 586
           TFNTMT+ALDQHYALLEDRVRARTKQL             KTVFIANISHELRTPLNGIL
Sbjct: 476 TFNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGIL 535

Query: 587 GMTAISMEETDVNKIRNNLKLIFRSGXXXXXXXXXXXXFSKNVLQRTKLERRDFCITDVA 646
           GMTAISMEE D++KI+++LKLIFRSG            FSKNVLQRTKLE+RDF ITDVA
Sbjct: 536 GMTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDVA 595

Query: 647 LQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTV 706
           +QIKSIFGKVAKDQRV+ SI+LFPN IR MVL+GDSNRIIQIVMNLVSNALKFTPVDG V
Sbjct: 596 VQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKV 655

Query: 707 DVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTA 766
            VRM+LLGEYDK  SE   FK V+V  GTE  +     D    P      K  +LE    
Sbjct: 656 SVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRE-----DGLIPPPVKQFEKQEDLEKEKI 710

Query: 767 SITSCRDNSAIQEEITKRNTAANENIYKKANDREKXXXXXXXXXXXXXXXXXXXAIFNSQ 826
           S           EE    + +   N+  K  D ++                    IF++Q
Sbjct: 711 S-------EKHNEEEASTSDSEKTNLDDKTPDSKRSDADDQVSLISISTSSYDDTIFHTQ 763

Query: 827 FNKALDSDSDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQ 886
           F K   S  DE+G++   +E+PK W IS+EVEDTGPGI+PSL ESVF+PFVQGDQ LSRQ
Sbjct: 764 FKKHTSSSGDENGHL---LEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQALSRQ 820

Query: 887 YGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFN 946
           YGGTGLGLSICRQLA MM+GTMKL+S++GVGSKFTFTLPL QT+EI F + E  FEDEFN
Sbjct: 821 YGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTREIEFED-ENAFEDEFN 879

Query: 947 PESKKNRRVKFSVA 960
           P SKKNR+VKF VA
Sbjct: 880 PLSKKNRKVKFKVA 893

 Score =  496 bits (1276), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 244/382 (63%), Positives = 299/382 (78%)

Query: 1   MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60
           MR    ++  F PPFRI IR QLTALVS+VALVSL ILAVTTGVYFTSNYK+LRS+RLY+
Sbjct: 1   MRLGTIAKEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYV 60

Query: 61  AAQLKSSQVDQTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120
           AAQLKSSQ+DQ LN          S+  LQ+SL +YV+GNK++ NWVDS SV+QKFLSSS
Sbjct: 61  AAQLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSS 120

Query: 121 NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180
            LF VARVYD+ F TVLNATNNGTGD++ +DVL  L PLS+++ LP+SLE+ G+LTDP++
Sbjct: 121 ALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVL 180

Query: 181 NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240
           N T YLMSMSLPI+ANPSIILT+SRVYGY+TI+MSA+ LKSV++D TALEKS+V I+SA 
Sbjct: 181 NGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAI 240

Query: 241 YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300
           Y        Y FVF PYGT   I    +PI NN+F+S+  R GK GS ++T+ F  +  A
Sbjct: 241 YKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSA 300

Query: 301 LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360
           +GYSPCSF+ VNWVA++SQ E+VF+ P+T+LTKII G V+ IG FV + T PL HWAV+P
Sbjct: 301 VGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQP 360

Query: 361 IVRLQKATELITEGRGLRPSTP 382
           IVRLQKATE+ITEGRGLR  TP
Sbjct: 361 IVRLQKATEIITEGRGLRSGTP 382

 Score =  248 bits (633), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 139/161 (86%), Gaps = 3/161 (1%)

Query: 1051 EENLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNL 1110
            E ++G+V++DRPFLQSTGTA+SS+NV  V   +K   S +ILV EDNHVNQEVI+RML L
Sbjct: 928  EFSVGNVSLDRPFLQSTGTASSSKNVTVVSNVNK---SYRILVAEDNHVNQEVIKRMLTL 984

Query: 1111 EGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPI 1170
            EGID I+LA DGQ+AFDKVK L  KGE+Y +IFMDVQMPKVDGLL+TKMIR+DL Y+ PI
Sbjct: 985  EGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPI 1044

Query: 1171 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFC 1211
            VALTAFADDSNI+ CLE+GMNGFLSKPIKRPKL TI++++C
Sbjct: 1045 VALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYC 1085

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
           YIL147C (SLN1) - histidine kinase osmosensor that
           regulates an osmosensing MAP kinase cascade and is
           similar to bacterial two-component regulators [contig
           159] FULL
          Length = 1143

 Score =  534 bits (1375), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 278/470 (59%), Positives = 331/470 (70%), Gaps = 23/470 (4%)

Query: 501 TSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXX 560
           TS NL EAR+P YKRLFSDELS+LTETFNTMTD LD+HYALLEDRVRART+QL       
Sbjct: 480 TSTNLIEARVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEA 539

Query: 561 XXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXXXX 620
                 KTVFIANISHELRTPLNGILGMTAI+M E D  K++++LKLIFRSG        
Sbjct: 540 EGANEAKTVFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMT 599

Query: 621 XXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWG 680
               FSKNVL+RTKLE RDF I D+ALQ++SIFGK+AKDQ V L+IS+ PNL+R+MVLWG
Sbjct: 600 ELLTFSKNVLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWG 659

Query: 681 DSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEI-TD 739
           DSNRI+QIVMNLVSNALKFTPVDG VDV+ +LLGEYD++ S+  ++KEV V   TE  T 
Sbjct: 660 DSNRIVQIVMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTS 719

Query: 740 VVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANENIYKKANDR 799
             E+ D++            N ES   S T+     +  E   ++N    +    +A D 
Sbjct: 720 STEAKDEK------------NAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDS 767

Query: 800 EKXXXX-------XXXXXXXXXXXXXXXAIFNSQFNKALDSDSDESGNVGRPIENPKTWV 852
           E                           AIF ++  K  DS S+E    GR +E+PK WV
Sbjct: 768 EAIESSDEDDENEDTKSIGSGNTSSYDDAIFQTRLRK--DS-SNEENEEGRALESPKKWV 824

Query: 853 ISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLES 912
           IS+EV DTGPGI+P+L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MMHGTMKL+S
Sbjct: 825 ISMEVHDTGPGIDPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDS 884

Query: 913 QVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKS 962
           QVGVGSKF+FT+PL QTKE+ F ++E PFEDEFNP+SKKNR+VKF + KS
Sbjct: 885 QVGVGSKFSFTVPLTQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKS 934

 Score =  472 bits (1214), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 222/372 (59%), Positives = 285/372 (76%), Gaps = 1/372 (0%)

Query: 14  PFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQTL 73
           P  + IR QLTALV +VAL+SL ILAV TGVYFTS++K+LR++RL++AAQLKSSQ+DQ L
Sbjct: 20  PLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSSQIDQNL 79

Query: 74  NXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSSF 133
           N          +RD LQ++LT Y+AGN S +NW D+ + + KFL SSNLF +ARVYDSSF
Sbjct: 80  NYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYDSSF 139

