Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.195.702ON1680168082050.0
Suva_9.395.702ON1682168051760.0
YIL149C (MLP2)5.702ON1679168051060.0
Smik_9.205.702ON1682168350520.0
TDEL0B021905.702ON1810176611871e-134
SAKL0E14916g5.702ON1779142310791e-120
Smik_11.3585.702ON1878157410171e-112
ZYRO0G06600g5.702ON1820140610121e-111
Suva_11.3315.702ON189813859641e-105
YKR095W (MLP1)5.702ON187514229125e-99
Ecym_40185.702ON176913919116e-99
KLTH0E01056g5.702ON177113748867e-96
Kwal_55.196975.702ON176013838322e-89
NCAS0A032005.702ON178814178172e-87
KLLA0A00594g5.702ON174814087948e-85
AFR286W5.702ON175812827511e-79
CAGL0G02497g5.702ON178013977118e-75
TBLA0E017305.702ON182011816974e-73
NCAS0G002305.702ON173511876044e-62
NDAI0E050405.702ON197314505464e-55
KNAG0L021405.702ON160811915178e-52
NDAI0F002905.702ON15548015033e-50
KAFR0H002105.702ON14549744239e-41
KAFR0D022205.702ON16746854014e-38
KNAG0C065905.702ON165113063495e-32
Kpol_1043.705.702ON13214792798e-24
TPHA0D046105.702ON11831951786e-12
Skud_11.3345.702ON1885491203e-05
Kpol_2001.755.702ON1006981060.001
NCAS0A025504.268ON71288910.067
TDEL0G045306.16ON958113900.12
KLTH0F16500g5.414ON838258880.20
KAFR0E040105.414ON905141850.42
TPHA0E002305.702ON128457820.84
KLLA0F19085g8.259ON1372179811.1
Suva_13.1992.590ON840109782.4
Kpol_297.32.422ON24382762.8
ZYRO0C00814g7.21ON713101782.9
Suva_2.2638.248ON133586783.2
TPHA0D004208.39ON858100764.8
TPHA0N014102.590ON87474764.9
TPHA0P009302.199ON131188756.7
KLLA0D01045g6.16ON965156748.7
KLLA0C17204g4.46ON768243748.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.19
         (1680 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...  3165   0.0  
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...  1998   0.0  
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...  1971   0.0  
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...  1950   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   461   e-134
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   420   e-120
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   396   e-112
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   394   e-111
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   375   e-105
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   355   5e-99
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   355   6e-99
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   345   7e-96
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   325   2e-89
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   319   2e-87
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   310   8e-85
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   293   1e-79
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   278   8e-75
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   273   4e-73
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   237   4e-62
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   214   4e-55
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   203   8e-52
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   198   3e-50
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   167   9e-41
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   159   4e-38
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   139   5e-32
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   112   8e-24
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    73   6e-12
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...    51   3e-05
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    45   0.001
NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {O...    40   0.067
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...    39   0.12 
KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]...    39   0.20 
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    37   0.42 
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    36   0.84 
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...    36   1.1  
Suva_13.199 Chr13 complement(322643..325165) [2523 bp, 840 aa] {...    35   2.4  
Kpol_297.3 s297 complement(4030..4761) [732 bp, 243 aa] {ON} com...    34   2.8  
ZYRO0C00814g Chr3 complement(61495..63636) [2142 bp, 713 aa] {ON...    35   2.9  
Suva_2.263 Chr2 complement(455349..459356) [4008 bp, 1335 aa] {O...    35   3.2  
TPHA0D00420 Chr4 complement(70327..72903) [2577 bp, 858 aa] {ON}...    34   4.8  
TPHA0N01410 Chr14 complement(310293..312917) [2625 bp, 874 aa] {...    34   4.9  
TPHA0P00930 Chr16 complement(187009..190944) [3936 bp, 1311 aa] ...    33   6.7  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...    33   8.7  
KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some...    33   8.7  

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 3165 bits (8205), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1597/1680 (95%), Positives = 1597/1680 (95%)

Query: 1    MEDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRIS 60
            MEDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRIS
Sbjct: 1    MEDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRIS 60

Query: 61   KLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEG 120
            KLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEG
Sbjct: 61   KLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEG 120

Query: 121  AKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQE 180
            AKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQE
Sbjct: 121  AKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQE 180

Query: 181  KELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQ 240
            KELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQ
Sbjct: 181  KELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQ 240

Query: 241  NKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKE 300
            NKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKE
Sbjct: 241  NKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKE 300

Query: 301  KGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENXXXXXXXXXXXXX 360
            KGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEEN             
Sbjct: 301  KGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENGTTVNTNTAAPTV 360

Query: 361  XKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCST 420
             KLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCST
Sbjct: 361  GKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCST 420

Query: 421  ELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTS 480
            ELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTS
Sbjct: 421  ELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTS 480

Query: 481  PLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKL 540
            PLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKL
Sbjct: 481  PLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKL 540

Query: 541  ETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRVNILTRERDSYKLLASANDNK 600
            ETNEGEADKTVAKIENQT          MESINSKLALRVNILTRERDSYKLLASANDNK
Sbjct: 541  ETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLALRVNILTRERDSYKLLASANDNK 600

Query: 601  THADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFE 660
            THADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFE
Sbjct: 601  THADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFE 660

Query: 661  NFKVLVAEKEAMLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEI 720
            NFKVLVAEKEAMLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEI
Sbjct: 661  NFKVLVAEKEAMLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEI 720

Query: 721  SNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRI 780
            SNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRI
Sbjct: 721  SNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRI 780

Query: 781  KVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTI 840
            KVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTI
Sbjct: 781  KVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTI 840

Query: 841  GRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEE 900
            GRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEE
Sbjct: 841  GRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEE 900

Query: 901  IISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLRE 960
            IISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLRE
Sbjct: 901  IISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLRE 960

Query: 961  GASYLVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMR 1020
            GASYLVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMR
Sbjct: 961  GASYLVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMR 1020

Query: 1021 LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV 1080
            LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV
Sbjct: 1021 LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1081 LIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSI 1140
            LIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSI
Sbjct: 1081 LIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSI 1140

Query: 1141 GDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIYK 1200
            GDLQRANTVPRNKVQCPAV            AQVNILRENNAILHKSLKNVTEKNEAIYK
Sbjct: 1141 GDLQRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYK 1200

Query: 1201 ELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETE 1260
            ELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETE
Sbjct: 1201 ELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETE 1260

Query: 1261 KLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKD 1320
            KLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKD
Sbjct: 1261 KLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKD 1320

Query: 1321 KLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRNAN 1380
            KLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRNAN
Sbjct: 1321 KLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRNAN 1380

Query: 1381 DASDAFXXXXXXXXXXXXXXXXXXTKDFEKKLQDAXXXXXXXXXXXXXXXHIXXXXXXXX 1440
            DASDAF                  TKDFEKKLQDA               HI        
Sbjct: 1381 DASDAFEKIKNNMEEEKNKIIDEKTKDFEKKLQDAVNKSKSNESEVENSEHIEALKKEWL 1440

Query: 1441 XXXXXXTVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSG 1500
                  TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSG
Sbjct: 1441 KEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSG 1500

Query: 1501 SNEEEAEDELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSENKE 1560
            SNEEEAEDELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSENKE
Sbjct: 1501 SNEEEAEDELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSENKE 1560

Query: 1561 NNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNIKSAF 1620
            NNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNIKSAF
Sbjct: 1561 NNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNIKSAF 1620

Query: 1621 AAGTAGNTLKTSDPANVGINEAKVMEIGNTSKRPIQSDTSSDPDSKKFKESPENDLAPKD 1680
            AAGTAGNTLKTSDPANVGINEAKVMEIGNTSKRPIQSDTSSDPDSKKFKESPENDLAPKD
Sbjct: 1621 AAGTAGNTLKTSDPANVGINEAKVMEIGNTSKRPIQSDTSSDPDSKKFKESPENDLAPKD 1680

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 1998 bits (5176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1080/1680 (64%), Positives = 1310/1680 (77%), Gaps = 8/1680 (0%)

Query: 1    MEDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRIS 60
            MEDKISE+LHVPS+SL+G+ +S L+ L K+I +FERSE+EVT+LNV +DEIKSQYYTRIS
Sbjct: 1    MEDKISEYLHVPSKSLQGVNYSILRALCKRIDKFERSEEEVTRLNVLIDEIKSQYYTRIS 60

Query: 61   KLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEG 120
            KL +LL ESSEEK ++ K ++RL + LK ERS+  RKIDALNKQLNAS  TI KL DE G
Sbjct: 61   KLNELLGESSEEKNVSKKELSRLHNLLKNERSKCARKIDALNKQLNASKNTITKLNDERG 120

Query: 121  AKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQE 180
             KEEA   +   +N+D  +  L  ENKLL+RKLLEMENILQ CKSN +SL+ KYDT  QE
Sbjct: 121  VKEEAEVLKAEHQNNDLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQE 180

Query: 181  KELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQ 240
            KEL L+NKKW EE+LS  ++K LVD+VT+TS++QNLEE+LN+TQ + ESVST N+FLL Q
Sbjct: 181  KELILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQ 240

Query: 241  NKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKE 300
            NK+LSH +E+K+LEIKNLKDT N EK++FSKEMTLQK MNDLLRSQLTSFE+ +SL  +E
Sbjct: 241  NKQLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSARE 300

Query: 301  KGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENXXX-XXXXXXXXX 359
            K +D  CKN +H +V ++LID KL+LEKSK+ECQ L+NIV+DCIEE+             
Sbjct: 301  KDNDDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVDPS 360

Query: 360  XXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCS 419
              K+FS+IK LKRQL+KER+QKFQ+QNQ++ F+ ELE KTP L+SFKERTE LE ELK S
Sbjct: 361  VNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQELKNS 420

Query: 420  TELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTT 479
            T+LLET+SLAKRKDEK+LTSL QKIN+ EANIHSLV+QRLDLARQVK+LL NISA+Q   
Sbjct: 421  TDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKA 480

Query: 480  SPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADK 539
            SPLSNDEL+SL+KLLES +  NE+DSQIIITE+LVEF N +ELQEKNMELL+C+R+LADK
Sbjct: 481  SPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELLNCVRVLADK 540

Query: 540  LETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRVNILTRERDSYKLLASANDN 599
            LE +EG+ DK++AK+ENQT          +E +NS L  R++IL+RERDSYKLLASAN N
Sbjct: 541  LENHEGKQDKSLAKLENQTIKEAKDAIIELEHVNSTLESRIDILSRERDSYKLLASANGN 600

Query: 600  KTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEF 659
            K +AD    TEA   KKI+EL+S+LS T+VE+SA++Q LN +LLT KKSQ++G+IALQEF
Sbjct: 601  KIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLTCKKSQSNGQIALQEF 660

Query: 660  ENFKVLVAEKEAMLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYE 719
             NFKVL  EKE +LQ RI+ LKT+LEKQR SA   +     S  T+LS  +NK  SL  E
Sbjct: 661  SNFKVLAIEKENLLQTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCE 720

Query: 720  ISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTR 779
            ISNL K+NT L  MKESLTRDLERCCKEKMQL +KL+ESETSHNEQ L   SK++QY+T+
Sbjct: 721  ISNLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTK 780

Query: 780  IKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETT 839
            IK LEKN +ELN RL SK QEI+TLQ+SKNSQLKWAQNTIDDTEKN+KS+S +LS K+TT
Sbjct: 781  IKNLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTT 840

Query: 840  IGRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYE 899
            I +LSLE+++L  EL+ TKLQYK L+N+SD NTLE  L+KEL+++QI+LKDAHSQI+AYE
Sbjct: 841  IRKLSLEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLKDAHSQIEAYE 900

Query: 900  EIISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLR 959
            EIIST+EN LKELN +L K KE+ + K Q  ++E  AKEEE+S LR+ELDEIR LQPKL+
Sbjct: 901  EIISTDENTLKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPKLK 960

Query: 960  EGASYLVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVM 1019
            EGA  LV QSEK+G+Q QRIQ M  KIDKM  I+E +Q+ E+SQYQ++LK NKDLS  V+
Sbjct: 961  EGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLSALVL 1020

Query: 1020 RLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENS 1079
            RLE E  DYQTELKKTK SL+STQELLD+HE+KWMEEKADYERELISNIEQTESLRVENS
Sbjct: 1021 RLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLRVENS 1080

Query: 1080 VLIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKS 1139
             L+EKID  T  +N +++YL+LVSLFS+LRHER++LETKLTTCKRDLAL +QKNA+LEKS
Sbjct: 1081 ALVEKIDDGTGENNGDKEYLKLVSLFSSLRHERNTLETKLTTCKRDLALAKQKNANLEKS 1140

Query: 1140 IGDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIY 1199
            + D+Q+ + V R  VQC               AQVNIL+ENN IL KSLK VTEKNEAIY
Sbjct: 1141 VNDMQQTHLVSRKDVQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLKKVTEKNEAIY 1200

Query: 1200 KELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNET 1259
            KE  ++Q EIS+LQG L QTKEQVS+NANKVL YESEIEQ KQRY +LSQQQK THK+ET
Sbjct: 1201 KEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQQQKETHKDET 1260

Query: 1260 EKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETK 1319
            EKL N I DL+ KLLN QNANADL +KFNRLKKQAHEKLDASKKQQTALTNE++ELK+ K
Sbjct: 1261 EKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALTNEVDELKDMK 1320

Query: 1320 DKLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRNA 1379
            ++LEE+LH+EESKV++LE KLK+H +Q   VSKD +    KP +EEIE LK+ELQVF+  
Sbjct: 1321 NELEESLHSEESKVLELEAKLKKHLVQAEGVSKDQEEDTSKPLMEEIELLKRELQVFKET 1380

Query: 1380 NDASDAFXXXXXXXXXXXXXXXXXXTKDFEKKLQDAXXXXXXXXXXXXXXXHIXXXXXXX 1439
            +D+SD                    T +FE+KL++A               ++       
Sbjct: 1381 SDSSDTIEKMKEIMEAEKNKIIEEKTTEFERKLEEA--TGKNTGATIENGENMEELKKQW 1438

Query: 1440 XXXXXXXTVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFS 1499
                   T++RIKEAEENLKKRIRLPSEERIQKIISKRK ELEQEF+RKLK N+ S   S
Sbjct: 1439 LKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLS 1498

Query: 1500 GS---NEEEAEDELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKS 1556
                 NE  AED+LWNSPSKG+SEKPSVVT+LI+QKN+ LQEQLKN K  +  ND RP S
Sbjct: 1499 SDKKENEVNAEDDLWNSPSKGNSEKPSVVTNLIRQKNLILQEQLKNPKKGIISNDSRPTS 1558

Query: 1557 ENKENNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNI 1616
             NKEN+IP S  A+N+ P AF+FGKPLF SNTSSFQSF NPFTP+A +F+T G  P FNI
Sbjct: 1559 SNKENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAATSFNT-GVSPVFNI 1617

Query: 1617 KSAFAAGTAGNTLKTSDPANVGINEAKVMEIGNTS-KRPIQSDTSSDPDSKKFKESPEND 1675
            K A A     +T KT    + G NEAK++EIGN S KRPI+++ S D DSKK KE+ +ND
Sbjct: 1618 KPALAVDATVDTFKTPGLNDAGTNEAKIIEIGNNSLKRPIENEVSFDTDSKKVKENSDND 1677

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score = 1971 bits (5106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1063/1680 (63%), Positives = 1272/1680 (75%), Gaps = 7/1680 (0%)

Query: 1    MEDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRIS 60
            MEDKISEFL+VP ESL+G+ +  L++LYKKI +FERSE+EVTKLNV VDEIKSQYY+RIS
Sbjct: 1    MEDKISEFLNVPFESLQGVTYPVLRKLYKKIAKFERSEEEVTKLNVLVDEIKSQYYSRIS 60

Query: 61   KLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEG 120
            KL +LL+ESSE+K    + +N L+DQL EERSR+ R+IDAL KQL+ SHE ++++ DE+ 
Sbjct: 61   KLKQLLDESSEQKNTAKEELNGLKDQLNEERSRYRREIDALKKQLHVSHEAMREVNDEKR 120

Query: 121  AKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQE 180
             KEE   WQ   + +DS    L+KENKLL+RKL+EMENILQ CKSNA+SLQ KYDT+ QE
Sbjct: 121  VKEEYDIWQSRDQGNDSLNDDLNKENKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQE 180

Query: 181  KELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQ 240
            KEL LQ+KK  EE+LSS ++K L +EVTK+S+++NLEEKL Q Q+  ESV TYNKFLL+Q
Sbjct: 181  KELMLQSKKLIEEKLSSFSKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQ 240

Query: 241  NKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKE 300
            NK+LS  VEEK+LE+KNLKDTA+ EK+EFSKEMTLQK MNDLLRSQLTS E+  SLR  E
Sbjct: 241  NKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIE 300

Query: 301  KGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENXXXXXXXXXXXXX 360
            K DD  C+NPEH DV +ELID KL+LEKSK ECQ L+NIV DC +E              
Sbjct: 301  KNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQNIVMDCTKEEEATMTTSAVSPTV 360

Query: 361  XKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCST 420
             KLFS+IK LKRQL+KER+QKFQ+QNQL+DF+LELEHKTP L+SFKERT+ LEHELK ST
Sbjct: 361  GKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRST 420

Query: 421  ELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTS 480
            ELLET+SL KRK E+++TSL QKIN  EANIHSLV+QRLDLARQVK+LL N SAIQ T S
Sbjct: 421  ELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETAS 480

Query: 481  PLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKL 540
            PLS DEL+SLRK+LES N VNE DSQ IITE+LVEF N++ELQEKN+ELL+CIRILADKL
Sbjct: 481  PLSQDELISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKL 540

Query: 541  ETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRVNILTRERDSYKLLASANDNK 600
            E  EG+ DKT+ K+ENQT          +E+IN+K+  R+NIL RERDSYKLLAS  +NK
Sbjct: 541  ENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENK 600

Query: 601  THADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFE 660
             + ++    EA  EKKIREL+++LSST+VE+SAIIQNL  +LL YKKSQ   K  L++FE
Sbjct: 601  ANTNSVTSMEAAREKKIRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFE 660

Query: 661  NFKVLVAEKEAMLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEI 720
            NFK L  EKE ML+E I+HLK +LEKQ+      +   K    T+LS S  KI SL+YEI
Sbjct: 661  NFKGLAKEKERMLEEAIDHLKAELEKQKSWVPSYIHVEKERASTELSQSRIKIKSLEYEI 720

Query: 721  SNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRI 780
            S LKKE    I  KESLTRD E+CCKEK +L ++L ESE SHNE  + F SKE QY  +I
Sbjct: 721  SKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKI 780

Query: 781  KVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTI 840
            K LE NL+ L   L+SK QEI++++S K+SQLKWAQNTIDDTE  +KS+  ELSNKETTI
Sbjct: 781  KELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNKETTI 840

Query: 841  GRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEE 900
             +LS EIENL  ELR TK QYKFL   SD +TLEPTLRKEL+Q Q++LKDA+SQI+AYEE
Sbjct: 841  EKLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKELEQIQVQLKDANSQIQAYEE 900