Query: 134 TTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLPI 193
             VLN +NNG+G+LIPE++L  LFPLSTD+ LPSSLE TG+LTDP++N + YLMSMSLPI
Sbjct: 140 QDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMSLPI 199

Query: 194 FANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHFV 253
           FANPSIIL+ ++VYGYIT+V+SAEGLKSV+NDTTAL+ S+V I+S  Y+    A GYH V
Sbjct: 200 FANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDHELA-GYHLV 258

Query: 254 FPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLVNW 313
           FPPY     +    + IEN +F+    ++GKGGS+K T  F  K +A+GYSPC+  L  W
Sbjct: 259 FPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTLAQW 318

Query: 314 VAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELITE 373
           VA+++QPE++FLSP+T+L KII GT IAI V   ++T PL+HWAV+PIVRLQKATE+IT 
Sbjct: 319 VAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEIITA 378

Query: 374 GRGLRPSTPRTV 385
           GRGLR     T+
Sbjct: 379 GRGLRSDNSSTL 390

 Score =  236 bits (601), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 109/161 (67%), Positives = 135/161 (83%), Gaps = 4/161 (2%)

Query: 1051 EENLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNL 1110
            E ++GSV +DRPFLQSTGTA S+  V T    D+     KILV EDN+VNQEVI+RMLNL
Sbjct: 970  EVSVGSVRVDRPFLQSTGTALSTTLVTTSSLADRR----KILVAEDNNVNQEVIKRMLNL 1025

Query: 1111 EGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPI 1170
            EG++++ELACDGQ+AFDKVK   + G++Y++IFMDVQMP+VDGL +T+MIR++LGY  PI
Sbjct: 1026 EGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKELGYSHPI 1085

Query: 1171 VALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFC 1211
            VALTAFADDSNIKECL++GMNGFLSKPIKRPK+  IL E+C
Sbjct: 1086 VALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYC 1126

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
           similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  508 bits (1307), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 281/482 (58%), Positives = 336/482 (69%), Gaps = 37/482 (7%)

Query: 499 LTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXX 558
            TTSAN  E R+P Y+RLFSDELS+LT+TFN+MTD LD+HYALLEDRVRARTKQL     
Sbjct: 475 FTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKI 534

Query: 559 XXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXX 618
                   KT+FIANISHELRTPLNGILGMTAI+M E D+ K++N+LKLIFRSG      
Sbjct: 535 QAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHI 594

Query: 619 XXXXXXFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVL 678
                 FSKN+L+R KLE+R+F + DVALQ+KSIFGK+AKDQ V+ SI L PNLIR MVL
Sbjct: 595 LTELLTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVL 654

Query: 679 WGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEIT 738
           WGDSNRIIQIVMNLVSNALKFTPVDG V +R+KLLGEYD++ SEK    EV +K+GTEI+
Sbjct: 655 WGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEIS 714

Query: 739 DVVESIDKRDLPTSLGRRKYVNL--ESTTASITSCRDNSAIQEEITKRNTAANENIYKKA 796
           D     + +++  ++   KYV+   EST  +I +       QE   K + A N ++    
Sbjct: 715 D-----ETKNVFDTITEEKYVSCSGESTDDTIETG------QEGAQKPDKADNISVVSSG 763

Query: 797 NDREKXXXXXXXXXXXXXXXXXXXAIFNSQFNK---ALDSDSDESGNVGRPIENPKTWVI 853
                                   AIF+S+F K    LD D  +  ++G+  E  K WVI
Sbjct: 764 TS------------------SYDDAIFHSRFKKIPAVLDVDEGDLSSIGKS-EKKKVWVI 804

Query: 854 SIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQ 913
           SIEVEDTGPGI+PSLQESVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ MM GTMKL S+
Sbjct: 805 SIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSE 864

Query: 914 VGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQSTSSLT 973
           VGVGSKF FT+PL QT  +   + E  FEDEFN +SK NRRVKF + K  KSRQ  SSL+
Sbjct: 865 VGVGSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQ--SSLS 922

Query: 974 TP 975
            P
Sbjct: 923 VP 924

 Score =  335 bits (859), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 188/371 (50%), Positives = 254/371 (68%), Gaps = 7/371 (1%)

Query: 11  FIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVD 70
           F PP++ G+  QLT LV I+AL SL ILAVTTGVYFT+NYK+LR+DRL +AAQL S+Q++
Sbjct: 23  FRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQLTSAQIN 82

Query: 71  QTLNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYD 130
           QTLN          SRD++Q++L SY  GN S  N  ++  V+ KFL SSN  +   +YD
Sbjct: 83  QTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIFRTHLYD 142

Query: 131 SSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMS 190
           S+F  VL+ + N TG++I +D+L +L PLS++ PLPSS+   G+L++P+ N + + MSMS
Sbjct: 143 SAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSSFFMSMS 202

Query: 191 LPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGY 250
           LP+ A  SI+   S   GYIT+VMSA+ + SV     AL  S V++++  Y+     + Y
Sbjct: 203 LPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDENNILNSY 262

Query: 251 HFVFPP----YGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPC 306
             +FPP       LL I   +FPI NN+F+ + F N   GS+ KTN F   N+A+GY+ C
Sbjct: 263 QVLFPPSIVQVPRLLEI---VFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGYAAC 319

Query: 307 SFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQK 366
           SF+LVNWVAVV+Q E+VFLSP+TKLTKII GTVI I  F+ ++T  + +WAVKPIVRLQK
Sbjct: 320 SFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVRLQK 379

Query: 367 ATELITEGRGL 377
           ATELI  GRGL
Sbjct: 380 ATELIAAGRGL 390

 Score =  220 bits (561), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 130/153 (84%), Gaps = 3/153 (1%)

Query: 1059 IDRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIEL 1118
            +DRPFLQSTGTATS+R++PTV   +   ++ K+LV EDN+VNQEVI+RML LEGI +IEL
Sbjct: 951  VDRPFLQSTGTATSTRSIPTVGSLE---SNFKVLVAEDNNVNQEVIKRMLQLEGIYDIEL 1007

Query: 1119 ACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFAD 1178
            ACDG+EA +KV  LT++ ++YN++FMDVQMPK+DGL++T+ IR++L Y  PIVALTAFAD
Sbjct: 1008 ACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFAD 1067

Query: 1179 DSNIKECLESGMNGFLSKPIKRPKLNTILSEFC 1211
            DSNIK CLESGM+GFLSKPIKR KL  IL E+C
Sbjct: 1068 DSNIKVCLESGMDGFLSKPIKREKLRKILLEYC 1100

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
            YIL147C
          Length = 1140

 Score =  495 bits (1274), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 302/710 (42%), Positives = 409/710 (57%), Gaps = 61/710 (8%)

Query: 507  EARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXX 566
            E ++P Y++LF DEL++LT+TFN M++ALD+HYALLE RV  RTKQL             
Sbjct: 482  EIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAANEA 541

Query: 567  KTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXXXXXXXXFS 626
            KTVFIANISHELRTPLNGILGMT+ S+EE D+ KI++ LKLIFRSG            FS
Sbjct: 542  KTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLTFS 601

Query: 627  KNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFP-NLIRTMVLWGDSNRI 685
            KNVL +TKLE R+F I ++  QIK+IF K+ + Q V+L I L P   +++++ +GDSNRI
Sbjct: 602  KNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSNRI 661

Query: 686  IQIVMNLVSNALKFTP-VDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDVVESI 744
            +Q++MNL+SNA+KFTP V+G V+V M LLGEYD++ S+   + +V +K  T+I  V ES 
Sbjct: 662  LQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQI--VTESG 719

Query: 745  DKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEIT-KRNTAANENIYKKANDREKXX 803
            +           K     +T  +  S R  S   + ++   +T    + +  A+ R    
Sbjct: 720  ELIKSKIRCKITKSTTNMNTATTNNSARIESNTNQYLSPYSHTNTRTHTHPGADSRRNSN 779

Query: 804  XXXXXXXXXXXXXXXXXAIFNSQFNKALDSDSDESGN---VGRPIENPKTWVISIEVEDT 860
                                N  FN+ +  + D   N       IE  K WVI  EV D 
Sbjct: 780  VSTVNNSSISLDSESSKMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVIDN 839

Query: 861  GPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKF 920
            GPGI+ +L +SVF+PFVQGDQTLSRQYGGTGLGLSIC+QL  MM GT++LES++G GSKF
Sbjct: 840  GPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGSKF 899

Query: 921  TFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQSTSSLTTPVTNSN 980
             +T+PL Q             +D  + E   N     SV   I      S  ++  T+S+
Sbjct: 900  IYTIPLLQVGGTK--------KDNDDNEEDHNDNTNSSVDIDIIEDTPVSITSSSQTHSD 951

Query: 981  TLANDVLIEARSSDEEEVEKTKNFIKRKEGENENGKAQQQPQEKNTKHSVSFSSAERSSQ 1040
                  L   +S+   EV    +F    E EN++  A                    S  
Sbjct: 952  ------LNSLQSNSTNEVGLDDSF---SEAENDSTVA--------------------SLD 982

Query: 1041 KTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVN 1100
            K+V  K R   + + +  ID            ++ +P         + +K+LV EDN VN
Sbjct: 983  KSVLQKTRMDAQKVEANEID-------DIDHCNKGIP---------SKLKVLVAEDNLVN 1026

Query: 1101 QEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMI 1160
            QEVI+RML LE I +IELA DG EAF+KVK+     + Y++IFMD+QMPK+DGL ST  I
Sbjct: 1027 QEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMPKMDGLESTTKI 1086

Query: 1161 RRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            R++L Y+  IVALTAFAD+SNIKEC ++GM+GF+ KPIKR  L+T+L EF
Sbjct: 1087 RQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEEF 1136

 Score =  352 bits (902), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/370 (49%), Positives = 246/370 (66%), Gaps = 4/370 (1%)

Query: 13  PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72
           PP+R  +RAQLT LV IVA++SLT LA+ TGVYFT++YK+L  +RLYIA+QLKSSQ+DQT
Sbjct: 19  PPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQLKSSQIDQT 78

Query: 73  LNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132
           LN          SR+ +Q+ + S   G  +    ++S SV+ KF+ +S+LFY   +YD +
Sbjct: 79  LNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTMIYDKN 138

Query: 133 FTTVLNATNNGTGDLIPEDVLDNLFPLS-TDIPLPSSLETTGILTDPIVNNTDYLMSMSL 191
             +++N+TNN +G  +   +L  L PLS T+  +P  +  TGILTDPI+N+T YLMSMSL
Sbjct: 139 LKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNSTKYLMSMSL 198

Query: 192 PI---FANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRAS 248
           PI   ++  + I   S +YGY+T+VMSAE LKSVFNDT  L  S  A++SA Y       
Sbjct: 199 PISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTNDTLPR 258

Query: 249 GYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSF 308
            +HFVFPP+    SI      I+N TF    F   K GS KK      KN A+GY+P +F
Sbjct: 259 YFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNYAIGYAPTNF 318

Query: 309 QLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKAT 368
            L  WVAVV+ P+  F S + KLTKII GTV+ I VFV L++LPL++WAV+PIVRLQ+A+
Sbjct: 319 PLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVRLQRAS 378

Query: 369 ELITEGRGLR 378
           ELIT+ RGLR
Sbjct: 379 ELITKRRGLR 388

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  469 bits (1206), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 240/455 (52%), Positives = 311/455 (68%), Gaps = 47/455 (10%)

Query: 504 NLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXXX 563
           NL + ++P  +R   DELS+LTET+  MTDALD+H  LLE RV+ RTKQL          
Sbjct: 450 NLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESA 509

Query: 564 XXXKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXXXXXXX 623
              KTVFIAN++HELRTPLNGILGMTAI+MEETD+ +I+++LKLI+RSG           
Sbjct: 510 NEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTELL 569

Query: 624 XFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSN 683
            FSKNVL++TKLE+  FC+ D+ALQI+SIFGK++KDQ V+LSI + PN +R+MVLWGD N
Sbjct: 570 TFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQN 629

Query: 684 RIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDVVES 743
           RI+Q++MNLVSNALKFTPVDG + V +KLLGEYDKD S    +K+V++K           
Sbjct: 630 RILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK----------- 678

Query: 744 IDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANENIYKKANDREKXX 803
               ++  S G +          ++ S +D  ++ + I+ ++ A+         D E+  
Sbjct: 679 ----EIRNSNGDKI-----KPLMTLISSKDTMSVADNISNKSVAS---------DTER-- 718

Query: 804 XXXXXXXXXXXXXXXXXAIFNSQF-NKALDSDSDESGNVGRPIENPKTWVISIEVEDTGP 862
                             I++++F N +   D+D++  +G P++  + WVIS+EVEDTGP
Sbjct: 719 -------------STNNTIYSNKFKNGSNFQDTDDA--IGVPLDKKRKWVISVEVEDTGP 763

Query: 863 GIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTF 922
           GIEPSLQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQLAN+MHGTMKLES+VGVGSKF F
Sbjct: 764 GIEPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIF 823

Query: 923 TLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKF 957
           T+PL QT+EI F   E  FEDEFN  SKKNR VKF
Sbjct: 824 TVPLLQTREIEFNGNELVFEDEFNINSKKNREVKF 858

 Score =  425 bits (1092), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 202/363 (55%), Positives = 266/363 (73%)

Query: 14  PFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQTL 73
           P+++ +R QLT LV  VA++SL ILA++TGVYFT NY++LR  +LYIAA+LKSSQ+DQT+
Sbjct: 13  PYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQIDQTI 72

Query: 74  NXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSSF 133
           N           RD ++S+LT Y AGN+S +NW  +  V+  FL SS +F    +YDS F
Sbjct: 73  NLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDSQF 132

Query: 134 TTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLPI 193
             +LN TNN T D IP+DVL +L PLS    LPS L TTG+LTDP++N++ YLMSMSLPI
Sbjct: 133 NLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSLPI 192