Query: 901  IISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLRE 960
            IIS+NEN L EL  EL K KE+ + KI+LE KEK A+EE+LS LR EL EIR LQPKL+E
Sbjct: 901  IISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKLKE 960

Query: 961  GASYLVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMR 1020
            GA + V QSEK+ ++ +RIQ+M  KI+KM+ I++  +K+E SQYQS +K NKDLSE V+R
Sbjct: 961  GALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELVIR 1020

Query: 1021 LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV 1080
            LEK+A D Q EL KTK SLYS Q+LLD+HE+KWMEEKADYERELISNIEQTESLRVENSV
Sbjct: 1021 LEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1081 LIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSI 1140
            LIEK+D  T  +N ++ +L+LVSLFSNLRHER+SLETKLTTCKR+LA ++QKN SLEK+I
Sbjct: 1081 LIEKVDD-TAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTI 1139

Query: 1141 GDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIYK 1200
             DLQR  T+   + QC AV             QVNIL+ENNAIL KSLKNVTEKN  IYK
Sbjct: 1140 NDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLKNVTEKNREIYK 1199

Query: 1201 ELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETE 1260
            +L + QEEISRLQ  LIQTKEQVSIN+NK+L YESE+EQCKQRYQDLSQQQK   K + E
Sbjct: 1200 QLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIE 1259

Query: 1261 KLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKD 1320
            KL N I DL+ KL + +NANADLENKFNRLKKQAHEKLDASKKQQ ALTNELNELK  KD
Sbjct: 1260 KLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKD 1319

Query: 1321 KLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRNAN 1380
            KLE++LH E +KV+DL+ KLK H LQ  +VS+DH+   ++  +EEIESLKKELQ+F+ AN
Sbjct: 1320 KLEQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLKKELQIFKTAN 1379

Query: 1381 DASDAFXXXXXXXXXXXXXXXXXXTKDFEKKLQDAXXXXXXXXXXXXXXXHIXXXXXXXX 1440
             +SDAF                  TK+FEKKLQ+                 I        
Sbjct: 1380 SSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQET--LNKSTSSEAEYSKDIETLKKEWL 1437

Query: 1441 XXXXXXTVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVF-- 1498
                  T++RIKEAEENLKKRIRLPSEERIQKIISKRK ELE+EF +KLKEN  SL F  
Sbjct: 1438 KEYEDETLRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLTFLD 1497

Query: 1499 -SGSNEEEAEDELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSE 1557
              GS  E+AE+ELWNSPSKG+SE+PS V   I QKN+K QEQLKNVKN V+FND +    
Sbjct: 1498 NKGSG-EDAEEELWNSPSKGNSERPSAVAGFINQKNLKPQEQLKNVKNDVSFNDSQSMVT 1556

Query: 1558 NKENNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNIK 1617
            NKENNI DS+AA N+    FSFGKP FSSNTSS QSF NPFT S +N +T+  L T NI+
Sbjct: 1557 NKENNIVDSSAAGNKAIPTFSFGKPFFSSNTSSLQSFQNPFTASQSNINTNAPLRTLNIQ 1616

Query: 1618 SAFAAGTAGNTLKTSDPANVGINEAKVMEIGNTSKRPIQSDTSSDPDSKKFKESPENDLA 1677
               A   A N    +D  N   + AK+ EIG+TSKRPI+S TSSDPD+KK KESP ND A
Sbjct: 1617 PEVAVKAAINFSNVTDLTNNSTDGAKITEIGSTSKRPIESGTSSDPDTKKVKESPANDQA 1676

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 1950 bits (5052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1043/1683 (61%), Positives = 1283/1683 (76%), Gaps = 4/1683 (0%)

Query: 1    MEDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRIS 60
            MEDKISEFLHVP ESL+GI +S L++L+KKI  FE  E+EVT+LNV VDEIKSQYY+RIS
Sbjct: 1    MEDKISEFLHVPFESLQGINYSVLRKLFKKIDNFEYFEEEVTRLNVLVDEIKSQYYSRIS 60

Query: 61   KLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEG 120
            KL+KLLNESSE+K I SK ++ LQDQL ++R R  RKIDALNKQL++S + IK+L DE+ 
Sbjct: 61   KLSKLLNESSEQKNIASKELSHLQDQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEKD 120

Query: 121  AKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQE 180
            AKEE+   Q   +N +S ++VLDKENKLL+RKL+EMENILQ+CKSN+VSLQ KYDT  QE
Sbjct: 121  AKEESMIRQSKHQNVNSVQNVLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQE 180

Query: 181  KELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQ 240
            KEL LQNKKWTEE+LSS N K L DE TK S ++NLEEKL Q Q + ES  +Y++ LLDQ
Sbjct: 181  KELMLQNKKWTEEKLSSYNNKTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQ 240

Query: 241  NKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKE 300
            NK+LSH VEEK+LEIKNLKDTA  EK+EFSKEMTLQK MNDLL SQL SFER HS     
Sbjct: 241  NKQLSHSVEEKILEIKNLKDTACIEKTEFSKEMTLQKSMNDLLSSQLASFERDHSSGEIG 300

Query: 301  KGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENXXXXXXXXXXXXX 360
            K DD LCK+P+H +V +EL++ K++ +KS++ECQ L+NI+SD ++E+             
Sbjct: 301  KDDDNLCKDPDHNNVTDELMNTKVQFQKSQDECQRLQNIISDFVQEDKATVDTNGASHTV 360

Query: 361  XKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCST 420
             KLFS+IK L++QL+KERSQKFQ+QNQ++DF+LELEHKTP LVSFKERT+ LEHELK ST
Sbjct: 361  GKLFSDIKVLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRST 420

Query: 421  ELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTS 480
            ELLET+S+AKRKDE++LTSL QKINS EANIH LV+QRLDLARQVK+LL N SAIQ TT 
Sbjct: 421  ELLETISMAKRKDERELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTL 480

Query: 481  PLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKL 540
            PLS D+L+SLRK+LES + VNE D+Q II+E+LVEF NI+ELQEKN+ELL CIR LADKL
Sbjct: 481  PLSKDDLISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKL 540

Query: 541  ETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRVNILTRERDSYKLLASANDNK 600
            E +EG+ D T+A++E QT          +E+ N K+  R+NIL RERDSYKLLAS+ +N 
Sbjct: 541  EFHEGKKDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENN 600

Query: 601  THADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFE 660
             + + +  TE ++EKKI+EL+++LSST+VESSA+IQNL  +L TYKK   D KIA Q+FE
Sbjct: 601  VNVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFE 660

Query: 661  NFKVLVAEKEAMLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEI 720
            NFK+L  EKE++L+ R+N+LKT LEKQ+LS    VQD K  + T+L  S  K   L +EI
Sbjct: 661  NFKMLAKEKESILETRVNNLKTDLEKQKLSVPSFVQDNKVRDSTELLQSRTKTEILMHEI 720

Query: 721  SNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRI 780
            S+LKKE    + +KESLTRDLERCCKEK+QL +KL ESE S NEQ + F SK ++Y  RI
Sbjct: 721  SSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARI 780

Query: 781  KVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTI 840
            K LE++L+ L + L+SK QEIK+LQSSK+SQLKWAQNTIDDTE+ LKSV  ELS KE T+
Sbjct: 781  KQLEESLERLRIELKSKAQEIKSLQSSKDSQLKWAQNTIDDTEEKLKSVLTELSRKEKTV 840

Query: 841  GRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEE 900
              LS +IENL NELR  KL+Y+FL+NTSD +TL+P LRKEL+QTQ+ELKDAHSQ++ YEE
Sbjct: 841  VTLSSKIENLDNELRENKLKYEFLNNTSDASTLQPALRKELEQTQLELKDAHSQVRTYEE 900

Query: 901  IISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLRE 960
            IISTNE  LKELN +L   KED + +I+LE KEK A EEELS LR+ELDEIR LQPKL+E
Sbjct: 901  IISTNEKALKELNSQLASMKEDYDARIELECKEKLANEEELSLLRRELDEIRSLQPKLKE 960

Query: 961  GASYLVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMR 1020
            G   LV QSEK+ +QA++IQEMK KIDKM   ++ Y+KE++SQ+QS +K NK+LSE V R
Sbjct: 961  GTVCLVKQSEKLRNQAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVTR 1020

Query: 1021 LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV 1080
            LEKEA D Q ELKK K SL+ TQ+LLD HEKKWMEEKADYERELISNIEQTESLRVENSV
Sbjct: 1021 LEKEATDSQMELKKLKSSLHKTQDLLDTHEKKWMEEKADYERELISNIEQTESLRVENSV 1080

Query: 1081 LIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSI 1140
            LIEKI   TEGS+ NE YL+LVS FSNLRHER+SLETKLTTCKRDLAL++QKNASLEK+I
Sbjct: 1081 LIEKIGSVTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNI 1140

Query: 1141 GDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIYK 1200
             DLQ      + ++QC AV            AQVN+L+ENNAIL KSLKNVTEKN  IY+
Sbjct: 1141 NDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNREIYE 1200

Query: 1201 ELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETE 1260
            EL   QEE+S+L+  LI+TKEQVS+NANK+L YESE++QCKQRY DLS QQ+   K   E
Sbjct: 1201 ELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIE 1260

Query: 1261 KLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKD 1320
            KL++ I D + KLL+ +N   +LENKFNRLKKQAHEKLDASKKQQTALTNEL ELK  +D
Sbjct: 1261 KLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRD 1320

Query: 1321 KLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRNAN 1380
            KLE++L+++  K VDL+ + KEH +Q G++ +D + +A  P +EEIESLK+ELQVF+NAN
Sbjct: 1321 KLEQDLNSKNFKTVDLDTEPKEHTVQSGDLLRDQEKVASLPLIEEIESLKRELQVFKNAN 1380

Query: 1381 DASDAFXXXXXXXXXXXXXXXXXXTKDFEKKLQDAXXXXXXXXXXXXXXXHIXXXXXXXX 1440
            ++SDAF                  TK+FEKKL++                +I        
Sbjct: 1381 NSSDAFEKLRDNMEEEKNKIINERTKEFEKKLEEIVSKSKSTGKVADNSENIETLKKEWL 1440

Query: 1441 XXXXXXTVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSG 1500
                  T++RI+EAEENLKKRIRLPSEERIQKIISKRK ELE+EF+RKLKEN  SL FS 
Sbjct: 1441 KEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTFSC 1500

Query: 1501 SNEEEAED---ELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSE 1557
              +E  +D   +LWNSPSKG+SE+PSV+TD +KQKNIK+QEQLK  KN V F D R  S 
Sbjct: 1501 DRKETNDDPDEDLWNSPSKGNSERPSVITDFMKQKNIKVQEQLKKAKNGVFFGDSRSSSM 1560

Query: 1558 NKENNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNIK 1617
            NKEN+       D++  S FSFGKPLF S T+SFQSF NPFT S  + +T  SLPTFNI+
Sbjct: 1561 NKENSAL-VKVNDDKAASTFSFGKPLFPSTTTSFQSFQNPFTQSTIDSNTGVSLPTFNIR 1619

Query: 1618 SAFAAGTAGNTLKTSDPANVGINEAKVMEIGNTSKRPIQSDTSSDPDSKKFKESPENDLA 1677
            +   AG A +T KT   AN   +E ++ EIG+T KRP + D SSDP++KK KESPE++ A
Sbjct: 1620 TDLLAGVATDTSKTDGLANNSPDEEEITEIGSTLKRPNEEDASSDPNTKKVKESPEDEPA 1679

Query: 1678 PKD 1680
             KD
Sbjct: 1680 SKD 1682

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  461 bits (1187), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 492/1766 (27%), Positives = 857/1766 (48%), Gaps = 175/1766 (9%)

Query: 4    KISEFLHVPSESLRGI--KHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISK 61
            +I+ FL +  + L+ +   H     L  K+ EF   +    +L+  VDE+K+   +++  
Sbjct: 19   RIAGFLGISDDELKPVLADHVLSDCLVNKLQEFNNLQSNNLRLHATVDELKALCTSKVDS 78

Query: 62   LTK----LLNESSEEKVINSKVMNRLQDQ---LKEERSRHTRKIDALNKQLNAS------ 108
            L K    L+ E+  EK    +  NRL++Q   L +E++    +++ +  +L  +      
Sbjct: 79   LKKETERLIRENDTEK----QRRNRLEEQVSQLTKEKTLALGQMENVKFELQNTIEQKNV 134

Query: 109  -----HETIKKLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVC 163
                  E +K LE++    E +      L ND          NK L+++L+E +N +Q  
Sbjct: 135  LKSNKQEVVKLLEEKISELEASKVESQELVND----------NKNLRQQLMETQNEVQTL 184

Query: 164  KSNAVSLQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQT 223
            K N +  + + +   Q+  +  ++ +W E+ ++S  ++ +       + LQ   +++ + 
Sbjct: 185  KCNGLGDKSELEIVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARL 244

Query: 224  QTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLL 283
            + + +   +  +FLL +N+++S  ++ KL EIK L D  NTEK EFS+EM+L++K+ DL 
Sbjct: 245  KNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQ 304

Query: 284  RSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVA---EELIDAKLKLEKSKEECQLLKNIV 340
              QL SF+    L  +EK +     N +    A   ++L   + +LE+S  E   L+ +V
Sbjct: 305  DEQLQSFKEELRL-TEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVV 363

Query: 341  SDCIEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTP 400
            ++ + ++              KL+ +I  LK+QL+KER QK  +Q Q++ FV+ELE+K P
Sbjct: 364  NEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVP 423

Query: 401  ALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLD 460
             + S KER+  LE EL     LLE  S  K +  ++L S   KI   E N H+L+RQR D
Sbjct: 424  VINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSD 483

Query: 461  LARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNID 520
            LARQV+ LL N +    +  PL+ DE+  ++K++E+EN  NE DSQ IITE+LVEFK+I 
Sbjct: 484  LARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIA 543

Query: 521  ELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRV 580
             LQE+N ELL   R LAD+LE  E  ++  +  +E +T          ++  NS++  +V
Sbjct: 544  TLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKV 603

Query: 581  NILTRERDSYKLLASAN----DNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQ 636
            + + +ERD+YK + S      DN   AD    ++   E  I+ L+ KLS+   E+S   +
Sbjct: 604  STIEKERDAYKAILSQTSQSFDNLGDADRMKDSQENQE-LIKSLEDKLSTLTTETSKNNE 662

Query: 637  NLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQ--------------ERINHLKT 682
             LN ++    +S+T   I+ ++  + + L  ++  +LQ               R + L++
Sbjct: 663  LLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQS 722

Query: 683  QLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLE 742
             L KQ       V  Y           ++K+  L+   +NL  E + L +  +SL R+++
Sbjct: 723  ILSKQEARNGETVNKY--------ISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQ 774

Query: 743  RCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIK 802
            +   E+  L++ +++ +T  +E+  +    +  +   I  LE    EL   + SK+ EIK
Sbjct: 775  KISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIK 834

Query: 803  TLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTK---L 859
              + +K +Q KW Q  ID+   +   +  EL+ K  T+ +L LE+ +L  ++  +     
Sbjct: 835  ASEDAKRAQTKWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIA 894

Query: 860  QYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKA 919
             YK L++  +  T +  LRK+L++T IELK A+SQ + +++I ST E  LK L+ E ++ 
Sbjct: 895  SYKTLNDAGNGETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEER 954

Query: 920  KEDCETKIQLENKEKGAKEEELSHLRKELDEIR---CLQPKLREGASYLVLQ-------S 969
             E  ++  +    EK   E+ +S+L+K +D +     LQ    E     +L+       S
Sbjct: 955  TEALKSNAEKYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESS 1014

Query: 970  EKVGDQA-----QRIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMRLEKE 1024
            E    Q      Q++ +++  +++  A     QK     Y+ EL+ + ++S+ + +L  E
Sbjct: 1015 EHSLGQVKKEYDQKLYQLQKDLEQQTAYANIAQK----NYEEELQKHAEVSKIISQLRSE 1070

Query: 1025 AFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEK 1084
                ++E+++ K S    +E+L+  EK W  +K + +  +     Q +++  +N +L  +
Sbjct: 1071 VQSGRSEIQQLKASEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQ 1130

Query: 1085 IDGATEGSNSNEKYLELVS--LFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGD 1142
            ++  ++     E  L   S  L  +LR ER  LETKLT  KR+  LL QK  +LE  + +
Sbjct: 1131 VELLSKSEREFENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAE 1190

Query: 1143 LQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIYKEL 1202
             ++     +      +              Q+N+LRE+N  L  ++    EKN  +  EL
Sbjct: 1191 ARKKLFKLQENDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSEL 1250

Query: 1203 INMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKL 1262
             ++Q +I  L   L + ++ +     +++    E ++ K+R  D+ ++ +     E  KL
Sbjct: 1251 NHLQSKILPLNSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKL 1310

Query: 1263 HNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKL 1322
               I +L+ +L      N DL ++F RLKKQAHEKL+ASK  Q  L+ E+NEL+ TK K+
Sbjct: 1311 EEEISNLKKELEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKM 1370

Query: 1323 EENLHNEESKVVDLEL------------------------KLKEHGLQVGEVSKDHDSIA 1358
            EE L   ++KV++LE                         + KE  +++GE     + + 
Sbjct: 1371 EEILKETQTKVLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLT 1430

Query: 1359 FKPFVEEIESLKKELQVFRNA-NDA--------SDAFXXXXXXXXXXXXXXXXXXTKDFE 1409
             +   EEI SLK+++++F+   ND+        S+                    T+++ 
Sbjct: 1431 SQ-LNEEINSLKEQVRIFKEKENDSTLEGSQGLSNVVESMKKAFEEEKIKFIQEKTEEYN 1489

Query: 1410 KKLQDAXXXXXXXXXXXX---XXXHIXXXXXXXXXXXXXXTVKRIKEAEENLKKRIRLPS 1466
            KK ++                    +              + +RI+EAEENLKKRIR+P+
Sbjct: 1490 KKFEEEKAKLSSENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPT 1549

Query: 1467 EERIQKIISKRKGELEQEFERKLKENNKSLVFSGSNEEEAED--------------ELWN 1512
            EERI+K++ KRK ELE+EF+R+LKENN  L   G + +E E+              E+  
Sbjct: 1550 EERIKKVLDKRKTELEEEFQRRLKENN--LQPEGGDAKEREELKKQLESEFEAKYKEILA 1607

Query: 1513 SPSKGSSE----KPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSENKENNIP---D 1565
            S  K + E    + ++ + L+++K  KL+ QL +  N         K+      +P   D
Sbjct: 1608 STKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNNPTP-----EKAAATSVGLPTKID 1662

Query: 1566 SAAADNRVPSAFSFG--------KPLFSSNTSSFQSFHNPFTPS-AANFSTDGSLPTFNI 1616
             +  +N      +FG        KP FS   S   S  NPFT +   N +  G  PTF+ 
Sbjct: 1663 ESRTENMATGTPAFGEKVLKLSDKPAFSFQPS---SKSNPFTSALPGNNNVFGMKPTFSF 1719

Query: 1617 KSAFAAGTAGNTLKTSDP--ANVGIN 1640
                   T G++   S P   + G N
Sbjct: 1720 -------TPGSSQPESRPTFGSTGFN 1738

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  420 bits (1079), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 416/1423 (29%), Positives = 751/1423 (52%), Gaps = 134/1423 (9%)