Query: 194 FANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHFV 253
            ANPS+ L+DSRV+GY+T+VMSAE +++V NDTTALEKS VA+IS+T         YHFV
Sbjct: 193 IANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYHFV 252

Query: 254 FPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLVNW 313
           FPP+G    I    +P+EN+TF+S  F + +GGS+ K+ +  +K +A+GY PCSF L NW
Sbjct: 253 FPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLANW 312

Query: 314 VAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELITE 373
           V  VSQPE VF+S + KLTKIIAGTVIAI VFV ++T PL+ W+V+PIVRLQKATE+I++
Sbjct: 313 VGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVISK 372

Query: 374 GRG 376
             G
Sbjct: 373 RDG 375

 Score =  182 bits (463), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 104/127 (81%)

Query: 1085 DGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFM 1144
            D  + K+L+VEDN VNQ V+ RML LEGI+N  +ACDGQEA +K+KE+ S+GE Y ++ M
Sbjct: 913  DVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLM 972

Query: 1145 DVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLN 1204
            D+QMPKVDG+ +TK+IR++L Y  PIVALTAFADDSNI+ C +SGM+GFL+KPIKR +L 
Sbjct: 973  DIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLK 1032

Query: 1205 TILSEFC 1211
             IL+EFC
Sbjct: 1033 GILTEFC 1039

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  454 bits (1167), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 240/456 (52%), Positives = 302/456 (66%), Gaps = 36/456 (7%)

Query: 508 ARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLXXXXXXXXXXXXXK 567
            R+P +    +DEL++L ETFN M D+LD+H  LLE+RV+ARTK+L             K
Sbjct: 468 VRVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAK 527

Query: 568 TVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGXXXXXXXXXXXXFSK 627
           TVFIANISHELRTPLNGILGMTAI++EE D  K++ +LKLI+RSG            FSK
Sbjct: 528 TVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSK 587

Query: 628 NVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQ 687
           NVLQ+TKLE+  FCI D+ALQIKSIFGK+AKDQ V  SI + PNLIRTMV +GDSNRIIQ
Sbjct: 588 NVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQ 647

Query: 688 IVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDVVESIDKR 747
           ++MNLVSNALKFTP+DG VDVR+KLLGEYD++ S    + +V++K+GT  T      D  
Sbjct: 648 VIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTG-----DND 702

Query: 748 DLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANENIYKKANDREKXXXXXX 807
            +PT          E  +  I+    +S+I +  +K  T  N+NI  +    +       
Sbjct: 703 AIPT----------EPISDKISFAGGSSSIHDYCSK--TDENDNIKTEIKSDDSTISDYS 750

Query: 808 XXXXXXXXXXXXXAIFNSQFNKALDSDSDESGN--VGRPIENPKTWVISIEVEDTGPGIE 865
                         I  S +      ++   G   +G PI  PK WVIS++VEDTGPGI 
Sbjct: 751 EEN-----------IMGSYY------ENKNPGQELLGVPIPKPKKWVISVDVEDTGPGIS 793

Query: 866 PSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLP 925
           P+LQ+SVF+PFVQGDQTLSRQYGGTGLGLSICRQLA++MHGTM+L+S  G+GSKFTFT+P
Sbjct: 794 PTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVP 853

Query: 926 LHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAK 961
           L Q ++I F+  E  FEDEFN  SKKNR+V F   K
Sbjct: 854 LLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDK 889

 Score =  405 bits (1041), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 198/368 (53%), Positives = 269/368 (73%), Gaps = 1/368 (0%)

Query: 13  PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72
           PP+ + +RAQL  L  IV+++SL IL+++TGVYFT+NYK+LR+++L+IAAQLKSSQ+DQ+
Sbjct: 12  PPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71

Query: 73  LNXXXXXXXXXXSRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132
           LN            D L  +L  Y +GNK+ +NWV+S+S V  FL+SS++F  A +YD++
Sbjct: 72  LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131

Query: 133 FTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLP 192
           F  + N +NNGTG  IP+D++  L PLS+D  LP+S+ T G LTDP++N ++YLMS+SLP
Sbjct: 132 FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191

Query: 193 IFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATY-NAQGRASGYH 251
           IF NPSIIL+DSRVYGY+TI+  A  + +VFNDTTALE SNVAIISA Y N+   A GYH
Sbjct: 192 IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251

Query: 252 FVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLALGYSPCSFQLV 311
           FVFPPYG+  S+    +P+ NN+F+   F     GS+  T  F +  +A+GYS C+F L 
Sbjct: 252 FVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLA 311

Query: 312 NWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRLQKATELI 371
           NWVAVVSQPESVF S   KLTKII+GTV+ I   V  +T  ++++ VKPI++L++ATELI
Sbjct: 312 NWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELI 371

Query: 372 TEGRGLRP 379
           + GRGLRP
Sbjct: 372 SRGRGLRP 379

 Score =  159 bits (402), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 77/133 (57%), Positives = 97/133 (72%)

Query: 1078 TVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGE 1137
            T+   + D    K+L+VEDN VNQEVI+R+L LE I  IE A DGQEA D VK+  S+ +
Sbjct: 929  TISEDNIDQHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKD 988

Query: 1138 NYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKP 1197
             +++IFMD+QMP VDG  +T++IR +L Y  PIVALTAFADDSN KEC  SGMN FL+KP
Sbjct: 989  KFDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKP 1048

Query: 1198 IKRPKLNTILSEF 1210
            IKR +L  I+ EF
Sbjct: 1049 IKRFELKEIIKEF 1061

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 69/120 (57%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1150
            +L+VED+ V  ++  + L   G  ++E+  DG  A + V++       Y+++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPN 384

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            +DG  +T +IR     ++PI+A+T   +D ++   L+ GMN  L+KP  +  L+++L  +
Sbjct: 385  LDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 69/120 (57%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1150
            +L+VED+ V  ++  + L   G  ++E+  DG  A + V++       Y+++ MD+ MP 
Sbjct: 320  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPN 373

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            +DG  +T +IR     ++PI+A+T   +D ++   L+ GMN  L+KP  +  L+++L  +
Sbjct: 374  LDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRY 432

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 87/172 (50%), Gaps = 34/172 (19%)

Query: 1067 TGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAF 1126
            T  + + R  P  +  DK    I +L+VEDN +NQ ++   L    I + E+A +G EA 
Sbjct: 527  TDGSPNYRPSPIKRTRDKVFPKINVLIVEDNIINQAILVSFLKRHRI-SYEIAKNGAEAV 585

Query: 1127 DKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIR-------------------RDLG-- 1165
            +K ++        ++I MD+Q+P + GL +TK IR                   RD    
Sbjct: 586  EKWRQ-----GGIHLILMDLQLPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLD 640

Query: 1166 -----YKSP--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
                 ++SP  IVALTAF+  ++ +E L +G N +L+KP+    L++ ++E+
Sbjct: 641  LDRSKFRSPVIIVALTAFSSHADRREALVAGCNDYLTKPVNLDWLSSKITEW 692

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 68/120 (56%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1150
            +L+VED+ ++ ++  + L   G   +E+  DG  A   +++       Y+++ MD+ MP 
Sbjct: 355  VLLVEDDAISIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKFR-----YDLVLMDIVMPN 408

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            +DG  +T +IR     ++PI+A+T   +D ++   L+ GMN  L+KP  R  L+++L  +
Sbjct: 409  LDGATATSIIRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLIRY 467

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 67/117 (57%), Gaps = 7/117 (5%)

Query: 1091 ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1150
            +L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ MP 
Sbjct: 407  VLLVEDDSVSIQLCSKFLRKYGC-TVQVVTDGLSAISNLEKFR-----YDLVLMDIVMPN 460

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTIL 1207
            +DG  +T ++R     ++PI+A+T   +D ++   L+ GMN  L+KP  R  L++IL
Sbjct: 461  LDGATATSIVRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDLHSIL 516

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 73/135 (54%), Gaps = 11/135 (8%)

Query: 1080 QGGDKDGTSIK----ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSK 1135
            QG D +   ++    +L+VED+ ++ ++  + L   G   +++  DG  A       T +
Sbjct: 390  QGLDLNNVELRKGFHVLLVEDDAISIQLCSKFLRKYGC-TVQVVTDGLSAI-----TTLE 443

Query: 1136 GENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLS 1195
               Y+++ MD+ MP +DG  +T +IR     ++PI+A+T   DD ++   L+ GMN  L+
Sbjct: 444  NSRYDLVLMDIVMPNLDGATATSIIR-SFDNQTPIIAMTGNIDDGDLITYLQHGMNDILA 502

Query: 1196 KPIKRPKLNTILSEF 1210
            KP  R  L+++L  +
Sbjct: 503  KPFTRDDLHSMLIRY 517

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 68/120 (56%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1150
            +L+VED+ V+  +  + L   G   +E+  DG  A   +++       Y+++ MD+ MP 
Sbjct: 383  VLLVEDDAVSIRLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 436

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            +DG  +T +IR +   ++PI+A+T   +D ++   L+ GMN  L+KP  +  L+++L  +
Sbjct: 437  LDGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRY 495

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 68/120 (56%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1150
            +L+VED+ V  ++  + L   G  ++E+  DG  A   +++       Y+++ MD+ MP 
Sbjct: 309  VLLVEDDSVCIQLCSKFLLKYGC-SVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 362

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            +DG  +T ++R     ++PI+A+T   +D ++   LE GMN  L+KP  +  L+++L  +
Sbjct: 363  LDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLIRY 421

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 72/135 (53%), Gaps = 12/135 (8%)

Query: 1081 GGDKDGTSI-----KILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSK 1135
            G D + TS+      +L+VED+ V  ++  + L   G   +E+  DG  A   +++    
Sbjct: 321  GLDTNDTSVLKEGFHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF--- 376

Query: 1136 GENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLS 1195
               Y+++ MD+ MP +DG  +T ++R      +PI+A+T   +D ++   L+ GMN  L+
Sbjct: 377  --RYDLVLMDIVMPNLDGATATSIVR-SFDNHTPIIAMTGNIEDQDLITYLQHGMNDILA 433

Query: 1196 KPIKRPKLNTILSEF 1210
            KP  +  L+++L  +
Sbjct: 434  KPFTKDDLHSMLIRY 448

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 65.1 bits (157), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 84/164 (51%), Gaps = 34/164 (20%)

Query: 1075 NVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTS 1134
            +VP+ Q  D+    I +L+VEDN +NQ ++   L    I + E+A +G EA +K +    
Sbjct: 495  SVPSNQTRDRVFPKINVLIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEAVEKWR---- 549

Query: 1135 KGENYNMIFMDVQMPKVDGLLSTKMIR---RDLG-----------------------YKS 1168
            KG   ++I MD+Q+P + G+ + K IR   R  G                       +++
Sbjct: 550  KG-GIHLILMDLQLPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRA 608

Query: 1169 P--IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            P  IVALTAF+  ++  E L +G N +L+KP+    L+  ++E+
Sbjct: 609  PVIIVALTAFSSHADRNEALVAGCNDYLTKPVNLDWLSNKITEW 652

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 75/143 (52%), Gaps = 28/143 (19%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++R  L    I + ++A +GQEA D+ KE        ++IFMD+Q+
Sbjct: 501  ITVLIVEDNVINQAILRSFLKKHKI-SYKVAKNGQEAVDRWKE-----GGIDLIFMDLQL 554

Query: 1149 PKVDGLLSTKMIRRDLGY-------------------KSP--IVALTAFADDSNIKECLE 1187
            P   G+ + K IR DL                     K+P  IVA TA    ++ +E L 
Sbjct: 555  PVFSGMDAAKKIR-DLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALL 613

Query: 1188 SGMNGFLSKPIKRPKLNTILSEF 1210
            SG N +L+KP+    L+  ++E+
Sbjct: 614  SGCNDYLTKPVNLHWLSKKINEW 636

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 68/120 (56%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1150
            +L+VED+ V  ++  + L   G  ++E+  DG  A       T + + ++++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIS-----TLEKQRFDLVLMDIVMPN 384

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            +DG  +T ++R     ++PI+A+T   DD ++   L+ GMN  L+KP  +  L+++L  +
Sbjct: 385  LDGATATSIVRS-FDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 72/133 (54%), Gaps = 11/133 (8%)

Query: 1082 GDKDGTSIK----ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGE 1137
            GD D   +K    +L+VED+ V+ ++  + L   G   +++  DG  A   +++      
Sbjct: 371  GDVDSNELKKGFHVLLVEDDDVSIQLCSKFLRKYGC-TVQVVTDGLAAISILEKF----- 424

Query: 1138 NYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKP 1197
             ++++ MD+ MP +DG  +T +IR +   ++PI+A+T   +  ++   L+ GMN  L+KP
Sbjct: 425  RFDLVLMDIVMPNLDGATATSIIR-NFDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKP 483

Query: 1198 IKRPKLNTILSEF 1210
              R  L +IL  +
Sbjct: 484  FTRKDLYSILIRY 496

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 66/122 (54%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
              +L+VED+ V  ++  + L   G   +E+  DG  A   +++       Y+++ MD+ M
Sbjct: 376  FHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLAAISTLEKF-----RYDLVLMDIVM 429

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILS 1208
            P +DG  +T ++R      +PI+A+T   +D ++   L+ GMN  L+KP  +  L+++L 
Sbjct: 430  PNLDGATATSIVRS-FDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 488

Query: 1209 EF 1210
             +
Sbjct: 489  RY 490

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/174 (30%), Positives = 83/174 (47%), Gaps = 33/174 (18%)

Query: 1060 DRPFLQSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELA 1119
            D PFL+S     ++ ++      DK    I +LVVEDN +NQ ++   L    I + ++A
Sbjct: 394  DSPFLRSAMETFTTESITR----DKVFPKISVLVVEDNMINQTILSSFLRKHKI-SYKVA 448