Query: 5    ISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLTK 64
            IS FL + +  +  +  + +++L  K  +F + + +  K +V +DE+KS    R S+  K
Sbjct: 21   ISSFLELDASKVSTLDPAVVRQLSIKANQFGQLKAQNLKYSVTLDELKSSSERR-SEAFK 79

Query: 65   L----LNESSE------------------EKVINSKVMNRLQDQLKEERSRHTRKIDALN 102
            L    +NE++E                  EK   SK +N L+ QL E + +        N
Sbjct: 80   LQLEKINENTESLRKEKDAFEDEKFKLIDEKANASKEVNLLKSQLTELKQQ--------N 131

Query: 103  KQLNASHETIKKLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQV 162
            +   +S + + +L +E+    EAS         D  K +L +  K L++++LE+EN +Q 
Sbjct: 132  EIFRSSKQDVVQLLNEKIGDLEASQ--------DEAKQLL-QNTKTLRKQVLELENEVQT 182

Query: 163  CKSNAVSLQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQ 222
             KSN +  + +    +QE  L   N +W E+ L+S +++         S LQ    +LN 
Sbjct: 183  FKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNS 242

Query: 223  TQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDL 282
             ++E E   + ++ L  +   LS  +++K+ E+K+L+D+++ EK EF++EMTL++++ DL
Sbjct: 243  IRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDL 302

Query: 283  LRSQLTSFERGHSLRPKEKGDDKLCKNPEHID-----VAEELIDAKLKLEKSKEECQLLK 337
            L  Q+ SF+        E   +K   N +H+D     + EELI+ K KLE S+ +   L+
Sbjct: 303  LEKQIESFKTEL-----ESARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLE 357

Query: 338  NIVSDCIEE-------NXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKD 390
              V + +         N              KL  +I  LK++L++ER QK Q+Q Q++ 
Sbjct: 358  ETVDELLSTDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEA 417

Query: 391  FVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEAN 450
            FVLELEHK P L SFKERTE+LE EL     +LE  S  K + E +LTS++ KI  YE  
Sbjct: 418  FVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQ 477

Query: 451  IHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIIT 510
            IHSLVRQR DLA QV+ LL  +S    +  PL+ +E   ++K++ S  +  E+D+Q II+
Sbjct: 478  IHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIIS 537

Query: 511  EKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXME 570
            E+LV F+++ ELQEKNMELL+ IR LADKLE  E E+     ++E++T          ++
Sbjct: 538  ERLVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQ 597

Query: 571  SINSKLALRVNILTRERDSYKLLAS----ANDNKTHADTEGITEATYEKKIRELQSKLSS 626
              N  L  ++ I+ +ERD++K+LAS    +N       +E       E+KI+EL++ LSS
Sbjct: 598  EYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSS 657

Query: 627  TRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKT---Q 683
               ES+  I+ LN ++ +  ++Q D  + L++  + ++L  ++  ++   +   K    +
Sbjct: 658  LTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMENDE 717

Query: 684  LEKQRLSAAPPV--QDYKY-SNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRD 740
            L K+  S    +  QD K    +  L   ++++ +L+ +++N + E   L +++E+L ++
Sbjct: 718  LRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKE 777

Query: 741  LERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQE 800
             E   +E+  + + +++ +T   E+  +    +  +  +   LE  L +   +L++K +E
Sbjct: 778  NESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKSKE 837

Query: 801  IKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQ 860
            I    S+K+SQ KW Q   D   + L +   +LS+K T I  L L++E+L N+L  ++ +
Sbjct: 838  ISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEAR 897

Query: 861  YKFLSNTSDTNTLEP---TLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELK 917
             +  +  + + ++E    TLR+EL++T+I+L DA+SQ++ Y+ +  ++E     +   L+
Sbjct: 898  IQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALE 957

Query: 918  KAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLREGASYLVLQSEKVGDQAQ 977
            ++K +   KI+   KE+   ++++  L+   D+I  L  +L    S    Q   + D  +
Sbjct: 958  QSKAEYTEKIETLTKERDMFKDQVPILK---DQISNLNNELNHQKSQFESQ---ISDYTR 1011

Query: 978  RIQEMKNK---IDKMAAIIE--------------AYQKEESSQYQSELKTNKDLSEWVMR 1020
             ++++K K   +D M A  E              +Y       Y+ EL+ + D+S+ +  
Sbjct: 1012 NLEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISL 1071

Query: 1021 LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV 1080
            L  EA  Y++E +  + +  + ++ L++ E  W ++ +DYE EL    ++ E L  ++ +
Sbjct: 1072 LRAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKI 1131

Query: 1081 LIEKIDGATEGSNSNEKYLELVS-----LFSNLRHERSSLETKLTTCKRDLALLRQK--- 1132
            L ++ID  ++G  ++ + L  +S     L ++LR E+  LETKL    R+  +LRQK   
Sbjct: 1132 LYDQIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKL 1191

Query: 1133 -NASLEKS---IGDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAILHKSL 1188
              + LE S   +  LQRA +         +              Q+N+LRE+N     +L
Sbjct: 1192 IESDLEGSRIELSKLQRAAS-------GNSATLKDQEEIMTQLNQLNLLRESNI----TL 1240

Query: 1189 KNVTEKN-----------EAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEI 1237
            +N  +KN           +A+Y ++  ++ +++ LQ  + +   Q+S+          E 
Sbjct: 1241 RNEAQKNGERSRELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLK-------NEEA 1293

Query: 1238 EQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEK 1297
            E+ KQR QD+  + +     E +KL + + +L+ ++ +  + N +L+ +F RLK+QAHEK
Sbjct: 1294 ERWKQRSQDILHKYERIDPEEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEK 1353

Query: 1298 LDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLELKL 1340
            L+A+K  Q+ LT++LN+LK TK+KLE +L +++ +V +LE K+
Sbjct: 1354 LNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKI 1396

 Score = 57.4 bits (137), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/196 (27%), Positives = 85/196 (43%), Gaps = 49/196 (25%)

Query: 1447 TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSGSNEEEA 1506
            T +RI+E+ E LKKRIRLP+EE+I KI+ K++ ELE EFE  +++  + +  S S     
Sbjct: 1556 TSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSN 1615

Query: 1507 EDELWNSPSKG--------------------------SSEKPSVVTDLIKQKNIKLQEQL 1540
              E+     +                             ++ S+ +  +++K  KL+ Q+
Sbjct: 1616 STEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQI 1675

Query: 1541 KNVKNAVTFNDKR------------------PKSENKENNIPDSAAADNRVPSAFSFGKP 1582
            K   +A+  ND                    P   N+   +P      N  P+ F+FG P
Sbjct: 1676 KAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFN--PAHFAFGMP 1733

Query: 1583 LFSSNTSSFQSFHNPF 1598
             F   TS+  SF NPF
Sbjct: 1734 -FGQTTSN--SFQNPF 1746

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  396 bits (1017), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 439/1574 (27%), Positives = 786/1574 (49%), Gaps = 109/1574 (6%)

Query: 5    ISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLTK 64
            I+ F     E +  I    +K L  K+ +F   + E  ++ V  DE+K+    +I  L K
Sbjct: 24   IASFFGFSFEQVESINSDLIKHLNDKLLQFNELKSENLQITVSFDELKTNSSKKIDNLKK 83

Query: 65   LLNESSEEKVINSKVMNRLQDQLKEERSRHT----------RKIDAL---NKQLNASHET 111
             +    ++     K  +   D+L+ E++  T          R+ D L    K+L  + + 
Sbjct: 84   EMENLIKQNDGIRKERDDTCDKLESEKNEKTKISNELESIKRRADDLIEEKKELQCNQQR 143

Query: 112  IKKLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQ 171
              K+ DE   KE   +  D  R+D+  K         L+  ++++E   Q   ++ ++ +
Sbjct: 144  TLKILDE-RLKELEIARSDNNRSDNECKR--------LRSTIIDLETKQQDLITSDLNSR 194

Query: 172  FKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVS 231
             + +  +QE  +      W E+ L S N++ L         +  +  +LN  +++ +   
Sbjct: 195  AELERKAQELNILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEK 254

Query: 232  TYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSF- 290
            T N  L  +N +LS  ++EKLLEIK+L D  ++EK EFS E+ L++++ DLL SQL +  
Sbjct: 255  TKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVK 314

Query: 291  ERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENXXX 350
            E   S R  E  +D      E  D+ +EL   K +L + K EC  L +I+ +  EE+   
Sbjct: 315  EELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGETDEESGSS 374

Query: 351  XXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTE 410
                          S+   LK+QL+KE+  K  +QNQ++ F+LELEHK P + SFKERT+
Sbjct: 375  TSRSS---------SDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTD 425

Query: 411  LLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLS 470
             LE+EL  +  LLE  S  K    ++L++  +K+   E +I +L++QRLDL RQV+ LL 
Sbjct: 426  TLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLI 485

Query: 471  NISAIQTTTSPLSNDELMSLRKLLESE-NTVNERDSQIIITEKLVEFKNIDELQEKNMEL 529
              S  + +  PL  +E+M ++ +L+++ +T  E DSQ I+TE+LVEF++I ELQEKN EL
Sbjct: 486  TNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTEL 545

Query: 530  LDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRVNILTRERDS 589
            L  +R LAD+LE+NE E+ +++ KIE++T          +++   +L  +V  L +E ++
Sbjct: 546  LKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKECEN 605

Query: 590  YKLLASANDNKTHADTE----GITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTY 645
             K L S N+  +H ++       T+   E +I++LQS +S    ES+  +  LN ++   
Sbjct: 606  SKALLS-NEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDL 664

Query: 646  KKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKTQLEKQR-----LSAAPPVQDYKY 700
              S++D  I L + ++ ++L  E+  +L   ++  K + ++ R     L +    QD K 
Sbjct: 665  YDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKT 724

Query: 701  S-NLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESE 759
               L +    ++K+   + E+ NLK+E    I  +++L +++++   EK  L + +++ +
Sbjct: 725  QETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQ 784

Query: 760  TSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTI 819
            T   E+  +       Y  +I  LE    EL      K+Q IK L+   NS ++W QN I
Sbjct: 785  TLQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKI 844

Query: 820  DDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRK 879
            +  +K+ +S+   +++K+  I +L  ++++L  E+   K++     N  D    + +LRK
Sbjct: 845  EVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRL-HTYNVIDGTINDDSLRK 903

Query: 880  ELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEE 939
            EL++++I L DA+SQI+ Y+E+  TN   LK+++ + +++ +D   +I+    EK + EE
Sbjct: 904  ELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEE 963

Query: 940  ELSHLRKEL----DEIRCLQPKLREGASYL-----VLQSEKVGDQAQRIQEMKNKIDKMA 990
            ++S L++++    +E+      ++E  +       +LQ+     +A +  E ++K+ K+ 
Sbjct: 964  KISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVK-SEYESKLSKIQ 1022

Query: 991  AIIE---AYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQELLD 1047
              ++    Y     + Y+ EL+ + D+S+ +  L ++   Y+ ++     S    +  L 
Sbjct: 1023 KDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTLK 1082

Query: 1048 RHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKID---GATEGSNSNEKYLELVSL 1104
             +E+ W  ++     +L S+  + E L  +N +L ++I+    A +G         L S+
Sbjct: 1083 ENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSI 1142

Query: 1105 FSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRN----KVQCPAVX 1160
              +LR ER  L+TK+T  +RD  +LRQK + ++    +LQ A T   N    + + P + 
Sbjct: 1143 LLSLRRERDILDTKVTVAERDAKMLRQKISLMD---IELQEARTKLDNSRLEEEKRPTII 1199

Query: 1161 XXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTK 1220
                        Q+N+LRE+N  L   L+N  E+   +  EL  ++++I+ ++  L   K
Sbjct: 1200 QQHEDIMEKLN-QLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALK 1258

Query: 1221 EQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNAN 1280
              +     ++   + E+ + K+R QD+ ++ +    ++ EKL + I  L+VKL       
Sbjct: 1259 YSMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQG 1318

Query: 1281 ADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKV------- 1333
            A+ E +FNRL++QA E+L  SK     LT ++N+LK  K KLE++L +  +K+       
Sbjct: 1319 AEAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENAK 1378

Query: 1334 ---------------VDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRN 1378
                            D E   KE   ++ E +  +DS   K   EEI +L++E++  R 
Sbjct: 1379 AEQDNNQLDAIKRLQQDAENSSKEFKTKLEEKATFYDS-TIKKLNEEIITLREEIEKQRR 1437

Query: 1379 A------------NDASDAFXXXXXXXXXXXXXXXXXXTKDFEKKLQDAXXXXXXXXXXX 1426
                         ND S                     TK+  +K+ +A           
Sbjct: 1438 IQQQLQSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQERLNQPSNI- 1496

Query: 1427 XXXXHIXXXXXXXXXXXXXXTVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFE 1486
                +I               V RI+EAEE LKKRIRLP+EE+I KII +++ +LE+EF+
Sbjct: 1497 ----NIDELKIKWKAEHEEEVVNRIREAEEALKKRIRLPTEEKISKIIERKREDLEKEFD 1552

Query: 1487 RKLKENNKSLVFSG 1500
             K++E  K L  SG
Sbjct: 1553 EKVEERIKLLSQSG 1566

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  394 bits (1012), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 386/1406 (27%), Positives = 727/1406 (51%), Gaps = 90/1406 (6%)

Query: 4    KISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLT 63
            K+S F  VP + L  I    L  L  K+ +F   + +  +LNV +DEIK+    R     
Sbjct: 25   KLSAFYGVPEDQLVLIDGGILTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKR----- 79

Query: 64   KLLNESSEEKVINSKVMNRLQD---------QLKEERSRHTRKIDALNKQLNASHETIKK 114
                    E+ + +++ N ++D         Q +EE ++ +R    +  ++ +  E +  
Sbjct: 80   --------EEGLKNEIENLMKDNDSIRLERSQAQEESTQSSRDKQKIQNEVESLQEKLSD 131

Query: 115  LEDE-----EGAKEEASSWQDGLRNDDS----TKHVLDKENKLLQRKLLEMENILQVCKS 165
            L+ E     +  +E  +  ++ ++  +S    ++  LD ++K L++++LE+E  +Q  KS
Sbjct: 132  LDQERETLKQDKREVVAVLEEKIKELESFRTESRKSLD-DSKRLRQQVLELETTVQNLKS 190

Query: 166  NAVSLQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQT 225
              +  Q +  T +Q   +  +N +W EE ++S  ++ +         L  L  +    + 
Sbjct: 191  KELRDQSEIQTITQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKN 250

Query: 226  ENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRS 285
            E +   + N+ +  +N++L+  ++EKL+E+K+L D+   EK EF+ EM++++K+ DLL +
Sbjct: 251  ELQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLEN 310

Query: 286  QLTSFERGHSLRPKEKGDDKLC----KNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVS 341
            Q+ S + G      +K + +L     +N E+  + +ELI  K   E+S+ E   L+ +V 
Sbjct: 311  QVKSLQ-GELNASLDKDNVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQ 369

Query: 342  DCI-----EENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELE 396
            + I     +++                  ++  LK++L+KER QK ++Q Q++ F++ELE
Sbjct: 370  ELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELE 429

Query: 397  HKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVR 456
            +K P + SFKERT +LE EL     LL+  S  K K E++  +L +K+   E++IH+L R
Sbjct: 430  YKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTR 489

Query: 457  QRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEF 516
            QR DLA QV+ LL NIS    +   LS +E+  +++++ +++  +E DSQ +I+E+LVEF
Sbjct: 490  QRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEF 549

Query: 517  KNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKL 576
             NI  LQEKNMELL  +R LA+KLE+ E + +K +   EN T          ++  N+ L
Sbjct: 550  NNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANL 609

Query: 577  ALRVNILTRERDSYKLLASAND---------NKTHADTEGITEATYEKKIRELQSKLSST 627
              +V ILT+E D++K + S N          N T  +  G   ++ E+K+R L+++L+S 
Sbjct: 610  ESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNG---SSDEEKLRTLEARLTSL 666

Query: 628  RVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKT---QL 684
             VESS   + LN ++    +S+T   I L++  + K L  E+  ++Q  +   +    QL
Sbjct: 667  TVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQL 726

Query: 685  EK--QRLSAAPPVQDYKYS-NLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDL 741
             K  Q L +    QD + +  + +L    +K+  L+ +++NL+ E   L + + +   + 
Sbjct: 727  VKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENY 786

Query: 742  ERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEI 801
             +  +E+  L + +S+ +T  +E+       +  Y   +  LE+   +   RL++K +E 
Sbjct: 787  LKLSEERNSLRIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEA 846

Query: 802  KTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQ- 860
            + +++SK +Q++W Q+ +D      + +  EL  K   +  L  E+  L  ++  ++ + 
Sbjct: 847  EDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARI 906

Query: 861  --YKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKK 918
              Y+ LS +    + E +LRKEL++T+I L D +++I  Y+ ++ST E  L +L  +   
Sbjct: 907  QSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYAS 966

Query: 919  AKEDCETKIQLENKEKGAKEEELSHLRKEL---------------DEIRCLQPKLREGAS 963
             K++ + +++    EK   ++ ++ L + +               +E   LQ K+     
Sbjct: 967  GKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKI----- 1021

Query: 964  YLVLQSEKVGDQAQRIQEMKNKIDKMAAIIE---AYQKEESSQYQSELKTNKDLSEWVMR 1020
               L++E  G   Q  +E   +I K+   +E   ++       Y+ EL+ + ++S+ +  
Sbjct: 1022 -ATLETESKGSH-QLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISE 1079

Query: 1021 LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV 1080
            L +++   +  + + K S    +++L+++EK W  +K +YER+L ++ +  E L  +NS+
Sbjct: 1080 LREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSL 1139

Query: 1081 LIEKIDGATEGSNS--NEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEK 1138
            L ++I+  ++ ++   N +  E+  + +NLR ER  L TKLT  +R+   LR   AS+E 
Sbjct: 1140 LYDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVEN 1199

Query: 1139 SIGDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAI 1198
             +   +R  +  + ++   +              Q+N+LRE+N  L  + +   +KN  +
Sbjct: 1200 ELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNREL 1259

Query: 1199 YKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNE 1258
             +EL  ++E I  L+  L      V     ++  Y+ E  + K+R Q++  +       +
Sbjct: 1260 QEELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPED 1319

Query: 1259 TEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKET 1318
             ++L   +  LE KL      N +L+++FNRLKKQAHEKL++SK  QT L+N+LNEL+E 
Sbjct: 1320 HKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREA 1379

Query: 1319 KDKLEENLHNEESKVVDLELKLKEHG 1344
            K +LE     EE KV +L+ +L  HG
Sbjct: 1380 KSELEGKFEAEERKVHELQERLNAHG 1405

 Score = 69.7 bits (169), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 87/274 (31%), Positives = 133/274 (48%), Gaps = 50/274 (18%)

Query: 1448 VKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSGSN----- 1502
            +KRI EAEENLKKRIRLP+EERI++++ K+K  LE+ +++KL+E+  SL  S  N     
Sbjct: 1542 LKRIAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGNNSDLK 1601

Query: 1503 -------EEEAEDELWNSPSKGSSE---KPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDK 1552
                   +E+ E E+     K   E   + ++ + L+++K  KL+ QL    ++   +  
Sbjct: 1602 KQLEKDLQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKVDSPDKSSS 1661