Query: 1120 CDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRR-----DLGYKSP----- 1169
             +G EA D+ KE        ++I MD++MP + G+ + K IRR      +G   P     
Sbjct: 449  KNGIEAVDRWKE-----GGMHLILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEH 503

Query: 1170 -------------IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
                         IVALTA    S+  E L +G N +L+KP+    L   ++E+
Sbjct: 504  APAKRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPVNLDWLTRKITEW 557

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 72/129 (55%), Gaps = 13/129 (10%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA D  KE        ++IFMD+Q+
Sbjct: 517  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQL 570

Query: 1149 PKVDGLLSTKMIR-----RDLGYKSP--IVALTAFADDSNIKECLESGMNGFLSKPIKRP 1201
            P + G+ + K IR     R     +P  IVALTA     + ++ L SG N +L+KP+   
Sbjct: 571  PVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLH 630

Query: 1202 KLNTILSEF 1210
             L+  ++E+
Sbjct: 631  WLSKKITEW 639

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 67/120 (55%), Gaps = 7/120 (5%)

Query: 1091 ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1150
            +L+VED+ +  ++  + L   G   +E+  DG  A   +++       Y+++ MD+ MP 
Sbjct: 307  VLLVEDDSICIQLCSKFLMKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVMPN 360

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            +DG  +T ++R     ++PI+A+T   +D ++   L+ GMN  L+KP  +  L+++L  +
Sbjct: 361  LDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 419

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 75/149 (50%), Gaps = 33/149 (22%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA DK KE      N ++IFMD+Q+
Sbjct: 463  INVLIVEDNVINQAILGSFLRKNKI-SYKIAKNGKEAVDKWKE-----GNLHLIFMDLQL 516

Query: 1149 PKVDGLLSTKMIR-----RDLGYKSP----------------------IVALTAFADDSN 1181
            P + G+ + K IR     R +  +S                       IVALTA     +
Sbjct: 517  PVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQED 576

Query: 1182 IKECLESGMNGFLSKPIKRPKLNTILSEF 1210
             +E L SG N +L+KP+    L+  ++E+
Sbjct: 577  KREALISGCNDYLTKPVNLLWLSKKITEW 605

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 77/146 (52%), Gaps = 13/146 (8%)

Query: 1065 QSTGTATSSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQE 1124
            Q++ T  +  N  T++ G        +L+VED+ V+ ++  + L   G   +++  DG  
Sbjct: 359  QNSLTPNAQNNTVTLRKG------FHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVSDGLS 411

Query: 1125 AFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKE 1184
            A   +++       Y+++ MD+ MP +DG  +T ++R     ++PI+A+T    + ++  
Sbjct: 412  AISTLEKYR-----YDLVLMDIVMPNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLIT 465

Query: 1185 CLESGMNGFLSKPIKRPKLNTILSEF 1210
             L+ GMN  L+KP  R  L++IL  +
Sbjct: 466  YLQHGMNDILAKPFTRDDLHSILIRY 491

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 65/117 (55%), Gaps = 7/117 (5%)

Query: 1091 ILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPK 1150
            +L+VED+ V+ ++  + L   G   +E+  DG  A   ++        Y+++ MD+ MP 
Sbjct: 426  VLLVEDDAVSIQLCSKFLRKSGC-TVEVVTDGLAAISILEAF-----RYDLVLMDIVMPN 479

Query: 1151 VDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTIL 1207
            +DG  +T +IR +   ++PI+A+T   +D ++   L+ GM   L+KP  R  L ++L
Sbjct: 480  LDGATATSIIR-NFDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSML 535

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 77/144 (53%), Gaps = 12/144 (8%)

Query: 1072 SSRNVPTVQGGDKDGTSI-----KILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAF 1126
            +  N+ T+ G    G +I      +L+VED+ V+ ++  + L   G   +++  DG  A 
Sbjct: 328  NDENINTIDGDLAQGDTILKKGFNVLLVEDDEVSIQLCSKFLIKYGC-TVQVVTDGLAAI 386

Query: 1127 DKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECL 1186
              +++       ++++ MD+ MP +DG  +T +IR +   ++PI+A+T   +  ++   L
Sbjct: 387  STLEKY-----RFDLVLMDIVMPNLDGATATSIIR-NFDNETPIIAMTGSIEHQDLITYL 440

Query: 1187 ESGMNGFLSKPIKRPKLNTILSEF 1210
            + GMN  L+KP  R  L ++L+ +
Sbjct: 441  QHGMNDILAKPFTRRDLYSMLTRY 464

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 100/221 (45%), Gaps = 35/221 (15%)

Query: 1017 AQQQPQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGT-----AT 1071
            A   P  +      + S  +R S   ++S    +EE +G V    P +Q  G+     A 
Sbjct: 331  ASSPPALEEVSPGAAISPTQRVSPVLMTSAPLVEEE-IGLVPPRDPIVQREGSPFILSAM 389

Query: 1072 SSRNVPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKE 1131
             S    ++   DK    I +LVVEDN +NQ ++   L    I + ++A +G EA D+ KE
Sbjct: 390  ESVTTESITR-DKVFPKISVLVVEDNMINQAILSSFLRKHKI-HYKVAKNGVEAVDRWKE 447

Query: 1132 LTSKGENYNMIFMDVQMPKVDGLLSTKMIRR--------------------DLGYKSP-- 1169
                    ++I MD++MP + G+ + K IR+                     L  K+P  
Sbjct: 448  -----GGMHLILMDLEMPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVI 502

Query: 1170 IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            IVALTA    ++  E L +G N +L+KP+    L   ++E+
Sbjct: 503  IVALTASNSQTDKTEALLAGCNDYLTKPVNLDWLTRKITEW 543

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
              +L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ M
Sbjct: 379  FHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKFR-----YDLVLMDIVM 432

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILS 1208
            P +DG  +T ++R     ++PI+A+T    + ++   L+ GMN  L+KP  R  L++IL 
Sbjct: 433  PNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 491

Query: 1209 EF 1210
             +
Sbjct: 492  RY 493

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
              +L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ M
Sbjct: 378  FHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKF-----RYDLVLMDIVM 431

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILS 1208
            P +DG  +T ++R     ++PI+A+T    + ++   L+ GMN  L+KP  R  L++IL 
Sbjct: 432  PNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 490

Query: 1209 EF 1210
             +
Sbjct: 491  RY 492

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 76/154 (49%), Gaps = 32/154 (20%)

Query: 1083 DKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMI 1142
            DK    I +L+VEDN +NQ ++   L    I   ++A +GQEA D  +E        ++I
Sbjct: 559  DKVFPKINVLIVEDNVINQTILSSFLRKHKI-FYKVAKNGQEAIDVWRE-----GGIHLI 612

Query: 1143 FMDVQMPKVDGLLSTKMIR---RDLGY------KSP-----------------IVALTAF 1176
            FMD+Q+P + G+ + K IR   R+ G       K+P                 IVA TA 
Sbjct: 613  FMDLQLPVLSGIDAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTAS 672