Query: 1553 RPKSENKENNIPD-----SAAADNRVPSAFSFG---------KPLFSSNTSSFQSFHNPF 1598
               S  K  N+P      S   +  VP+    G         KP F  N SSF S  NPF
Sbjct: 1662 ETSSVPKP-NLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKPTF--NFSSF-SGGNPF 1717

Query: 1599 TPSAANFSTDGSL-----PTFNIK--SAFAAGTAGNTLKTSD-PAN-------VGINEAK 1643
            T S  N  T G+      PTF +   S  ++GT  ++  T + PAN        G +  +
Sbjct: 1718 TSSPQNNDTMGTSAFGFKPTFTLSNNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPE 1777

Query: 1644 VMEIGNTSKRPIQSDTSSDPDSKKFKESPENDLA 1677
              E  NT+  P   + +S P SK+  E  +N++ 
Sbjct: 1778 -RESSNTAMTPTPGEGASTP-SKRAAEDDDNEVG 1809

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  375 bits (964), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 395/1385 (28%), Positives = 716/1385 (51%), Gaps = 80/1385 (5%)

Query: 5    ISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLTK 64
            I+ F     E ++ I    +  L  K+ +F   + E  ++ V +DE+K+    +I+ L  
Sbjct: 24   IASFFDCSLEQVKSIDRDIVTHLNDKLLQFNELKSENIQITVTLDELKTNSAKKINSL-- 81

Query: 65   LLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQ---LNASHETIK-KLED-EE 119
               ++  E V+      R  D++++ER+  + K +++ ++   L+   E+IK KL D  E
Sbjct: 82   ---KTEMEDVL------RQNDEIRKERNDTSSKFESVQREKTHLSNELESIKRKLSDLSE 132

Query: 120  GAKEEASSWQDGLRNDD-----------STKHVLDKENKLLQRKLLEMENILQVCKSNAV 168
              KE  SS Q  L+  D           ++ H  D E K L+  +LE+E   Q   SN +
Sbjct: 133  EKKEIQSSQQRTLKILDERLKELEMVKAASNHS-DSECKKLRSTILELETKQQTYISNDL 191

Query: 169  SLQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENE 228
            + + + +  +QE  L   NK W E+ LSS NQ+ L       + +  +   LN+ + + +
Sbjct: 192  NSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQ 251

Query: 229  SVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLT 288
               T N  L  +N +LS  ++EKLL+IK L D++N+EK +FS E+TL++++ DLL SQL 
Sbjct: 252  LEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLN 311

Query: 289  SF-ERGHSLRPKEKGDDKLCKNPEHIDVAEELID----AKLKLEKSKEECQLLKNIVSDC 343
            +  E  ++ R     D     + + I   E+L+      K KL + + EC  L +I  + 
Sbjct: 312  AVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEEA 371

Query: 344  IEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALV 403
             +E+              K   +   LK+QL+KE+  K  +QNQ++ F++ELEHK P + 
Sbjct: 372  GKEDGILTS---------KSNGDFILLKKQLIKEKRAKEHLQNQIESFIVELEHKVPIIN 422

Query: 404  SFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLAR 463
            SFKERT+ LE+EL  +  LLE  S  K    K+L    +K+  Y+  IH L +QRLDL R
Sbjct: 423  SFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKNEKLAEYKDEIHILSKQRLDLCR 482

Query: 464  QVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVN-ERDSQIIITEKLVEFKNIDEL 522
            Q++ LL   S    +  PL  +E+  ++ +L+++++   E DSQ I+TE+LVEF++I +L
Sbjct: 483  QIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSATTESDSQKIVTERLVEFRDIIQL 542

Query: 523  QEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRVNI 582
            QEKN ELL   R LADKLE+NE ++   +  IEN+T          ++S   +L  +++ 
Sbjct: 543  QEKNSELLRVTRNLADKLESNENKSKNYLKNIENETINEAKEAILTLQSQKVQLESKIHE 602

Query: 583  LTRERDSYKLLASANDNKTHADTEGITEAT-----YEKKIRELQSKLSSTRVESSAIIQN 637
            L +ER+ +K      D +T  +   I + T      E + ++LQ+++S    ES+  +  
Sbjct: 603  LEKEREKFKNWTM--DQETSPNNSVIQQLTETKRELESQTQDLQARISQVTRESTENMSL 660

Query: 638  LNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKTQLEKQR-----LSAA 692
            LN +L     S++   I L   ++ ++L  E+  +L   ++  K + ++ R     L  A
Sbjct: 661  LNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLSNTLDLAKAENDQLRKRSINLQNA 720

Query: 693  PPVQDYKYS-NLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQL 751
               QD K    L D    ++K+ +++ E+SNLK E T  I ++++L ++L     EK  L
Sbjct: 721  ISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERTLKIELEKNLKQELSELSSEKTSL 780

Query: 752  HVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQ 811
            H+ +++ +T   E+  +    +     +I  L+    EL      K+Q IK L+   +S+
Sbjct: 781  HIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSK 840

Query: 812  LKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKFLSNTSDTN 871
            ++W QN I+   K+ +SV + L+ K+  + R   EI++L  E+   K++     N  D +
Sbjct: 841  IEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIKSLEKEIEENKIRL-HTYNVLDES 899

Query: 872  TLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQLEN 931
              + +LR+EL++++I L DA+SQI+ Y+++  T +  L+E++ +L ++ +    +IQ   
Sbjct: 900  INDDSLRRELEKSKINLTDAYSQIQEYKKLYETTDKSLQEMSSQLDESNKAFSNQIQNLT 959

Query: 932  KEKGAKEEELSHLRKELDEI--------RCLQPKLREGASYL-VLQSEKVGDQAQRIQEM 982
             EK + E+++S LR+++  +        + ++ +  E    + +LQ+     +A +  E 
Sbjct: 960  DEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKT-EY 1018

Query: 983  KNKIDKMAAIIE---AYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSL 1039
            ++K+ K+   ++    Y     + Y+ EL+ + D+S+ +  L ++   Y+ +++    + 
Sbjct: 1019 ESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLAR 1078

Query: 1040 YSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIDGATEGSN--SNEK 1097
               ++ L  +E  W  +K     +L  +  + E L  +N +L ++I+  T   N  ++ K
Sbjct: 1079 GQFEKALKENETNWNSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAK 1138

Query: 1098 YLELVS--LFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANT-VPRNKV 1154
               +++  +   LR ER  L+TK+   +RD  +LRQK + ++    +LQ A T +  +KV
Sbjct: 1139 SGSVLNNDILITLRRERDILDTKVAVAERDAKMLRQKISLID---VELQEARTKLCNSKV 1195

Query: 1155 QCP--AVXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRL 1212
            +    +              Q+N+LRE+N  L   L +   KN+ +  EL  ++  I+ +
Sbjct: 1196 ENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPI 1255

Query: 1213 QGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVK 1272
            +  L   K  +     ++   + E+ + K+R QD+ ++ +     + EKL   I  L+ +
Sbjct: 1256 ESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQ 1315

Query: 1273 LLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESK 1332
            L +     AD E KFNRL++QA EKL ASK  Q +   +LNELK+ K  LE++L+N  ++
Sbjct: 1316 LEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANAR 1375

Query: 1333 VVDLE 1337
            + +LE
Sbjct: 1376 IQELE 1380

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 45/56 (80%)

Query: 1449 KRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSGSNEE 1504
            K+I+EAEE LKKRIRLP+EE+I KII ++K +LE+EF+ K++E  KS+  SG  E+
Sbjct: 1526 KKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFDEKVEERLKSISQSGKMED 1581

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  355 bits (912), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 399/1422 (28%), Positives = 739/1422 (51%), Gaps = 87/1422 (6%)

Query: 5    ISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLTK 64
            I+ F     E ++      +K L  K+ +F   + E  K+ V  DE+K+    +I  L  
Sbjct: 24   IASFFGCSLEQVKSFDGDVVKHLNDKLLQFNELKSENLKVTVSFDELKASSLKKIDGL-- 81

Query: 65   LLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDAL-NKQLNASHE---TIKKLED-EE 119
               ++  E VI      R  D++++ER+    K +++ N+++  S E     +KL+D  E
Sbjct: 82   ---KTEMENVI------RENDKIRKERNDTFVKFESVENEKMKLSSELEFVKRKLDDLTE 132

Query: 120  GAKEEASSWQDGLRN-DDSTKHV---------LDKENKLLQRKLLEMENILQVCKSNAVS 169
              KE  S+ Q  L+  D+  K +          + E K L+  ++++E   Q   +N ++
Sbjct: 133  EKKETQSNQQRTLKILDERLKEIELVRVENNRSNSECKKLRSTIMDLETKQQGYITNDLN 192

Query: 170  LQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENES 229
             + + +  +QE  L   N  W E+ L S N++ L         + ++  +LN+ + + + 
Sbjct: 193  SRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDIRNELNRLRNDFQM 252

Query: 230  VSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTS 289
              T N  L  +N +LS  ++EKLLEIK L D+ N+EK EFS EM+L++++ DLL SQL +
Sbjct: 253  ERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLKQRLVDLLESQLNA 312

Query: 290  F-ERGHSLR----PKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCI 344
              E  +S+R     K   DD   + PE+ D+ +EL   K KL + ++EC  L +I  +  
Sbjct: 313  VKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRLSSITDEAD 372

Query: 345  EENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVS 404
            E+N              K  S+   LK+QL+KER  K  +QNQ++ F++ELEHK P + S
Sbjct: 373  EDNENLSA---------KSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIINS 423

Query: 405  FKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQ 464
            FKERT++LE+EL  +  LLE  S  K    K+L +  QK+   E ++ +L +QRLDL RQ
Sbjct: 424  FKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQRLDLCRQ 483

Query: 465  VKILLSNISAIQTTTSPLSNDELMSLRKLL-ESENTVNERDSQIIITEKLVEFKNIDELQ 523
            ++ LL   S    +  PL  +E+  ++ ++ E ++T+ E DSQ ++TE+LVEFKNI +LQ
Sbjct: 484  IQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVVTERLVEFKNIIQLQ 543

Query: 524  EKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRVNIL 583
            EKN ELL  +R LADKLE+ E ++ +++ KIE++T          ++S   K+ L   I 
Sbjct: 544  EKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITLKS--EKMDLESRIE 601

Query: 584  TRERDSYKLLASA-NDNKTHADT--EGITEA--TYEKKIRELQSKLSSTRVESSAIIQNL 638
              +++  +L  S  N++ ++++   + +TE     E ++++LQ+++S    ES+  +  L
Sbjct: 602  ELQKELEELKTSVPNEDASYSNVTIKQLTETKRDLESQVQDLQTRISQITRESTENMSLL 661

Query: 639  NGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKTQLEKQR-----LSAAP 693
            N ++     S++D  I L + ++ ++L  E+  +L   ++  K + ++ R     L    
Sbjct: 662  NKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDYLQNTI 721

Query: 694  PVQDYK-YSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQLH 752
              QD K +  L +    ++K+  ++ E+ NLK+E    + ++++L ++L +   EK  L 
Sbjct: 722  LKQDSKTHETLNEYVSCKSKLSIVETELLNLKEEQKLRVHLEKNLKQELNKLSPEKDSLR 781

Query: 753  VKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQL 812
            + +++ +T   E+  +          +I  LE  L EL      K+  IK L+   NS +
Sbjct: 782  IMVTQLQTLQKEREDLLEETRKSCQKKIDELEDALSELKKETSQKDHHIKQLEEDNNSNI 841

Query: 813  KWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKFLSNTSDTNT 872
            +W QN I+  +K+ +SV   + +K+T I +L  ++++L  E+   K++     N  D   
Sbjct: 842  EWYQNKIEALKKDYESVITSVDSKQTDIEKLQYKVKSLEKEIEEDKIRL-HTYNVMDETI 900

Query: 873  LEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQLENK 932
             + +LRKEL++++I L DA+SQIK Y+++  T    L++ N +L ++ +D   +I+    
Sbjct: 901  NDDSLRKELEKSKINLTDAYSQIKEYKDLYETTSQSLQQTNSKLDESFKDFTNQIKNLTD 960

Query: 933  EKGAKEEELSHLRKELDEIRC---LQPKL--REGASY----LVLQS-----EKVGDQAQ- 977
            EK + E+++S L++++  +     LQ K   +E A +     +LQ+     E V  + + 
Sbjct: 961  EKTSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYES 1020

Query: 978  RIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKK 1037
            ++ +++N +D+       Y     + Y+ EL+ + D+S+ +  L ++   Y+ ++K    
Sbjct: 1021 KLSKIQNDLDQQT----IYANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNL 1076

Query: 1038 SLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKID---GATEGSNS 1094
            S    +  L  +EK W  +K     +L  +  + E L  +N +L ++I     A +  N+
Sbjct: 1077 SRDQLENALKENEKSWSSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQIYTAADKEVNN 1136

Query: 1095 NEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKV 1154
            +     L ++   LR ER  L+TK+T  +RD  +LRQK + ++  + D +      R + 
Sbjct: 1137 STNGPGLNNILITLRRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEK 1196

Query: 1155 QCPAVXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQG 1214
            +  +              Q+N+LRE+N  L   L+N   K + +  EL  +++ ++ ++ 
Sbjct: 1197 ENHSSIIQQHDDIMEKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIES 1256

Query: 1215 HLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLL 1274
             L   K  +     ++   + E+ + K+R QD+ ++ +    ++ EKL + I +L+ +L 
Sbjct: 1257 ELTALKYSMQEKEQELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELE 1316

Query: 1275 NVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVV 1334
            N +   A+ E KFNRL++QA E+L  SK  Q +LT ++N L++ K+ LE +L    +++ 
Sbjct: 1317 NKERQGAEAEEKFNRLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLSEANARI- 1375

Query: 1335 DLELKLKEHGLQVGEVSKDHDSI-AFKPFVEEIESLKKELQV 1375
                      LQ  +V++ ++ + A +   E+ E   +ELQ 
Sbjct: 1376 --------EELQNAKVAQGNNQLEAIRKLQEDAEKASRELQA 1409

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 89/220 (40%), Gaps = 67/220 (30%)

Query: 1449 KRIKEAEENLKKRIRLPSEERIQKIIS--------------------------------- 1475
            ++I+EAEE LKKRIRLP+EE+I KII                                  
Sbjct: 1519 QKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSMEQSGEIDVVLRK 1578

Query: 1476 -------KRKGELEQEFERKLKENNKSLVFSGSNEEEAEDEL-----------WNSPSKG 1517
                   +++ ELE E+ +KL+E  K +  S    ++  D+L           +N+  + 
Sbjct: 1579 QLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRLREEFNNELQA 1638

Query: 1518 --------SSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSENKENN----IPD 1565
                      ++  + T L+++K  K++ QL   K +    +  PKS N   N    +P 
Sbjct: 1639 IKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSA---ESPPKSVNNVQNPLLGLPR 1695

Query: 1566 SAAADNRVP-SAFSFGKPLFSSNTSSFQSFHNPFTPSAAN 1604
                ++  P +    G+ L   N+ S     NPFT  + N
Sbjct: 1696 KIEENSNSPFNPLLSGEKLLKLNSKSSSGGFNPFTSPSPN 1735

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  355 bits (911), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 386/1391 (27%), Positives = 697/1391 (50%), Gaps = 83/1391 (5%)

Query: 4    KISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLT 63
            K++ FL V    ++ +  S +   + K  EF + + +  +L++ +D +K  +  +I+   
Sbjct: 17   KVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKINTFK 76

Query: 64   KLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEGAKE 123
            + +     EK++ S V +R Q    E++     K+  +N++   S E +K     E AK+
Sbjct: 77   EQV-----EKLL-SDVASRQQ----EKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQ 126

Query: 124  E----ASSWQD-------GLRNDDSTKHVLDK---ENKLLQRKLLEMENILQVCKSNAVS 169
                 AS+ QD        + +  ++K   D+    NK L++  +++E I+Q  KS  + 
Sbjct: 127  GMEIIASAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELR 186

Query: 170  LQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENES 229
             + +     QE  L   N  W  + L S N++         S LQN  E++N  +++ E 
Sbjct: 187  EKSEIQRLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEF 246

Query: 230  VSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTS 289
                N  L  +  +LS+ ++EKL+E K L D  NTEK EF++EM+L++++ DLL SQ++S
Sbjct: 247  ARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSS 306

Query: 290  FERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSD------- 342
              +       +  +      PE   + +ELID K  LE ++ E   L+  V++       
Sbjct: 307  M-KSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVNGK 365

Query: 343  ----CIEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHK 398
                 I  N              KL  +I  LK+QLV+ER QK ++QNQ++ FV+ELEHK
Sbjct: 366  NGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHK 425

Query: 399  TPALVSFKERTELLEHELKCSTELLETMSLAKRKDEK--KLTSLEQKINSYEANIHSLVR 456
             P L SFKERT++LE EL   T LLE  S AK++D+K  +L   + KIN+YE+ + SL+ 
Sbjct: 426  IPILNSFKERTDMLERELNDVTLLLE--STAKQRDQKTIELNQYKNKINNYESQVCSLIV 483

Query: 457  QRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEF 516
            QR DLA QV+ LL  +S       PL+  E+  +++++ SE+   + D+Q II+E+LV+F
Sbjct: 484  QRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQF 543

Query: 517  KNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKL 576
            K++ ELQ KN ELL+ IR LADKLE  E ++   +  +E QT          ++    +L
Sbjct: 544  KSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRL 603

Query: 577  ALRVNILTRERDSYKLLASANDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQ 636
              ++ I+++ERD++KL  SAN     A +        ++ I EL+ +L +   +S   I+
Sbjct: 604  EDQLKIVSKERDAFKLANSANKQGDSAPSSTYQSKKLDEHIMELEKRLKNLAEQSQDNIK 663

Query: 637  NLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLK---TQLEKQR--LSA 691
             LN ++    K++++  + L++  + KVL  E+  ++Q  ++  K    +L K+   L  
Sbjct: 664  LLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQR 723

Query: 692  APPVQDYKY-SNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQ 750
                QD K  S + ++  +++++ +L  +++ L  E   L  ++  L  + E   KE   
Sbjct: 724  VLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTT 783

Query: 751  LHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNS 810
              + +S+ +T   E++++    +  Y   I+ LE +L E    L  + +E +  + S  S
Sbjct: 784  SKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTS 843

Query: 811  QLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQ---YKFLSNT 867
            Q KW Q  +D   + L +    L  K  +I  L L  ++L  +L   +L+   Y  L+N 
Sbjct: 844  QYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANA 903

Query: 868  SDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKI 927
             D      TLRK L++  I L DA+SQI+ Y+ +   +E    E++  L++++ +    I
Sbjct: 904  DDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNI 963

Query: 928  QLENKEKGAKEEELSHLRKELDEIRCLQPKLREGASYLVLQSEK--------VGDQAQR- 978
             L  +E+ +  ++++ L    D+I+ L  +L    S    QSEK        +   +QR 
Sbjct: 964  ALLEQERKSLTDQIALLN---DQIKDLNSELDHQKSQ--NQSEKSELIKKLSILQGSQRS 1018

Query: 979  IQEMKN----KIDKMAAII---EAYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTE 1031
            + E+K+    KI K+   +    +Y  +    Y+ EL+ + D+++ +  L +E+  Y++E
Sbjct: 1019 LDELKSEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSE 1078

Query: 1032 LKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIDGATEG 1091
            ++  K+S    +  L+R+E+ W ++ AD E +L    ++TE L  +N +L ++++  ++ 
Sbjct: 1079 MEGFKRSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKA 1138

Query: 1092 SNSNEKYLELVS-----LFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRA 1146
            ++S+ +    +S     L   LR ER  LETKL    R+  +LRQ+    +  + +++  
Sbjct: 1139 TSSDSEAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVR-- 1196

Query: 1147 NTVPRNKVQCPA----VXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIYKEL 1202
              +  +K Q  A                  Q+N+LRE+N  L    K   E+++    E+
Sbjct: 1197 --LEFSKTQATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEI 1254

Query: 1203 INMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKL 1262
              +QE++  L+  L      +S    ++   + E  + KQR QD+  + +     E +KL
Sbjct: 1255 AKLQEQLQPLESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKL 1314

Query: 1263 HNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKL 1322
             + + +L+ +L      N + + +F +L+KQA+E+LD  K  +  + +E   +   K +L
Sbjct: 1315 ADEVTELKNELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQL 1374

Query: 1323 EENLHNEESKV 1333
            E  L     KV
Sbjct: 1375 EAELAQTLDKV 1385

 Score = 67.4 bits (163), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 115/238 (48%), Gaps = 28/238 (11%)

Query: 1447 TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKL--------KENNKSLVF 1498
            T++RI+EAEE LKKRIRLPSEERI ++I +R+  L+QEFE ++        KEN +S V 
Sbjct: 1551 TLERIREAEEALKKRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVG 1610

Query: 1499 SGSNE-EEAEDELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSE 1557
              +   +E ++E+    +K   +   V     ++   +L  ++K +++ +   + +P   
Sbjct: 1611 DTAKLIKEHQEEMDKLEAKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKI 1670

Query: 1558 NKENNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNIK 1617
            N  N++P     DN   S+    +P+ +   S FQ        + +  S  GSL      
Sbjct: 1671 NLNNSVPSKIPIDNNNNSSPQGAQPI-AIKPSPFQVAFGKAMENTSFGSFKGSLLDSKQF 1729

Query: 1618 SAFAAGTAGNTLKTSDPANVGINEAKVMEIGNTSKRPIQSDTSSDPDSKKFKESPEND 1675
             A  A T+ +TL      NVG          NT+KR  + + +  P+ +     P++D
Sbjct: 1730 IANTADTSTSTL----TGNVG---------TNTNKRQSEDELAQSPEKR-----PKDD 1769

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  345 bits (886), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 373/1374 (27%), Positives = 689/1374 (50%), Gaps = 69/1374 (5%)

Query: 8    FLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKS-----------QYY 56
            FL + S  L  +    +  +  K  EF++ + E  + +V VDE++S           Q +
Sbjct: 22   FLGIESNELLAVDGGVVVNIAAKAREFQQLQAENLRTSVTVDELRSSSERKLGACKDQVH 81

Query: 57   TRISKLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQ---LNASHETIK 113
              + +L  L  ES++ + +  ++ +  Q  L +  +   RK +AL +Q   L +S   + 
Sbjct: 82   LLLQELESLRGESAQFEKMKLELTSEKQRALNDSETLRVRK-EALEQQKQALESSKNDVA 140

Query: 114  KLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFK 173
            +L +E+ +  E SS++     DD     L +EN+ L+++ L++E+  +V KS  +  + +
Sbjct: 141  RLLNEKIS--ELSSFKQ--EADD-----LMQENRRLRQQTLDLESESRVSKSEDLQRKAE 191

Query: 174  YDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTY 233
                SQE  L   N +W E +L   N +      T  S L  L +KL   + E ++ +  
Sbjct: 192  LHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTRT 251

Query: 234  NKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERG 293
            NK L + N ++++ +E +L  +K L D  N+EK EF++EM+L++++ DLL  Q+ S +  
Sbjct: 252  NKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKSD 311

Query: 294  HSLRPKE-KGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCI---EENXX 349
              LR    +GDD    NP +  ++EEL     +LE+S+ + Q L+  V D +   +E+  
Sbjct: 312  LELRSTAGEGDDGSFSNPLNA-LSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRL 370

Query: 350  XXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERT 409
                         L+ +I  LKRQ++ E+ QK  +QNQ++ FV+ELE K P L SFK+R 
Sbjct: 371  KSSAHEYPASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPMLSSFKDRN 430

Query: 410  ELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILL 469
            ++LE +L  +  +LE++S  K      L   + +I+ +E  I  L RQR DLARQV+ LL
Sbjct: 431  DMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDLARQVQYLL 490

Query: 470  SNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMEL 529
               S    +  PL+ +E+  +R++LE  +   ERD+Q +I+E+LVEF++I ELQ KN +L
Sbjct: 491  IQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVELQSKNSDL 550

Query: 530  LDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRVNILTRERDS 589
            L  IR LADKLE+ E ++      +EN            ++    +L  R+ +LT+ERD+
Sbjct: 551  LRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIEVLTKERDA 610

Query: 590  YKLL--ASANDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKK 647
            YK +  ++ N NK        ++     ++ +L+  L + R E+   ++ LN ++    +
Sbjct: 611  YKAIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKMLNSEIQELLR 670

Query: 648  SQTDGKIALQEFENFKVLVAEKEAMLQERINHLK-TQLEKQRLSAAPPV-------QDYK 699
             +T   I +++    K L  E+  + Q     LK T+ E + L+    +       QD K
Sbjct: 671  QKTKLAIEIEKERTSKCLAEERLKVSQ---GSLKLTKQENEELNKRYHIIQDNLLKQDTK 727

Query: 700  YS-NLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSES 758
                L+ L   ++K+ +L+ E+ +   +   L + ++  T  +E+   E+  L + +++ 
Sbjct: 728  TQETLSCLIECQSKLATLESELKSSVAKIESLSSCQKKNTESIEQLTAERNNLTILVTQL 787

Query: 759  ETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNT 818
            +T   E++ +    E  Y  ++  LE    +L  +L  K++E      + +S+ +W Q  
Sbjct: 788  QTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEK 847

Query: 819  IDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELR--MTKLQ-YKFLSNTSDTNTLEP 875
            ID   + LK V+++L ++  T   L  + + L   L+   TK Q Y  L+ T D      
Sbjct: 848  IDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTE 907

Query: 876  TLRKELKQTQIELKDAHSQI-------KAYEEIISTNENVLKELN-------GELKKAKE 921
             LR EL++++I+L+DA+SQI       K+ EE +S   N  +          G +KK ++
Sbjct: 908  ALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKED 967

Query: 922  DCETKIQLENKEKGAKEEELSHLRKELD-EIRCLQPKLREGASYLVLQSEKVGDQAQRIQ 980
            +   +++    +      EL H +K+ D E   L+ +L    S     +       Q++ 
Sbjct: 968  ELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLG 1027

Query: 981  EMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLY 1040
            ++   +++ AA     Q+     Y+ EL+ + D+S+ + +L +E+  Y+ +    + S+ 
Sbjct: 1028 KLTQDLNQQAAFANKAQE----NYEQELQRHADVSKTISQLREESQKYKNQASVLQSSIE 1083

Query: 1041 STQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIDGATEGSNS----NE 1096
              ++ LD  + KW+ +K +YE +L S  ++ E L V+N +L++++D   +  NS    +E
Sbjct: 1084 QLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSE 1143

Query: 1097 KYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKVQC 1156
               ++  L ++LR ER  L+TKL   KR   +  +K  ++E+ +   +   +  +     
Sbjct: 1144 PQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSLQALSSQ 1203

Query: 1157 PAVXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHL 1216
             ++             Q+N+LRE+N  L   ++  T++ + +  ++ N+Q+ +  L+  L
Sbjct: 1204 NSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESEL 1263

Query: 1217 IQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNV 1276
               K  V    +++     E  + KQR QD+  + +     E +KL   +   + +L   
Sbjct: 1264 ASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAK 1323

Query: 1277 QNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEE 1330
             + N++LE++F RLKKQA E+LDA+K  Q  L+ EL + +E +  +E  L  E+
Sbjct: 1324 ADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQ 1377

 Score = 59.7 bits (143), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/44 (65%), Positives = 37/44 (84%)

Query: 1447 TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLK 1490
            T+KRI+E+ E L+KRIRLP+EE+I KI+  RK ELEQEFE KL+
Sbjct: 1541 TIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQ 1584

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  325 bits (832), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 363/1383 (26%), Positives = 685/1383 (49%), Gaps = 59/1383 (4%)

Query: 2    EDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRIS- 60
            ED ++ FL +  E+L  +  +   ++  KI EF++ + E  K +V +DE++S    ++  
Sbjct: 18   EDAVASFLELDREALVNVSGTVTAQIAAKIREFQQLQAENLKCSVTIDELRSSSSHKLGA 77

Query: 61   ---KLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLED 117
               ++  LL E    +  N ++  R + Q   ER R     D L  +  A  +  + LE 
Sbjct: 78   CKDQIHSLLQEIEAVRAENLQLEQR-RAQCDAERQRSINDSDTLRARNEALEQQKQVLE- 135

Query: 118  EEGAKEEASSWQDGLRNDDST----KHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFK 173
                K + +   +    D +T       L +E + L+++ LE+E   +V KS  +  +  
Sbjct: 136  --ANKNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKAD 193

Query: 174  YDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTY 233
            +   SQ+  L   N +W E +L+  N +         S L ++ ++L   + + ++ +  
Sbjct: 194  FHQLSQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKT 253

Query: 234  NKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERG 293
             K L +QN +    +E +   +K L D   + K EF++EM+L++++ +LL  Q+++ +  
Sbjct: 254  IKTLREQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSE 313

Query: 294  HSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSDCIEENXXXXXX 353
               +   +             + +EL+    +LE+S+ + Q L+  V   +  +      
Sbjct: 314  LEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKTISG 373

Query: 354  XXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLE 413
                     L+++I  LK+Q++ ER QK  +QNQ++ FV+ELE+K P L SFK+R ++LE
Sbjct: 374  SQSLPD---LYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLE 430

Query: 414  HELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNIS 473
             EL  +  +L+++S  K +    L   + +I   E+ I +L +QR DLARQV+ LL  ++
Sbjct: 431  KELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVT 490

Query: 474  AIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCI 533
                +  PLS +E   ++K++  ENT  + D+Q II+E+LVEFKNI ELQ KN +LL  +
Sbjct: 491  VRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTV 550

Query: 534  RILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRVNILTRERDSYKLL 593
            R LA++LET E +       IEN T          ++    +L  R++++TRERD+YK +
Sbjct: 551  RNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRERDAYKAI 610

Query: 594  ASA----NDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQ 649
             S       N    D         + KIREL+  LS+ + E+ A ++ L  +     +S+
Sbjct: 611  QSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQELARSK 670

Query: 650  TDGKIALQEFENFKVLVAEKEAMLQERINHLKTQLEKQRLSAAPPV-------QDYKYS- 701
            ++  + +++ ++ ++L  E+  + +  +  L T+ E + L+    V       QD +   
Sbjct: 671  SELVVNVEKEKSSRLLAEERLKISKSSL--LLTKQENEELNKRGLVLENNLAKQDTRTQE 728

Query: 702  NLTDLSHSENKIGSLKYEISN-LKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESET 760
             +++L   ++++ +L  E+ N + KEN  L    + L    E+  KE+ +L + +++ +T
Sbjct: 729  TISELIDCKSQLATLSAELKNSIAKENL-LNTSHQKLKETNEQLTKERNELTILVTQLQT 787

Query: 761  SHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTID 820
               E++ +    +  +  +I  LE  + +L   L  K  E+    S+ +S+ +W Q  ID
Sbjct: 788  LQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSRWYQEKID 847

Query: 821  DTEKNLKSVSAELSNKETTIGRLSLEIENLGNELR--MTKLQ-YKFLSNTSDTNTLEPTL 877
               + LKS +++L++K   I  L  +   L ++LR   TK Q Y  L+ T D  T    L
Sbjct: 848  ALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDVLTQTDAL 907

Query: 878  RKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQLENKEKGA- 936
            R EL++T+I LKDA SQ+  Y+ + ++ +  L  +   L+ +K+D   +++   KE+ A 
Sbjct: 908  RSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETLKKERDAL 967

Query: 937  ------KEEELSHLRKELDEIRCLQPKLREGASYLVLQSEKVGDQAQRIQEMKNKID-KM 989
                   +++L++L  ELD  + L   L+   +      E+V      +  MK++   ++
Sbjct: 968  SNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKC---EEEVKSNKTALASMKDQYQLEL 1024

Query: 990  AAIIE------AYQKEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQ 1043
            + + E       Y  +    Y+ EL+ + D+S+ + +L +EA  ++ ++   + S+   +
Sbjct: 1025 SKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASITELK 1084

Query: 1044 ELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIDGATEGS--NSNEKYLEL 1101
            + L+ +E  W  +K +YE +   + ++ E L  +N +L ++I      S   ++E   E 
Sbjct: 1085 KSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQISLKDTDSIPINDELKSEA 1144

Query: 1102 VSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANT-VPRNKVQCP--A 1158
              L S L+ E   L+TKL   KRD + L+QK   LE +  +L  A + + +++V     +
Sbjct: 1145 RELISTLKRECDILQTKLELAKRDESNLKQK---LEFTEQELSVAKSEIRKSQVTSDTRS 1201

Query: 1159 VXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQ 1218
            +             QVN+LRE+N  L   L+  +++N+ + + +  +QE +  L+  ++ 
Sbjct: 1202 IMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPLENDILT 1261

Query: 1219 TKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQN 1278
             +  V     ++     E+ + KQR QD+  + +     E +KL   +     +      
Sbjct: 1262 LQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAEAAANAQ 1321

Query: 1279 ANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLEL 1338
              ++LE++F RLKKQA E+LD ++  Q  L  EL E +E++  LE+ L  E  K   L+ 
Sbjct: 1322 QRSELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREKTRSLQE 1381

Query: 1339 KLK 1341
             +K
Sbjct: 1382 SIK 1384

 Score = 59.7 bits (143), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 1447 TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLV 1497
            T+KRI+EA E L+KRIRLP+EE+I KII  RK EL++EFE KL++    L 
Sbjct: 1538 TIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELA 1588

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  319 bits (817), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 377/1417 (26%), Positives = 711/1417 (50%), Gaps = 126/1417 (8%)

Query: 5    ISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLTK 64
            I  FL VP E L  I+ S L  L  K+ +F   + +  K  V ++E++     RI+ L  
Sbjct: 16   IGSFLSVPVEQLNAIETSILSNLKTKVEQFTELQSQSLKNEVSLEELQKTSQGRINDLRT 75

Query: 65   LLNESSEEKVINSKV-----------------MNRLQDQLKEERSRHTRKIDALNKQLNA 107
             L +  E+    S+                  ++  +D L+ E      K D L KQ   
Sbjct: 76   QLEDLIEQNASASEEKKKIEKELSDEKKESFQLSSTRDNLRAELKEIQEKFDNLQKQ--- 132

Query: 108  SHETIK----KLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVC 163
            + +TIK    K+   E  KE      +  R  +ST    D E+++   + L+  + L   
Sbjct: 133  NQDTIKLLDRKISQNEVEKELTLKLTNQYR--ESTAKCHDLEDEI---QSLKYNDSLTET 187

Query: 164  KSNAVSLQFKYDTASQEK-ELWLQNK-KWTEERLSSCNQKALVDEVTKTSYLQNLEEKLN 221
              N +S   K  +  +E+ E  L+NK K   E  S+C            + +Q L +K++
Sbjct: 188  TMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQ-----------AEIQTLRKKIS 236

Query: 222  QTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMND 281
              +     + + N  L  +N+ +S  + EK  +++ L +  NTEK E  KE++L+++M D
Sbjct: 237  TLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMID 296

Query: 282  LLRSQLTSFERGHSL-----RPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLL 336
            +L++Q+   +  ++      +P  + D++  +N E  ++ ++LI+ + +L K        
Sbjct: 297  VLQTQVQKLQDDYTRILNTKQPIVQNDEE--RNLEVEELKQKLIETETQLNKE------- 347

Query: 337  KNIVSDCIEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELE 396
                   +EE               +   ++ T+K++L++ER QK ++QNQ++ F++ELE
Sbjct: 348  -------LEERRNITMQTESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELE 400

Query: 397  HKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVR 456
             K P + SFK+RT++LE EL  +T LLE +   K +   +L +L Q   S +    SL +
Sbjct: 401  KKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTK 460

Query: 457  QRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEF 516
            QR DLA Q++ +L + S    +  PLS +E+  ++ +L++E+     DSQ +I+E+LV F
Sbjct: 461  QRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQVISERLVTF 520

Query: 517  KNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKL 576
            +NI ELQ+KN++LL  +R LA KLE  E     T   +E Q           ++S N+KL
Sbjct: 521  QNIVELQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKL 580

Query: 577  ALRVNILTRERDSYKLLASANDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQ 636
              ++  L  E D YK L    D K   +   + E   +  I+EL+++L+++R ES+    
Sbjct: 581  EDKIKTLNDELDCYKSLPKP-DTKVETEHLRLNEENTD-LIKELETRLATSREESNKTFA 638

Query: 637  NLNGQL--------LTYKKSQTD------GKIALQEFENFKVLVAEKEAMLQERINHLKT 682
            +LN ++         T K+ Q +       +  L+  +N   L   +   LQ+R+  L+ 
Sbjct: 639  SLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQD 698

Query: 683  QLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLE 742
               KQ       +++Y  S    LS+S+N++  ++ ++ N+ K N      ++SL  D+ 
Sbjct: 699  ITLKQDQRTQETLKEY-VSCKVALSNSQNELNYIQSQL-NISKTN------EKSLKDDIT 750

Query: 743  RCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIK 802
               KE+ +L   +S+ ++   E+  IF S +L   TR+  +E+ L +++ +L++K++EIK
Sbjct: 751  IVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIK 810

Query: 803  TLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQ-- 860
             L+S++ S+++W QN ID  ++   +   EL  K   IG L+ EI+ L  +L+ ++ +  
Sbjct: 811  ELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVT 870

Query: 861  -YKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKA 919
             YK L+N+ +  T   TL+ EL++++I L +A++++  Y++  S  E  L+     +++ 
Sbjct: 871  AYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEET 930

Query: 920  KEDCETKIQLENKE-------KGAKEEELSHLRKELD--------EIRCLQPKLREGASY 964
            K++   KI+   K+       K    E+++ L  ELD        E   +  KL E    
Sbjct: 931  KKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNE---- 986

Query: 965  LVLQS---EKVGDQAQ-RIQEMKNKIDKMAAIIEAYQKEESSQYQSELKTNKDLSEWVMR 1020
            L+ Q+   E+V +Q + ++  ++N +++ A+     Q    + Y+ EL+ + +L++ + +
Sbjct: 987  LLAQNHNIEEVSNQYELKLSTLQNDLEQQASYANIAQ----NNYEQELQKHAELAKTISQ 1042