Query: 1177 ADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
               S+ KE L SG N +L+KP+    L+  ++E+
Sbjct: 673  KSQSDKKEALISGCNDYLTKPVNLHWLSNKINEW 706

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 62.0 bits (149), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
              +L+VED+ V+ ++  + L   G   +++  DG  A   +++       Y+++ MD+ M
Sbjct: 379  FHVLLVEDDVVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKFR-----YDLVLMDIVM 432

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILS 1208
            P +DG  +T ++R     ++PI+A+T    + ++   L+ GMN  L+KP  R  L++IL 
Sbjct: 433  PNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 491

Query: 1209 EF 1210
             +
Sbjct: 492  RY 493

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 71/128 (55%), Gaps = 13/128 (10%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA     E+   G   ++IFMD+Q+
Sbjct: 475  INVLIVEDNVINQAILGGFLRKHKI-SYKVAKNGKEAV----EMWKNG-GLHLIFMDLQL 528

Query: 1149 PKVDGLLSTKMIRRDLGYKSP------IVALTAFADDSNIKECLESGMNGFLSKPIKRPK 1202
            P + G+ + K IR D   + P      IVALTA     + +  L SG N +L+KP+    
Sbjct: 529  PVLSGIDAAKQIR-DFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHW 587

Query: 1203 LNTILSEF 1210
            L+  ++E+
Sbjct: 588  LSKKITEW 595

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 68/122 (55%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
              +L+VED+ +  ++  + L ++    +E+  DG  A   +++       ++++ MD+ M
Sbjct: 302  FHVLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKF-----RFDLVLMDIVM 355

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILS 1208
            P +DG  +T ++R     ++PI+A+T   +D ++   L+ GMN  L+KP  +  L+++L 
Sbjct: 356  PNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 414

Query: 1209 EF 1210
             +
Sbjct: 415  RY 416

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 79/165 (47%), Gaps = 37/165 (22%)

Query: 1082 GDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNM 1141
            G+K    I +L+VEDN +NQ ++   L    I + ++A +G+EA DK KE        ++
Sbjct: 504  GEKVFPKINVLIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVDKWKE-----GGLHL 557

Query: 1142 IFMDVQMPKVDGLLSTKMIRRDLGYK----------------------------SP--IV 1171
            IFMD+Q+P + G+ + K IR    +K                            +P  IV
Sbjct: 558  IFMDLQLPVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIV 617

Query: 1172 ALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAYQG 1216
            A TA    ++ +E L SG N +L+KP+    L+  ++E+    QG
Sbjct: 618  AFTASNSLTDKREALISGCNDYLTKPVNLHWLSKKITEW-GCMQG 661

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 65/122 (53%), Gaps = 7/122 (5%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
              +L+VED+ V  ++  + L   G   + +  DG  A   ++        ++++ MD+ M
Sbjct: 416  FHVLLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTAISVLEN-----HRFDLVLMDIVM 469

Query: 1149 PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILS 1208
            P +DG  +T ++R    Y +PI+A+T   +D ++   L+ GMN  L+KP  +  L+++L 
Sbjct: 470  PNLDGATATSIVRNFDNY-TPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLV 528

Query: 1209 EF 1210
             +
Sbjct: 529  RY 530

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 58.5 bits (140), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 74/141 (52%), Gaps = 25/141 (17%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA D  KE        ++IFMD+Q+
Sbjct: 545  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQL 598

Query: 1149 PKVDGLLSTKMIR---RDLGY--------------KSP--IVALTAFADDSNIKECLESG 1189
            P + G+ + + IR   ++ G               K+P  IVALTA     + +  L SG
Sbjct: 599  PVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISG 658

Query: 1190 MNGFLSKPIKRPKLNTILSEF 1210
             N +L+KP+    L+  ++E+
Sbjct: 659  CNDYLTKPVNLHWLSKKITEW 679

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 76/151 (50%), Gaps = 34/151 (22%)

Query: 1088 SIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQ 1147
            +I +L+VEDN +NQ ++   L    I +  +A +G+EA +K KE        ++IFMD+Q
Sbjct: 470  NITVLIVEDNVINQTILASFLRKHKI-SYRIAKNGREAVEKWKE-----GGIHLIFMDLQ 523

Query: 1148 MPKVDGLLSTKMIR-----RDLGYKSPI-----------------------VALTAFADD 1179
            +P + G+ + K IR     + +G ++P+                       VA TA    
Sbjct: 524  LPVMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSL 583

Query: 1180 SNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210
            ++ +E L SG N +L+KP+    L+  ++E+
Sbjct: 584  TDKREALVSGCNDYLTKPVNLHWLSKKITEW 614

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 72/149 (48%), Gaps = 33/149 (22%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE        ++IFMD+Q+
Sbjct: 486  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 539

Query: 1149 PKVDGLLSTKMIR-----------RDLGYKSP----------------IVALTAFADDSN 1181
            P + G+ + K IR           + L    P                IVALTA     +
Sbjct: 540  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMD 599

Query: 1182 IKECLESGMNGFLSKPIKRPKLNTILSEF 1210
             ++ L SG N +L+KP+    L+  ++E+
Sbjct: 600  KRKALVSGCNDYLTKPVNLHWLSKKITEW 628

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 74/149 (49%), Gaps = 33/149 (22%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE        ++IFMD+Q+
Sbjct: 503  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 556

Query: 1149 PKVDGLLSTKMIR-----RDLGY-KSP---------------------IVALTAFADDSN 1181
            P + G+ + K IR       +G  K+P                     IVALTA     +
Sbjct: 557  PVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQMD 616

Query: 1182 IKECLESGMNGFLSKPIKRPKLNTILSEF 1210
             ++ L SG N +L+KP+    L+  ++E+
Sbjct: 617  KRKALLSGCNDYLTKPVNLHWLSKKITEW 645

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 74/149 (49%), Gaps = 33/149 (22%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE        ++IFMD+Q+
Sbjct: 504  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 557

Query: 1149 PKVDGLLSTKMIR-----RDLGY--------------------KSP--IVALTAFADDSN 1181
            P + G+ + K IR       +G                     ++P  IVALTA     +
Sbjct: 558  PVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMD 617

Query: 1182 IKECLESGMNGFLSKPIKRPKLNTILSEF 1210
             ++ L SG N +L+KP+    L+  ++E+
Sbjct: 618  KRKALLSGCNDYLTKPVNLHWLSKKITEW 646

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 74/149 (49%), Gaps = 33/149 (22%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + +LA +GQEA +  KE        ++IFMD+Q+
Sbjct: 493  INVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWKE-----GGLHLIFMDLQL 546

Query: 1149 PKVDGLLSTKMIRR--------------------DLG-----YKSP--IVALTAFADDSN 1181
            P + G+ + K IR                     D G      ++P  IVALTA     +
Sbjct: 547  PVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMD 606

Query: 1182 IKECLESGMNGFLSKPIKRPKLNTILSEF 1210
             ++ L SG N +L+KP+    L+  ++E+
Sbjct: 607  KRKALLSGCNDYLTKPVNLHWLSKKITEW 635