Query: 1021 LEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSV 1080
            L ++A  Y+ ++   + +  + +ELL ++EK W E++  YE ++ +  ++ E L  +N +
Sbjct: 1043 LREDAHTYRKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKL 1102

Query: 1081 LIEKIDGATEGSNSNEKYLELVSLFSN------LRHERSSLETKLTTCKRDLALLRQKNA 1134
            L +++D  ++  NS   Y +  S   N      LR +R  L+T+L+  + +   LR K +
Sbjct: 1103 LFDQVDLLSKSENS---YNQQSSATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLS 1159

Query: 1135 SLEKSIGDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEK 1194
            S+   + + +   T  R + +   +             Q+N+LRE+N  L     +  EK
Sbjct: 1160 SVNTELTNTRAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREK 1219

Query: 1195 NEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLT 1254
             + + ++L  ++E++  L+    + KE +  N  ++ AY+ E  + KQR QD+  + K  
Sbjct: 1220 AKQLQEDLETLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKI 1279

Query: 1255 HKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNE 1314
               E EKL   I  L+  L + +  N +L ++FNR+KKQAHE+L++SK  Q  L +++ +
Sbjct: 1280 DPVEHEKLEAEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQ 1339

Query: 1315 LKETKDKLEENLHNEESKVVDLELKLKEHGLQVGEVS 1351
            L++    ++  L  E   + + E K ++   Q  +V+
Sbjct: 1340 LEDENAHIQSLLETERGNIQNTEEKFRQMNKQSEDVT 1376

 Score = 76.3 bits (186), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 83/281 (29%), Positives = 122/281 (43%), Gaps = 57/281 (20%)

Query: 1448 VKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSGSNEEEAE 1507
            +KRI++AEENLK+RIRLP+EE+I  +I K+K ELE+E++ K+ +  K L+ S  N+   E
Sbjct: 1511 LKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLSSEENKTFIE 1570

Query: 1508 D---------------ELWNSPSKGSSE---KPSVVTDLIKQKNIKLQEQLKNV------ 1543
            D               EL N+ +K   E   +  + T  +++K  KL+ QL+        
Sbjct: 1571 DLKNDIKKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQGSNAANEN 1630

Query: 1544 KNAVTFNDKRPKSENKENNIPDSAAADNRVP--SAFSFGKPLFSSN-----------TSS 1590
            KN V    K P     ENN+P         P  S      PL S+             SS
Sbjct: 1631 KNDVEVLLKTPSD---ENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSRAPSS 1687

Query: 1591 FQSF---HNPFTPSAANFSTDGSL-----PTFNIKSAFAAGTAGNTLKTSDPANVGI-NE 1641
             Q+     NPFT        D ++     P F ++       + +T+     +     +E
Sbjct: 1688 LQNGSDSSNPFTSPFQQTKNDANIPAVTQPAFLLREPSEPNMSVSTISRQSTSETNTESE 1747

Query: 1642 AKVMEIG---NTSKRPIQSDT-----SSDPDSKKFKESPEN 1674
              V   G    +SKRP Q DT      ++   KK K  PEN
Sbjct: 1748 LPVSSEGLATPSSKRPAQEDTEEEKLDAETPKKKSKTEPEN 1788

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  310 bits (794), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 381/1408 (27%), Positives = 686/1408 (48%), Gaps = 102/1408 (7%)

Query: 4    KISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQ-------YY 56
            ++++FL V  + ++ I +  L R+ +K+ +  + + E  ++   +D++KSQ       + 
Sbjct: 9    RVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKSENLRITATLDQLKSQSENKLESFK 68

Query: 57   TRISKLTKLLNESSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLE 116
              IS+L K L +  +E++   +   RL     E  S+ T++I  L +++    +  K+L 
Sbjct: 69   IHISQLAKALEDGKDERLHFEEEKRRL----IEGNSQVTKRIIELEQEIEVERQQ-KELA 123

Query: 117  DEEGAKEE-ASSWQDGLRNDDSTKHVLDKE---NKLLQRKLLEMENILQVCKSNAVSLQF 172
            D   +K++ A S  + +    STK  L++    NK L++K++  E  LQ     A+ L+ 
Sbjct: 124  D--ASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQT--QQALELRS 179

Query: 173  KYDTASQEKELWL--QNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESV 230
            K +    E+E+ L  +N  W   +L++   +      +  S LQ+ + K++  ++E E  
Sbjct: 180  KSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIA 239

Query: 231  STYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSF 290
             T N+ L      L   +E+KL E K +KD  N  K E +KEM+L+++M D L   + S 
Sbjct: 240  RTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESL 299

Query: 291  ERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEEC--------QLLKNIVSD 342
            ++      K   D       E  ++ EEL   K +L+ S+  C        +L  NI  +
Sbjct: 300  KKEMDA-TKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTSNIKLE 358

Query: 343  CIEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPAL 402
              E                KL+ ++  LK+QLV E+ QK +++ Q++ FV+ELEHK P L
Sbjct: 359  DSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHKIPVL 418

Query: 403  VSFKERTELLEHELKCSTELLETMSLAKRKDEK--KLTSLEQKINSYEANIHSLVRQRLD 460
             SFKER+E+LE EL   T LLE  S  K +D+K  +L  L+  + SYE  I SL +QR+D
Sbjct: 419  NSFKERSEMLERELNEVTILLE--STGKDRDQKSSQLDYLKATVKSYETQIASLSKQRVD 476

Query: 461  LARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNID 520
            LA Q++ LL N S       PLS +EL  ++ L  S+      D+Q IIT++LVEF+++ 
Sbjct: 477  LAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRSVV 536

Query: 521  ELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRV 580
            ELQ+KN ELL  IR LAD+LE  E E    +  +E++T          +      L  ++
Sbjct: 537  ELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLENQL 596

Query: 581  NILTRERDSYKLL---ASANDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAIIQN 637
             IL++ERD+YK L   AS+  N   A T        + K+++L+++L       +A+IQ 
Sbjct: 597  VILSKERDAYKALSVNASSGTNTPKAIT--YPSPDNDDKVKDLETRL-------TAVIQE 647

Query: 638  LNGQLLTYKKSQTDGKIALQEFE-NFKVLVAEKEA--MLQERINHLKTQLE--------- 685
                   +    ++ +  L E   NF+   +EK +  + ++R+N L++ LE         
Sbjct: 648  AENNAKEWSSENSNLRKKLYEISLNFE---SEKTSRTLAEDRLNLLQSTLELSKRQCEEL 704

Query: 686  KQRLSAAPPV---QDYKYSNLTD-LSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDL 741
            ++R S    +   QD +     D L  +++ + S++ E+S LK E   +  +++ L  + 
Sbjct: 705  QKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAEN 764

Query: 742  ERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEI 801
            ER  KE ++  V +++ +T   E+ ++    +  Y  +++ LE  L     RLE  E+  
Sbjct: 765  ERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNT 824

Query: 802  KTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQ- 860
              + S+K  Q  W Q  ID            L  KE  + ++   I     +L+  + + 
Sbjct: 825  TGIASNKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARA 884

Query: 861  --YKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKK 918
              Y  LSN  D   L  TLR+EL++  ++L D++SQI+ ++ +   +   + E++   ++
Sbjct: 885  QSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEE 944

Query: 919  A-KEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPKLREGASYLVLQSEKVGDQAQ 977
            A KE  +T I LEN E+   +  ++ L    D+++ L  ++    S    +     ++  
Sbjct: 945  AQKESQKTIITLEN-ERNQLQSTVNILN---DQVKDLNNEIFHQKSEYQTERNATMEEIS 1000

Query: 978  RIQEMKNKIDKMAAIIE--------------AYQKEESSQYQSELKTNKDLSEWVMRLEK 1023
            ++Q +K  +D+  A  E               Y  E    Y+ EL+ + D+S+ +  L  
Sbjct: 1001 KLQMVKESVDRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRT 1060

Query: 1024 EAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVL-- 1081
            EA  Y+++L+  K       E L   EK W E+K +YE +L    ++ + L  +N +L  
Sbjct: 1061 EAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYD 1120

Query: 1082 -IEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSI 1140
             IE ++   +  NS++    L+S    LR ER  LETKL     +  +L+Q+    +  I
Sbjct: 1121 QIELLNKTEDRDNSHDSSDLLIS----LRRERDMLETKLEVALSEQTVLKQRLDIAKSEI 1176

Query: 1141 GDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAILHKSLKNVTEKNEAIYK 1200
             DL    +  +N     A              Q+++LRE+N  L     +  ++ + +  
Sbjct: 1177 EDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKS 1236

Query: 1201 ELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETE 1260
            +L    + ++ LQ  +   +  + I   +++  + E E+ K R QD+  + +     E  
Sbjct: 1237 QLQECNDRLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHG 1296

Query: 1261 KLHNVIGDLEVKLLNVQNA-------NADLENKFNRLKKQAHEKLDASKKQQTALTNELN 1313
            KL   I D++ +L   ++          D E+KF R++ QA ++L+ASK+++ +L++E+N
Sbjct: 1297 KLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEIN 1356

Query: 1314 ELKETKDKLEENLHNEESKVVDLELKLK 1341
            ++ E K ++E +L   ++   +LE +L+
Sbjct: 1357 QINEAKSQVEADLGKCKTACKELEERLQ 1384

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 81/159 (50%), Gaps = 12/159 (7%)

Query: 1447 TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSGSNE--- 1503
            T+++IK AEE LKKRIRLP++++I KI+  RK  LE+ FE K+ E  + L     N+   
Sbjct: 1564 TLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLAGEIGNDAIT 1623

Query: 1504 -EEAEDELWNSPSKGSSEKPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSENKENN 1562
             E+   EL    +   S +     DL + K    +E  + V   + F + + ++  ++ +
Sbjct: 1624 LEKHRAEL---NALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLEQQKS 1680

Query: 1563 IPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPS 1601
                   D    SA +F  P+F S++    +F +PF+ S
Sbjct: 1681 TIKPVENDTSNMSA-AFQAPVFGSHS----TFTSPFSTS 1714

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  293 bits (751), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 348/1282 (27%), Positives = 618/1282 (48%), Gaps = 80/1282 (6%)

Query: 146  NKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVD 205
            NK L+R  +E+E  +Q  +S ++  Q +     QE  L   N +WT  +L+  NQ+    
Sbjct: 160  NKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSY 219

Query: 206  EVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTE 265
                   +Q+ + +LN  + E E        L  +N +LS  +++ L E K L D+ ++E
Sbjct: 220  REKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSE 279

Query: 266  KSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEE-----LI 320
            K EF++EM L++++ +LL  Q+ + ++       EK  D + KN    D   E     L 
Sbjct: 280  KQEFAREMALKQRLIELLNGQVATMKQDL-----EKAYD-VAKNGGMSDSERERLLNDLF 333

Query: 321  DAKLKLEKSKEECQLLKNIVSDCIEENXXXXXXX-----------XXXXXXXKLFSNIKT 369
            D K KLE S+     L++ + + +E +                          ++ ++  
Sbjct: 334  DTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAA 393

Query: 370  LKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLA 429
            L++QLV+ER  K ++Q Q++ FV+ELEHK P L SFK+R E LE +L   T LLE  + A
Sbjct: 394  LRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLE--ATA 451

Query: 430  KRKDEK--KLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDEL 487
            + +DEK  ++   + K+  YE  +  LV+QR DLARQV+ LL +IS    ++ PL+ +E+
Sbjct: 452  RERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEV 511

Query: 488  MSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEA 547
              ++KL    ++    D+Q II+ +LVEFK++ ELQ+KN ELL+ IR LA KLE  E + 
Sbjct: 512  EFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKT 571

Query: 548  DKTVAKIENQTXXXXXXXXXXMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEG 607
               V  +E  T          ++     L  ++  +T ERDS+KLL S   N +  +  G
Sbjct: 572  QSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVG 631

Query: 608  ITEATYEK---KIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKV 664
                  ++    I  L+++L +   ES    + LN ++    KS +   I L+   + + 
Sbjct: 632  AAALQPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIELERERSSRE 691

Query: 665  LVAEKEAMLQERINHLKT-----QLEKQRLSAAPPVQDYKY-SNLTDLSHSENKIGSLKY 718
            L  EK +++Q+ +  +K      Q     L A    QD +  S + +   +++++ S+  
Sbjct: 692  LADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISS 751

Query: 719  EISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYST 778
            +++ L+ E   L  ++  L ++ E   K+     + + + +T+  E++ +      +Y T
Sbjct: 752  QLTILQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYET 811

Query: 779  RIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKET 838
            RI+ L+  L     +LE K++E   L SS ++Q KW Q+ +D  ++ L S    L  K +
Sbjct: 812  RIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTS 871

Query: 839  TIGRLSLEIENLGNELRMTKL--QYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIK 896
             +  L   + +  ++L    +  Q   L   SD  +   +L K+L +   +L  A+S+I+
Sbjct: 872  ELDALKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIE 931

Query: 897  AYEEIISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKEL----DEIR 952
             Y+   +  E      N          +  I LE         EL+ L  ++    D I+
Sbjct: 932  RYKAASNATERPSLSYNAVQDNKDGSKQAAISLEA--------ELTKLNSDIAMANDRIK 983

Query: 953  CLQPKL-REGASYLVLQSE-------KVGDQAQRIQEMK----NKIDKMAAIIE---AYQ 997
             L+ +L R  A+Y   +SE        V D+ QRI+E K     KI ++   +E   +  
Sbjct: 984  VLEDELNRREATYSTERSELQEKINALVTDK-QRIEEAKADYQQKITQLQTDLEKQISST 1042

Query: 998  KEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEK 1057
             E  ++YQ+ L+   ++SE +  L K +  Y++E+ K K +    +++L+R+E+ W ++K
Sbjct: 1043 NEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQK 1102

Query: 1058 ADYERELISNIEQTESLRVENSVLIEKIDGATEGSNSNEKYLELVS-----LFSNLRHER 1112
            AD E  L    ++ E L  +N +L ++I+  +   +S+ +    +S     L   LR ER
Sbjct: 1103 ADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSSLEPDTKISSDARELIVTLRRER 1162

Query: 1113 SSLETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKVQCPAVXXXXXXXXXXXXA 1172
              LETK+   KR+  +LRQ+    +  + +L+   +  +  V                  
Sbjct: 1163 DILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLN 1222

Query: 1173 QVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLA 1232
            Q+N+LRE+N  L    + V+E NE +  E++++QE++  ++  +      ++    K+  
Sbjct: 1223 QLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATLTEKEQKLAL 1282

Query: 1233 YESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKK 1292
             + E ++ KQR QD+  + +     E  KL + I  L+ +L      + D + +F +L+K
Sbjct: 1283 LKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRK 1342

Query: 1293 QAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLELKLKEHGLQVGEVSK 1352
            QA+E+LD  K  +  + +EL      K +LE  L     K+  LE +L E        S+
Sbjct: 1343 QANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREKITSLETQLTERP-----ASE 1397

Query: 1353 DHDSIAFKPFVEEIESLKKELQ 1374
            D +     P   E+E  K +LQ
Sbjct: 1398 DDN-----PVSHELEETKTKLQ 1414

 Score = 57.4 bits (137), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 8/59 (13%)

Query: 1447 TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERK--------LKENNKSLV 1497
            T++RI+EAEE LKKRIRLPSEERI ++I +++  LEQEF  K        LKEN  S+ 
Sbjct: 1547 TLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIA 1605

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  278 bits (711), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 360/1397 (25%), Positives = 696/1397 (49%), Gaps = 87/1397 (6%)

Query: 2    EDKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISK 61
            E +I+ FL+V   ++  +       +  K  EF + + +  + NV ++E K+   ++  K
Sbjct: 6    ESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSDNLRTNVLLEETKANLSSKYEK 65

Query: 62   LTKLLNESSEEKVINSKVM---NRLQDQLKEERSRHTRKIDALNKQLNASHETIK----- 113
            L + L+   E+   N+KV      L +++    +    K+  +N QL  S+E ++     
Sbjct: 66   LKEELDYVVED---NTKVRAENKTLSEKVWSLETSDNSKLAEIN-QLKTSNEGLQNNIDR 121

Query: 114  ---KLEDEEGAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSL 170
               + ++  G+ +E  +  + +R++   K  L  + K L  K+LE+E   Q  +S+ ++ 
Sbjct: 122  ANERYKELNGSYDEKVTELEHIRDE---KKELQTQIKTLNDKILELELKCQEYQSSELNR 178

Query: 171  QFKYDTASQEKELWLQNKKWTEERLSSCNQKALV----DEVTKTSYLQNLEEKLNQTQTE 226
            + + +  +QE  L  +N++W E+ L++ NQ  +      ++     + N+E+  +  + E
Sbjct: 179  KSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIE 238

Query: 227  NESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQ 286
              S    +K L +  ++L +     L+E K+LKD    EK EF KE++++ K+  L  +Q
Sbjct: 239  KSSKEILSKKLDETTEQLQN----NLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQ 294

Query: 287  LTSFERGHSLRPKEKGDDKLCKNPEHI--DVAEELIDAKLKLEKSKEECQLLKNIVS--- 341
            + S E   +L+ K K  +   +N   +   + EEL  A+ KL+  +E+C  L++I+    
Sbjct: 295  IKSLE--STLQQKFKTAEANEENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDS 352

Query: 342  -----------------DCIEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQV 384
                                  +              ++  +IK LKRQLV+E+ QK ++
Sbjct: 353  NDVSLQTKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKL 412

Query: 385  QNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKI 444
            QNQ++ FV+ELEHK P + SF+ERT +LE EL  +  LLE  +        +L SL++KI
Sbjct: 413  QNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKI 472

Query: 445  NSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERD 504
            +   + +  L+RQR DLA Q++ LL NIS I      L+ DE+  ++ L+ ++N  +  D
Sbjct: 473  SDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTND 532

Query: 505  SQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNE----GEADKTVAKIENQTXX 560
            SQ +I+E L++FK+I +LQEKNMEL+  +R LA +LE NE      ++ TV + +N+   
Sbjct: 533  SQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDE-DNEIFA 591

Query: 561  XXXXXXXXMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGI-----TEATYEK 615
                    +E +N  L   + I+T+ERD++KLL S +  +    +  +      ++  E 
Sbjct: 592  EAKEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNET 651

Query: 616  KIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQE 675
             +++L+++L+    +S+A  + L  +L    K  +   + ++++ + K L  E+  + Q 
Sbjct: 652  VVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQN 711

Query: 676  RINHLKTQLEKQRLSAA----PPVQDYKYSNLTDLSHSE--NKIGSLKYEISNLKKENTG 729
             +  L  + E+ R+ ++      +Q  K +  T  S+ E  +K  SL+  + NL+ E T 
Sbjct: 712  SMELLSKENEQLRIRSSRLEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTL 771

Query: 730  LIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKE 789
            L   + SL  +L    +EK +L + +++ ++  +E+  +    +  +  RI  +    ++
Sbjct: 772  LKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEK 831

Query: 790  LNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIEN 849
            L+ +L  +  EI  ++  +N+Q +W Q  ID+  +  + +  +L  K   + RL L+ + 
Sbjct: 832  LDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKT 891

Query: 850  LGNELRMTKLQ---YKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNE 906
            L  EL   +++   Y+ ++  +  N  E  + KEL++T+IEL DA+SQ++ ++ +   +E
Sbjct: 892  LEKELEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSE 951