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 75/145 (51%), Gaps = 29/145 (20%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA D  KE        ++IFMD+Q+
Sbjct: 670  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWKE-----GGLHLIFMDLQL 723

Query: 1149 PKVDGLLSTKMIR-----RDLGYK----------------SP--IVALTAFADDSNIKEC 1185
            P + G+ + + IR     + +G +                +P  IVALTA     + ++ 
Sbjct: 724  PVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKRKA 783

Query: 1186 LESGMNGFLSKPIKRPKLNTILSEF 1210
            L SG N +L+KP+    L+  ++E+
Sbjct: 784  LLSGCNDYLTKPVNLHWLSKKITEW 808

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (65%), Gaps = 6/73 (8%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L   GI + ++A DG EA +K KE    G+++ +I MD+Q+
Sbjct: 394  INVLIVEDNAINQAILALFLRKNGI-SYKVAKDGVEAIEKWKE----GDSH-LILMDLQL 447

Query: 1149 PKVDGLLSTKMIR 1161
            P + GL +TK IR
Sbjct: 448  PLLSGLEATKKIR 460

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 75/158 (47%), Gaps = 37/158 (23%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I IL+VEDN +NQ ++   L    I   ++A +G+EA DK KE        ++IFMD+Q+
Sbjct: 565  INILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWKE-----GGIHLIFMDLQL 618

Query: 1149 PKVDGLLSTKMIRR-----DLGYK-----------------------SP--IVALTAFAD 1178
            P + G  + K IR+      +G +                       +P  IVA TA   
Sbjct: 619  PVLSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASNS 678

Query: 1179 DSNIKECLESGMNGFLSKPIKRPKLNTILSEFCAAYQG 1216
             ++ +  L +G N +L+KP+    L+  ++E+    QG
Sbjct: 679  LADKRAALIAGCNDYLTKPVNLHWLSKKITEW-GCMQG 715

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 45/73 (61%), Gaps = 6/73 (8%)

Query: 1089 IKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQM 1148
            I +L+VEDN +NQ ++   L    I + ++A +G+EA DK K+        ++I +D+Q+
Sbjct: 462  INVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVDKWKQ-----GGIHLILLDLQL 515

Query: 1149 PKVDGLLSTKMIR 1161
            P + G+ +TK IR
Sbjct: 516  PILSGIEATKEIR 528

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIEPSLQESVFQPFV-----------QGDQTLSRQ----YGGTGLGLSIC 897
           + I + D G GI+P +++ VF                 D  L  Q      G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 898 RQLANMMHGTMKLESQVGVGS 918
           +    + +GT+ ++S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 36.2 bits (82), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIEPSLQESVFQ-------------PFVQGDQTLSR--QYGGTGLGLSIC 897
           +SI V D G GI P  +  +               P  Q +Q  +   +  G G GL +C
Sbjct: 301 LSIRVRDHGGGIPPEREPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLGFGLPLC 360

Query: 898 RQLANMMHGTMKLESQVGVGS 918
           R  A +  G++ ++S  G+G+
Sbjct: 361 RMYAELFGGSLSIQSLWGLGT 381

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYG---------------GTGLGLSIC 897
           + I + D G GI P +++ +F+      Q  ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 898 RQLANMMHGTMKLESQVGVGS 918
           +    M  G++ ++S  G G+
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGT 397

>TDEL0H02230 Chr8 complement(375714..377006) [1293 bp, 430 aa] {ON}
           Anc_7.222 YIL042C
          Length = 430

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 50/121 (41%), Gaps = 18/121 (14%)

Query: 822 IFNSQFNKALDSDSDESGNVGRPIENP---KTWVISIEVEDTGPGIEPSLQESVFQPFV- 877
           +  + F   ++  + E+    +PIE     K   + I + D G GI P+++E ++     
Sbjct: 300 VLKNSFRAHIEGSTSENDLTEKPIEITIVRKDDEMQIRIRDYGGGISPAVEERMYDYSYS 359

Query: 878 ----QGDQTLSRQY----------GGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFT 923
               +   T +  Y           G G GL +C+   +M  G + ++S +G G+     
Sbjct: 360 TVSEKAKDTGAEAYMIPGEDVNNVSGMGFGLPMCKAYIDMFDGGLDVQSLLGWGTDVYIK 419

Query: 924 L 924
           L
Sbjct: 420 L 420

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 15/81 (18%)

Query: 853 ISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYG---------------GTGLGLSIC 897
           + I + D G GI P +++ +F        T ++  G               G G GL +C
Sbjct: 319 LKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSGMSAYVIPGADVCNVSGMGFGLPMC 378

Query: 898 RQLANMMHGTMKLESQVGVGS 918
           +    M +GT+ ++S  G G+
Sbjct: 379 KAYMEMFNGTLDIQSLWGWGT 399

>KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {ON}
           Anc_7.222 YIL042C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 409

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 41/109 (37%), Gaps = 23/109 (21%)

Query: 837 ESGNVGRPIE----NPKTWVISIEVEDTGPGIEPSLQESVFQ-----------------P 875
           E+G    P+E     P    +++ V D G GI P ++  +F                   
Sbjct: 293 EAGASHHPVEVTLLRPHETELTLRVSDRGGGIPPGVESHIFDYSYTTTTEAADTDTATAQ 352

Query: 876 FVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTL 924
              G+    +   G G GL +CR    +  G + ++S  G G+    T+
Sbjct: 353 MHAGEAV--KSVAGMGFGLPLCRTYLELFDGKIDVQSLWGHGTDVYLTM 399

>Ecym_1444 Chr1 (922983..924599) [1617 bp, 538 aa] {ON} similar to
            Ashbya gossypii AFR500W
          Length = 538

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 942  EDEFNPESKKNRRVKFSVAKSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKT 1001
            EDE +P   + R+V FS    I    S        +N N+++  V   +++  EEE+E T
Sbjct: 447  EDESSPLGSRERKVSFSEVDDIHIIPSPEEENGTTSNKNSISGPVKDRSKNKPEEEIENT 506

Query: 1002 KNFIKRKEGENENGKAQQQPQEKNTKHSVS 1031
            K      E E+E+ K  Q P   N K S++
Sbjct: 507  KLECIPAE-ESESAKNAQPPS--NQKESLA 533

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 11/70 (15%)

Query: 1139 YNMIFMDVQM-----PKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGF 1193
            Y+++ +D  +     P ++ +LS+      + Y  PI+ +T+  +D  +   L+ G+N  
Sbjct: 536  YDLVIIDAHVKFLNVPILESMLSS------IQYHPPIILMTSSLNDQQLIFYLQHGINSI 589

Query: 1194 LSKPIKRPKL 1203
            L KP    KL
Sbjct: 590  LEKPFHSHKL 599

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 116,556,800
Number of extensions: 4928691
Number of successful extensions: 19786
Number of sequences better than 10.0: 385
Number of HSP's gapped: 20778
Number of HSP's successfully gapped: 505
Length of query: 1221
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1100
Effective length of database: 39,606,813
Effective search space: 43567494300
Effective search space used: 43567494300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)