Query: 907  NVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIR---CLQPKLREGAS 963
            + LKELN        D    I+   +EK   E     L+++L+ I+    +Q +  E   
Sbjct: 952  DALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESER 1011

Query: 964  YLVLQS-EKVGDQAQRIQEMKN----KIDKMAAIIE---AYQKEESSQYQSELKTNKDLS 1015
              + Q+  ++   AQ I+E+K     K+ K+   +E    Y       Y+ EL+ + D+S
Sbjct: 1012 KRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVS 1071

Query: 1016 EWVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLR 1075
            + +  L ++    + + K     L S Q+ + ++EK    E+ +Y  ++    ++ + + 
Sbjct: 1072 KTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDIT 1131

Query: 1076 VENSVLIEKID--GATEGSNSNEKYLEL---VSLFSNLRHERSSLETKLTTCKRDLALLR 1130
             +N +L  +ID     E  N N    E     +L  +LR ER  L+TK+   + +   L+
Sbjct: 1132 KQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQ 1191

Query: 1131 QKNASLEKSIGDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAILHKSLKN 1190
            QK   ++  + + +R+  +  ++    +              Q+N+LRE+N  L   LK 
Sbjct: 1192 QKLDDIQNELENTKRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQ 1251

Query: 1191 VTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQ 1250
              ++ + I K+L   + E+  LQ +L      +     K+ +   E ++ K R +++ ++
Sbjct: 1252 ALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEK 1311

Query: 1251 QKLTHKNETEKLHNVIGDLEVKLLN-VQNANADLENKFNRLKKQAHEKLDASKKQQTALT 1309
             +  + ++  KL   + + +  L N VQ  N +L ++FNRLKKQAHEKL+ SK+ Q++L 
Sbjct: 1312 HQKVNVDDYTKLEETLNETKQLLDNKVQETN-ELNDRFNRLKKQAHEKLNTSKELQSSLQ 1370

Query: 1310 NELNELKETKDKLEENL 1326
             +++ L   KD + + L
Sbjct: 1371 EQISNLISEKDDIRKQL 1387

 Score = 79.0 bits (193), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 122/251 (48%), Gaps = 55/251 (21%)

Query: 1449 KRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSG-SNE---- 1503
            KRI EAE+NLKKRIRLPSEE+I KII KR+ ELE EF++K+++  + L+ +  SNE    
Sbjct: 1547 KRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSNEFNNE 1606

Query: 1504 ----------EEAEDELWNSPSKGSSE---KPSVVTDLIKQKNIKLQEQLKNVKNAVTFN 1550
                      E  EDEL  +  K   E   + ++ T L+++K  KL+ Q++         
Sbjct: 1607 LKEALEKELKERFEDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQ--------- 1657

Query: 1551 DKRPKSENKENNIPDSAAADNRVPSAFSFGKPLFSSNTSSFQSFHN--------PFTPSA 1602
            +K   SE  ++  P+    +N  PS     + L SS+T SF + +N        PF  ++
Sbjct: 1658 EKEKDSEETQDVKPE----ENSTPSVKKIPETLNSSDT-SFGNSNNVKVLKPSSPFGATS 1712

Query: 1603 ANFSTDGSL-----PTFNIKSAFA-------AGTAGNTLKTSDPANVGINEAKVMEIGNT 1650
            A  +          P F   SAFA       +G  G   + S    VG ++ +  E+   
Sbjct: 1713 AFNNPFTFNNNGNPPAF--ASAFAPTFKDLMSGQGGQQSELSQNKRVGDDDIETNELK-K 1769

Query: 1651 SKRPIQSDTSS 1661
            SK   +SD SS
Sbjct: 1770 SKSDSESDQSS 1780

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  273 bits (697), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 334/1181 (28%), Positives = 588/1181 (49%), Gaps = 101/1181 (8%)

Query: 219  KLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKK 278
            KL +  T  +S+      L D+N  L+   E  + EIKNLKD     K + +KE+ ++ K
Sbjct: 215  KLEEATTTLKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSK 274

Query: 279  MNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPE----HIDVAEELIDAKLKLEKSKEECQ 334
            + DLL+ QL+S +    LR   + + K  K P+    +  +  ++ D  LK+E+ + E  
Sbjct: 275  LIDLLQGQLSSTQ--EELRQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENF 332

Query: 335  LLKNIVSDCIEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLE 394
             L ++++    E                L+S I  LK+Q+ +E+ +K  +Q Q++ F++E
Sbjct: 333  NLNSMINQMSNEQNNSNNSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFIIE 392

Query: 395  LEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSL 454
            LE+K P + SF+E+ + LE+EL   T LL   S  K   + KL + + K+ +Y++NI  L
Sbjct: 393  LENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKEL 452

Query: 455  VRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVN--ERDSQIIITEK 512
            +RQRLDLA QVK LL  ++    +  PL+ +E+  + K+  +   +N  E  SQ +I+E+
Sbjct: 453  IRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISER 512

Query: 513  LVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESI 572
            LV F NI+ELQ KNMELL+ IR L++ LE  E     +  + +N+T          ++  
Sbjct: 513  LVTFSNIEELQAKNMELLNSIRSLSENLENIENA--NSHKEFQNKTIADAKEAILTLQYH 570

Query: 573  NSKLALRVNILTRERDSYKLLASAN---DNKTHAD--TEGITEATYEKKIRELQSKLSST 627
            N  L  +V +L  ERDS+KLL + N   D+    D  +   +  T EK I +LQ+ +   
Sbjct: 571  NDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEEL 630

Query: 628  RVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKTQLEK- 686
            + E       L  Q+ ++   +++  I+L++ ++   L+AEK ++ +   + LKT+ ++ 
Sbjct: 631  KAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKEL 690

Query: 687  -QRLSAAPPVQDYKYSNLTDLSH----SENKIGSLKYEISNLKKENTGLIAMKESLTRDL 741
             +R      +   + S L D+ +     E +I +LK ++S  K E   L+  ++SL  +L
Sbjct: 691  NKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSEL 750

Query: 742  ERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEI 801
             +  +EK +L + LS+ ++  NE+  +    + ++ ++I  LE N  +L   L SK  EI
Sbjct: 751  IKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTEI 810

Query: 802  KTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQY 861
            + L  S  SQ  W QNTIDD +K   ++  EL++K + I  L+ +IE L ++        
Sbjct: 811  QKLSISNESQCTWYQNTIDDLKKINSAIKTELTSKNSLISDLNTKIELLESQ-------- 862

Query: 862  KFLSNTSDTNTLEPT-------LRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNG 914
               S T DTNT   +       + K+L  T++ L +A++Q++ Y+++ ++ E  LK L  
Sbjct: 863  ---SYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEESLKTLES 919

Query: 915  ELKKAK---EDCETKIQLENKEKGAKEEELSHLRKELD-EIRCLQPKLREGASYLVLQSE 970
              +  K   +D  +K+  EN+   A   E      EL  +++  + K  E  + L +Q  
Sbjct: 920  NFESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQIT 979

Query: 971  KVG----DQAQRIQEMKNKIDKMAAIIE--------AYQKEES--SQYQSELKTNKDLSE 1016
            ++     D A    E + KI K+ + +E        A +K ES  ++  + L++ ++  E
Sbjct: 980  RLNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKE 1039

Query: 1017 WVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRV 1076
             + +L +     +++L+K K SL S  E L      W +++  +    IS++E+++    
Sbjct: 1040 QIEKLNQRIVIIESDLEK-KTSLLSENESL------WKKKQDAF----ISDLEESK---- 1084

Query: 1077 ENSVLIEKIDGATEGSNSNEKY---LELVS-----------------LFSNLRHERSSLE 1116
                  +KID  T   N N+ Y   LEL++                 +F+ LR +R  LE
Sbjct: 1085 ------KKIDNLT---NQNKLYVDQLELLNKDFSSMDSSQLSSETKHMFNRLRADRDVLE 1135

Query: 1117 TKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNI 1176
            TKL+  +RD      K  SL   + ++Q       NK+   +              Q+ +
Sbjct: 1136 TKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSELNQITL 1195

Query: 1177 LRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESE 1236
             +E+N  L   +  + EKN+ +  +L     ++S L   L   KE +      ++  + E
Sbjct: 1196 FKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEE 1255

Query: 1237 IEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHE 1296
              + + R ++LS Q      +   KL   +  L+      +  NA+LE +FN LKKQAHE
Sbjct: 1256 SNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHE 1315

Query: 1297 KLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLE 1337
            +L+ASK+ Q++L  ++NELK +   +E  L +E+ K +DL+
Sbjct: 1316 RLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQ 1356

 Score = 59.3 bits (142), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 127/286 (44%), Gaps = 75/286 (26%)

Query: 1447 TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKE---------NNKSLV 1497
            T++RI+EA+E LKKRIRLPSE +I ++I KRK ELE E+E KL+E         N+   +
Sbjct: 1505 TLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQEKLNEIEANRNSIETI 1564

Query: 1498 FSGSNEEEAEDEL-----------WNSPSKGSSE----KPSVVTDLIKQKNIKLQEQLKN 1542
              G   EE ++E+            N   K S E    + S+ T L+++K  KL+ QL  
Sbjct: 1565 DPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQLSE 1624

Query: 1543 VKNAVTFNDKRPKSENKENNIPD----SAAADNRVPS----AFSFGKPLFSSNTSSFQSF 1594
                   +DK P        I D    S  A  + PS    AFSFG    +++ ++ + F
Sbjct: 1625 AIENDKQSDKNPI-------ISDLAQTSTLASIQPPSAKKPAFSFGGFNTTNSLNANKGF 1677

Query: 1595 -----------------HNPFTPSAANFSTDGSLPTFNIKSAFAAGTAGNTLKTSDPA-N 1636
                              NPF+   +   T  S   FN  S  ++ T  N    +  + N
Sbjct: 1678 SSSSNNTSQSSKDTEIVQNPFSLGVS--QTSSSPMHFNPFS--SSATTSNVFNQNGTSKN 1733

Query: 1637 VGINEAKVMEIGNTSK------RPIQSDTSSDPDSKKFKESPENDL 1676
            +  N   VM +  T+       +P++S T ++       E PE+DL
Sbjct: 1734 IFGN---VMAMKPTTPTVEQAIKPLESVTPTET-----PEVPEDDL 1771

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  237 bits (604), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 310/1187 (26%), Positives = 594/1187 (50%), Gaps = 92/1187 (7%)

Query: 195  LSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLE 254
            LS  + K    + + ++ L+N ++ L+  + + E +   NK   ++N +L+  V ++L +
Sbjct: 204  LSEMSNKFYTLKTSSSNELRNAKDALHSLEKQYELLLEENKAFKERNNELTTTVSDELFK 263

Query: 255  IKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHID 314
             K+L++  N  K  F++EMTL +  NDLL+  +   +  ++ +    G   L K+     
Sbjct: 264  KKSLENDLNELKESFTREMTLTQHENDLLKEHIEYLK--NTTKETTGGTSTLEKDR---- 317

Query: 315  VAEELIDAKLKLEKSKEECQLLKNIVSDCIEENXXXXXXXXXXXXXXKLFSNIKTLKRQL 374
            +  EL+D K  LEKS+ E   L + +   + EN                 + +  LK QL
Sbjct: 318  LLHELVDIKKSLEKSELENVHLNDFIEQYLTENEESTSD-----------NELVLLKEQL 366

Query: 375  VKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDE 434
            +KE+ QK  +Q Q++ FV+ELE++ P + S K+R + LE EL   T LLE          
Sbjct: 367  IKEKRQKDYLQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRI 426

Query: 435  KKLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLL 494
            K+LT+  +++     NI+ L+ QR+DLA QV+ LL N+   +     L+ DE+  LRK++
Sbjct: 427  KELTTENRRLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKII 486

Query: 495  ESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKI 554
            +S N+ N+ DSQ II+E+LV+F +I  LQ++NMELL   R LA++LE+++ ++ + + + 
Sbjct: 487  KSRNSQNDSDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSVQKITRN 546

Query: 555  ENQTXXXXXXXXXXMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGITEATYE 614
            E++            ESIN  L  ++  L +E+D+YKLL+  N  +    TE +  +  +
Sbjct: 547  ESK-----EKIAKLQESING-LTSKLEKLQKEKDAYKLLSLQNTGE-QTPTEEL-RSQLQ 598

Query: 615  KKIREL-----QSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEK 669
            KK  +L      S L S   E  A +  LN  ++  KK + D   A+ +  + + +  +K
Sbjct: 599  KKEEQLTKLERMSSLDSHLAEEKAKV--LNQSIIKLKKEKYDLNNAIIKETSQRAIAEKK 656

Query: 670  EAMLQERIN--HLKTQLEKQRLSAAPPVQDYKY----SNLTDLSHS------ENKIGSLK 717
              ML++ +   H K  L      A    + Y+      N  ++ HS      + KI  L+
Sbjct: 657  SKMLEDSLELLHKKYDL------AVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQ 710

Query: 718  YEISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYS 777
             EI + K+         E+    L    +EK  L  +LS  +    ++  +   +E  Y 
Sbjct: 711  KEIESYKQNLLQYSKDNENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYK 770

Query: 778  TRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKE 837
                + E+ LK+  ++LE K +E+K  ++ KNSQ+ W Q  +D        +  EL NKE
Sbjct: 771  EHDSISERLLKKSKIQLEDKIKEVKDFEAKKNSQINWYQKRLDSLTTTNDKLQVEL-NKE 829

Query: 838  TTIGRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKA 897
             T  +++++       L+++ L+     NT+ +++L P + ++ ++ + ELK+   +I  
Sbjct: 830  LT--KINIQ------RLKISDLEKTLSQNTNGSSSL-PRVDQDFEKLKNELKEKQLEINQ 880

Query: 898  YEEIISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKELDEIRCLQPK 957
            Y ++++  E     L  +L K ++  +    +E KE+   +++L+ L +E   +  L   
Sbjct: 881  YRDLLNLAEETKNRLQKDLNKQRQIVDDA--MEGKEQL--DQQLAELTQECSSMNSL--- 933

Query: 958  LREGASYLVLQSEKVGDQAQRIQEMKNKI-----------DKMAAIIEAYQKEESSQYQS 1006
            L++  +      + + D+A   + +KN +           ++M    ++++++E++ Y+ 
Sbjct: 934  LQKQKAKCEDDQKIIQDKATETENLKNSLSSLENKITTLENEMVEKTKSFEEKENT-YKE 992

Query: 1007 ELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYE----- 1061
            +L    + S  + ++E E   Y+T L   K ++ + ++ +  + +K ++EK ++E     
Sbjct: 993  QLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAYRQKLLDEKFNHELQVDE 1052

Query: 1062 -RELISNIE-QTESLRVENSVLIEKIDGATEGSNSNEKYLELVS----LFSNLRHERSSL 1115
             +E I N+  Q    + + S +    +G+T  ++++E  +   S    L   LR ER  L
Sbjct: 1053 FKETIDNLNFQIHIQKGKRSFITS--EGSTTSNDTDETVVNDTSDKNELILALRRERDGL 1110

Query: 1116 ETKLTTCKRDLALLRQKNASLEKSIGDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVN 1175
            + KL   +R++  LR++  +L+ S+ + +++     ++V                  ++N
Sbjct: 1111 DIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQLNELN 1170

Query: 1176 ILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYES 1235
             L+E N  L + L+   ++N  I+ +L  ++ E++ L+  + + K  +     ++     
Sbjct: 1171 TLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQLTLLSE 1230

Query: 1236 EIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAH 1295
            E E+ K R +++  +++     E  KL   +  L+ +L      N DL ++FNRLKKQAH
Sbjct: 1231 ENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNEDLNDRFNRLKKQAH 1290

Query: 1296 EKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLELKLKE 1342
            EKLDA+K Q  +LT E+ +L + K KLE +L  E  ++ ++E +LK+
Sbjct: 1291 EKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQ 1337

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 25/27 (92%)

Query: 1448 VKRIKEAEENLKKRIRLPSEERIQKII 1474
            ++RI +AEENLKKRIRLPSEE+I ++I
Sbjct: 1485 MQRIADAEENLKKRIRLPSEEKINRVI 1511

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  214 bits (546), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 362/1450 (24%), Positives = 691/1450 (47%), Gaps = 144/1450 (9%)

Query: 4    KISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKLT 63
            K++ FL    + ++ +  + LK L  +  EF   E E  K++  ++  K    T I KL 
Sbjct: 23   KVASFLDTSPDVVQTLDETILKSLNNRFDEFNHIENEQIKISTELEVTKKTNNTTIKKLK 82

Query: 64   KLLNE--SSEEKVINSKVMNRLQDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEEGA 121
              L E   S E V   K     +   +EE+    R  D L  +L   H   + + + +  
Sbjct: 83   NELTELIDSYESVCKEKEDAYKKIAEEEEKKIDNR--DELESKLIQIHSLEENVSELQSK 140

Query: 122  KEE-ASSWQDGLRNDDSTKH---VLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTA 177
            K+E   S  D +   +  +H   +L+ E    + K+L++EN  Q  K N +S + + +  
Sbjct: 141  KQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQDLKINDLSQRTQLERL 200

Query: 178  SQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFL 237
            SQE E   + K W EERL    ++         +  Q+L+ +LN  + E + + + N  L
Sbjct: 201  SQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNTVKNELDQMKSTNCVL 260

Query: 238  LDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLR 297
             ++  +LS+ + +    +KN++ + N +K+   KE+TL++++  +L+SQL   +R +   
Sbjct: 261  QERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVVLQSQLNELQRENGNE 320

Query: 298  PKEKGDDKLCKNPEHIDVAEELIDAK--------------LKLEKSKEECQLLKNIVSDC 343
                  D    + +  D   E+ D K               KL KS++   +  +  SD 
Sbjct: 321  LSLTVSDTASSSRKDSDFTREINDLKNQLNHVQERNVELEFKLRKSEDYTAVSNSTSSDD 380

Query: 344  IEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALV 403
            +                 K + +I  LK++L  E+SQ+   +  L++F+ +LE + P L 
Sbjct: 381  L------------RNSLAKAYDDIDVLKKKLNDEQSQRENFEKNLEEFMDDLETELPTLE 428

Query: 404  SFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDLAR 463
            +++ R    E ELK +T LLE  +  K     +L   + +I S E  I  + +QR DLA 
Sbjct: 429  AYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIEQEIKLVAKQRSDLAN 488

Query: 464  QVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVN--ERDSQIIITEKLVEFKNIDE 521
            Q++  L + S    +  PL+++E+  +R +++ ++ ++  E D+Q +I+E+L +FK+I E
Sbjct: 489  QLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQKVISERLTKFKDIIE 548

Query: 522  LQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINSKLALRVN 581
            LQ+KNMELL   R LA KLE  +       ++IE +T          +++ NS L  ++ 
Sbjct: 549  LQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAILTLQNYNSSLTAKIA 608

Query: 582  ILTRERDSYKLLASANDNKTHADTEGITEAT---YEKKIRELQSKLSSTRVESSAIIQNL 638
             LT+E ++YK+L++  D+ T AD +   E     + + ++EL+++++S   ES      L
Sbjct: 609  ALTKELETYKVLSNTEDSSTPADFDKQREQREIEHTQLVKELETRIASIIQESKENANIL 668

Query: 639  NGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERINHLKTQLEK--QRLSAAPPV- 695
            N ++    +      I L   ++ K L  E+  +LQ+ ++   T+ E+  +RL++   V 
Sbjct: 669  NDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTITENERLQKRLNSLRNVV 728

Query: 696  --QDYK-YSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQLH 752
              QD + +  +  L  + +++ +++ + +  + E   L + +E L  +L R  +EK  + 
Sbjct: 729  VEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEMLKNELTRLNEEKNSMK 788

Query: 753  VKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQL 812
            + ++  +T  +E+  +  + + +++  +  LE    +L  +L+  E+   +L   + ++L
Sbjct: 789  LLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKEAEENYGSLME-ETTEL 847

Query: 813  KWAQNTIDDTEKNLKSVSAELSNKETTIGRL-SLEIENLGNELRMTK-------LQYKFL 864
            K      DD  +  KS+  E+SN E     +   E E      R+TK       L  K+ 
Sbjct: 848  K------DDFRQKKKSLKEEMSNVEKRYSEIVEKERETKWENTRLTKQLKEKTELIEKYK 901

Query: 865  SNTSDTNTLE--PTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKED 922
            + + D   LE   +L+KEL+  + EL +++SQ ++Y + I      + ++N         
Sbjct: 902  AASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIELLNQSIADINK-------- 953

Query: 923  CETKIQLENKEKGAKEE----ELSH---------LRKELDEIRC---LQPKLREGASYLV 966
                 Q+ NKE   KE     EL+          L+ ++D++     +Q KL E      
Sbjct: 954  -----QVLNKEAAFKERITEVELAKNNIADSNTVLKTQIDDLNNELEVQKKLYEDEK--- 1005

Query: 967  LQSEKVGDQAQRI-----QEMKNKIDKMAAIIE------AYQKEESSQYQSELKTNKDLS 1015
            +   +  ++ +R+     Q  ++  DK+ ++++       Y  +  + Y+ EL+ + ++S
Sbjct: 1006 INFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQNHANVS 1065

Query: 1016 EWVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLR 1075
            + + +L ++   Y+TE+ +   S    + LL+ ++  W +++ +YE+++    ++ E   
Sbjct: 1066 KTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKRIEEES 1125

Query: 1076 VENSVLIEKIDGATE----------GSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRD 1125
             +N +L E+    T+          G NS E   +LV    +LR ER  L+ +L   + +
Sbjct: 1126 EQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVL---SLRSERDLLQERLNVTEAE 1182

Query: 1126 LALLRQKNASLEKSIGDLQRANTVPRNKVQ-----CPAVXXXXXXXXXXXXAQVNILREN 1180
              LLR++  S+EK      RA  +   K++      P +             Q+++LRE+
Sbjct: 1183 EKLLRERLTSIEKDF----RATDLELQKIKEETHNYPDLLEQHKTVMSQL-TQLDLLRES 1237

Query: 1181 NAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAY-ESEIEQ 1239
            N  L      +  KN+ +  E+ N+ +++  L+  L QT   +    +K L+    E E+
Sbjct: 1238 NITLRNETIELQSKNQHLQTEVENLHDKLLPLETEL-QTLTNLIEEKDKQLSICHEESER 1296

Query: 1240 CKQRYQD-LSQQQKLT---HKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAH 1295
             KQR QD LS+ Q++    H+N  E+ + +   LE K       N +L N+F +LKKQAH
Sbjct: 1297 WKQRSQDILSKYQRIDPVEHENLAEERNRLQAQLEEK----SKENEELGNRFEKLKKQAH 1352

Query: 1296 EKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHD 1355
            EKL+ASK  Q +LT ++N+L+  K +L   L  E+   + LE +L+        +   HD
Sbjct: 1353 EKLNASKISQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLE------VTMKNSHD 1406

Query: 1356 SIAFKPFVEE 1365
             ++ +  +EE
Sbjct: 1407 IVSIQSQLEE 1416

 Score = 61.6 bits (148), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 41/51 (80%)

Query: 1447 TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLV 1497
            T +RIKEAEENLK+RIRLP+EE+I K+I KR+ +LE EF+ K++   K L+
Sbjct: 1553 TSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELL 1603

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  203 bits (517), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 306/1191 (25%), Positives = 544/1191 (45%), Gaps = 171/1191 (14%)

Query: 219  KLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKK 278
            KL+Q+ +E +++   N  LLD  ++++  + +K    K L D  ++++ +F +E+  + K
Sbjct: 161  KLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDK 220

Query: 279  MNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKS----KEECQ 334
            +N +L+ Q+ S    HS    E G+    + P H +  ++      + E+     KE+ +
Sbjct: 221  LNAVLKKQVNSL---HS----ELGNG--GETPAHAEPNDQFAKQSSQHEEEISNYKEQVE 271

Query: 335  LLKNIVSDCIEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLE 394
             L  I+                         +I  L++ L+KER +   ++ Q++ FV+E
Sbjct: 272  ELLGILGQGA--------------------PSIAHLRKLLLKERKENVSLKKQMESFVIE 311

Query: 395  LEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSL 454
            LEH+ P L   +++ + ++ +L  +T  +   S AK + +++L+S  QK++      H L
Sbjct: 312  LEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKL 371

Query: 455  VRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLV 514
              QR DLA Q++ LL+    + ++ + L   EL  ++ ++E+EN    +DSQ I++++L+
Sbjct: 372  RVQRSDLAHQIQFLLT----VNSSDTVLPPSELSFIKTIIENENWDAYKDSQRIVSDRLL 427

Query: 515  EFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXMESINS 574
             F NI ELQE+NM+L+  +R L DK+E+ E + D  +      T          +E  N+
Sbjct: 428  RFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQSNA 481

Query: 575  KLALRVNILTRERDSYKLLASANDNKTHADTEGITEATYEKKIRELQSKLSS-------- 626
            +L   V      ++   L+ +  D  +      +T    +KKI EL+SKL+         
Sbjct: 482  QLESEV------KNWEALMETLKDGDSLDSKINVTMVEQQKKIEELESKLTDVGESHVQK 535

Query: 627  ------TRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAM-LQERINH 679
                  T   + + I  LN Q+    KS  + K  L        +  ++E + L ++I+ 
Sbjct: 536  INVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSEL--------IACKRENLSLTQQIST 587

Query: 680  LKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTR 739
             + +L++    +A   +DY+   + +LS + NK  S +     L +E T +   + SL  
Sbjct: 588  KQNELDELNSKSAQKERDYQLK-IAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFD 646

Query: 740  DLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQ 799
             +++  K+ +QL  +  E E   + + L     E   S++I  L +  K L+  L  KE+
Sbjct: 647  KIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEE 706

Query: 800  EIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKL 859
            E+K        Q+KW Q  ID+       +S +  NK   I      IE L ++LR+  L
Sbjct: 707  EVKQFIEKSEKQIKWYQQNIDE-------LSEQNKNKSNKI------IE-LNDKLRL--L 750

Query: 860  QYKFLSNTS-DTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENV---------- 908
              K LSN      T    L+ EL   +  L+ + SQ   Y++ +  N+N           
Sbjct: 751  SEKSLSNKPYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQN 810

Query: 909  ----LKELNGELKKAKEDCETKI-QLENKEKGAKEEELSHLRKELDEIRCLQPKLREGAS 963
                L+  N  L K  E  + +I + EN+ KG + E  + + +   E   L+ KL     
Sbjct: 811  TISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSEKTALEEKLN---- 866

Query: 964  YLVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEESS---QYQSELKTN-KDLSEWVM 1019
                    +    ++I EMK + D     IE+  K +S     ++S L +  K+L+ + +
Sbjct: 867  -------SLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSYAV 919

Query: 1020 RLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENS 1079
            ++E+      TE+ K    + +  E  +   K  ++E+    +EL    ++ ESL  +NS
Sbjct: 920  QIEQ----LNTEIAKLNSDIAALTEPAEAR-KTLIKERDSLGQELKLANQRIESLAAQNS 974

Query: 1080 VLIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKS 1139
            +L +   G        E   +L +L  NLR ER   +++ TT +RD+ LL++    + + 
Sbjct: 975  ILYDTFSGMRHVDADAEPNEDLRNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEK 1034

Query: 1140 IGDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVN---ILRE---------NNAILHKS 1187
            +             + CP +              V    I+RE          N  L +S
Sbjct: 1035 LA------------ITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLDES 1082

Query: 1188 LKNVTEKNEAIYKELINMQEEISRL-QGHLIQTKEQVSIN----ANKVLAYESEIEQCKQ 1242
            +K++ E           +QEE+SRL +   +  K   +I+      K+  Y+ E E+ K 
Sbjct: 1083 IKSLNEDKRT-------LQEEVSRLRESEELAKKNSSAISEQEWQQKIETYQQESEKWKL 1135

Query: 1243 RYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASK 1302
              Q +S+      +N  ++L     D+++K       N DL ++F RLKKQAHEKL+ASK
Sbjct: 1136 MCQQMSENTATEIQNLQQQLETFKADIQLKT----QENDDLNDRFTRLKKQAHEKLNASK 1191

Query: 1303 KQQTALTNELNELKETKDKLEENLHNEESKVVDLE------LKLKEHGLQV 1347
                +L  EL+ELK   D L+E L+N+E+  VD E      L+LKE   Q 
Sbjct: 1192 ATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQA 1242

 Score = 59.3 bits (142), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/45 (57%), Positives = 41/45 (91%)

Query: 1447 TVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKE 1491
            T++RI+EA+ENLKK IRLP+EE+I+++I+KRK +LE++F+ K+ E
Sbjct: 1343 TLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAE 1387

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  198 bits (503), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 245/801 (30%), Positives = 399/801 (49%), Gaps = 79/801 (9%)

Query: 3   DKISEFLHVPSESLRGIKHSALKRLYKKIGEFERSEKEVTKLNVFVDEIKSQYYTRISKL 62
           DKIS F  +P  +   +   AL+++Y K  +     KE + ++  +D+IK  Y  +I+ +
Sbjct: 15  DKISSFFDLPGNTWESMDEHALEKIYTKAYDL---MKENSFVSAAIDDIKHVYEGKINTI 71

Query: 63  T-KLLNESSEEKVINSKVMNRL--QDQLKEERSRHTRKIDALNKQLNASHETIKKLEDEE 119
           + K  N   E K +  K    L  +++L  E+ +     DALN ++     T+ K  D E
Sbjct: 72  SQKYFNLQLENKKLKEKESGYLVAREKLVSEKQKEFDSNDALNSEI-----TLIKY-DLE 125

Query: 120 GAKEEASSWQDGLRNDDSTKHVLDKENKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQ 179
             + + ++ +   R    T++VL++    LQ  L E        K      + K D+ +Q
Sbjct: 126 AMQRDHTTLEARER---KTENVLEQSKLELQDSLTEN----SALKEQIGVFEGKLDSMTQ 178

Query: 180 EKELWLQNKKWTEERLSSCNQKAL----------VDEVTKTSYLQN-------LEEKLNQ 222
             ELWL N   TE +      K L            E  K   L +       L+++L  
Sbjct: 179 --ELWLAN---TENKKLQTGMKLLRENNLYLEIKCKETDKNKKLYSSAEDASRLQDQLQI 233

Query: 223 TQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKKMNDL 282
             +E  S+ +    L   N+ LS  ++ KL  IK+L D  N+ K EF+KE+TL++++N+L
Sbjct: 234 VSSEILSLKSEIATLKYMNESLSTDLQRKLFRIKDLDDNLNSSKQEFAKEITLKQRVNEL 293

Query: 283 LRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKNIVSD 342
           L +++ S+++       E+   K  + PE   + +EL+D K KL  S++EC  LK+ V  
Sbjct: 294 LHNEIASYKKQI-----ERLTSKNLETPEK-KIIQELVDLKEKLVNSEKECNELKSTVDK 347

Query: 343 CIEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPAL 402
            I  N              KL   I+ L+RQLVKE+  K  +Q Q++ F++ELE K P +
Sbjct: 348 YI--NIDEKKLISKFGNPKKL---IEILRRQLVKEKRHKDTLQRQVESFLVELEQKLPMI 402

Query: 403 VSFKERTELLEHE-LKCSTELLETMSLAKRKD--EKKLTSLEQKINSYEANIHSLVRQRL 459
            SFKER   LE E L+ ++ L ET   AK +D  +++LT+L++KI++ E     L+RQR 
Sbjct: 403 DSFKERNSSLERELLRITSSLEET---AKERDIKDRELTNLQKKISNNEQFNDELLRQRS 459

Query: 460 DLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNI 519
           DLA QV+ LL  I       SP +  E   ++K++ +ENT N+ DS  II+++L+ F+N+
Sbjct: 460 DLAHQVQYLLLCID----NKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNV 515

Query: 520 DELQEKNMELLDCIRILADKLETNEGEADKTVAKIE-NQTXXXXXXXXXXMESINSKLAL 578
            ELQ+KNMELL   R L   LE  E E  KT+   + N+           +E     L  
Sbjct: 516 KELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLES 575

Query: 579 RVNILTRERDSYKLL---ASANDNKTHADTEGITEATYEKKIRELQSKLSSTRVESSAII 635
           ++NI+++ERDSYKLL   ++   N ++     + +   EK+   L ++LSS + +   ++
Sbjct: 576 KINIISQERDSYKLLVTNSTIQSNTSNNSISSLQQCELEKE--RLTNELSSMKQQHVKVL 633

Query: 636 QNLNGQLLTYKKSQTDGKIALQE----FENFKV---LVAEKEAMLQERINHLKTQLEKQR 688
           + L  ++ T +KSQ   K+ +++    F+  K    L+ E    L+ +I  L+  L +  
Sbjct: 634 EELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVDKLENKIKTLEQDLAENE 693

Query: 689 LS----AAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERC 744
           L         V + + S + +LS +E KI  L  EISNLK +N  L     ++T      
Sbjct: 694 LFEKNLITGGVNNLEQSKIIELSVAEQKISFLDKEISNLKSKNKNLEDKILTMTLSKNLL 753

Query: 745 CKEKMQLHVKLSESETSHNEQ 765
             + +QL   LSE E   N Q
Sbjct: 754 DNKVLQLETSLSERELPKNTQ 774

 Score =  120 bits (301), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 113/337 (33%), Positives = 165/337 (48%), Gaps = 24/337 (7%)

Query: 1177 LRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESE 1236
            L E+NA L K ++N T+ NE +  +L +MQ ++  L+  + + K +V+     +   + E
Sbjct: 1072 LEESNAKLIKEVENCTKVNETLSSQLADMQVKLEPLEQEINELKLKVAEKEQHLNICQEE 1131

Query: 1237 IEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHE 1296
            +E+ K R Q + QQ K+  +    K    I  LE +L  V+  NA L ++F+RLKKQAHE
Sbjct: 1132 LERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRTENAQLTDRFDRLKKQAHE 1191

Query: 1297 KLDASKKQQTALTNELNELKETKDKLEENLH--------------NEESKVVDLELKLKE 1342
            KLDA+K  Q  LT ++NEL ETK  LE++L               +E  +++ L  +L++
Sbjct: 1192 KLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSGNGAADESEEIIRLRAELEK 1251

Query: 1343 HGLQVGEVSKDHDSIAFKPFVEEIESLKKELQ---VFRNANDASDAFXXXXXXXXXXXXX 1399
                  E+ K  +    K F  EIESLK ELQ    + N+   S                
Sbjct: 1252 SNNFSNELEKKVEDA--KKFKNEIESLKSELQSVKAYENSTVNSKIIKDLKESFKREKDE 1309

Query: 1400 XXXXXTKDFEKKLQDAXXXXXXXX-----XXXXXXXHIXXXXXXXXXXXXXXTVKRIKEA 1454
                  K+F+ KL+                      +I               +KRI EA
Sbjct: 1310 LIEQMKKEFKTKLEKEKETILAQRKNNILANGQESANIEELKKKWEEEQEALILKRITEA 1369

Query: 1455 EENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKE 1491
            EENLKKR+RLPSEE+I  +I KR+  LEQEFE KL+E
Sbjct: 1370 EENLKKRMRLPSEEKINAVIEKRRKVLEQEFETKLRE 1406

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  167 bits (423), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 257/974 (26%), Positives = 457/974 (46%), Gaps = 108/974 (11%)

Query: 214  QNLEEKLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEM 273
            QN+ E L     E    +  N  L  +N++LS  +  K+ EIK+L+++  T   +F  E 
Sbjct: 170  QNVMENLTAIDNELRMTNGKNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEK 229

Query: 274  TLQKKMNDLLRSQLTSFERGHSLRPKEKGDD----KLCKNP---------EHIDVAEELI 320
             LQ ++ + L++Q+ + +        EK DD    KL K+          E ++++E   
Sbjct: 230  QLQDQLINALQNQIKTLQEQLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISER-- 287

Query: 321  DAKLKLEKSKEECQLLKNIVSDCIEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQ 380
              +L L  S EE Q   NI  +    +               L  ++  L++  +KER Q
Sbjct: 288  -ERLSLVHSMEEFQ---NIPEEE--SSSVSSHASGRNNSALSLSGDVNILRKHFLKERQQ 341

Query: 381  KFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSL 440
            K Q++ Q++  + ELE   P+L S+KER+  LE EL  S  LLE +   K+++  K   L
Sbjct: 342  KRQLEEQMRQILQELERNMPSLSSYKERSTFLEKELNSSNILLEHI---KKENLDKSAEL 398

Query: 441  EQK---INSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESE 497
            E+K    ++  ++I+SL  QR  LARQVK LL  I   +T  S L   +L  L + L + 
Sbjct: 399  EKKESECSNLRSSINSLAFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAAN 458

Query: 498  NTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQ 557
                  DS+ I+ E+L +FKN+ ELQ +NM+LL   R LA K E  E    K ++  E++
Sbjct: 459  TAEAMSDSEKILLERLAQFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDE 518

Query: 558  TXXXXXXXXXXMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGIT-----EAT 612
            T          ++  + KL  ++  L+ E      LA     KT  + E I+     E  
Sbjct: 519  TINDAKEAILVLQEYSQKLESQIKELSDE------LAVQKKEKT--EKESISAMSKIEDD 570

Query: 613  YEKKIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAM 672
                  +L  +LS+    S  II  LN ++    ++ TD  I+L + ++ + L  ++  +
Sbjct: 571  ASSHTIDLGKQLSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNL 630

Query: 673  LQERINHLKTQLE-------KQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKK 725
            L+  ++ LK++ E       K + +     + + YS+  D    ++K+ + + EI++L+ 
Sbjct: 631  LEYNVSLLKSEKEELQEEVNKLQQNILDKEKQFSYSS-RDYISCKSKLSTAEAEITSLRA 689

Query: 726  ENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEK 785
            EN   I  + +L    E    E+  L + +++  + +NE   +    +  Y  ++K+   
Sbjct: 690  ENELSIETQTTLRTKKEALLNERNNLRMTVTQMNSLNNELQTLLKETKSGYDDKLKISAL 749

Query: 786  NLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSL 845
               + N +L+  +Q +  L+S  +S++KW + TIDD + N+  ++ EL  KE  I   S 
Sbjct: 750  KCTQTNNQLQLVQQRMSELKSQNDSEIKWYKATIDDLKANVFELNEELKQKEEKIEEFSK 809

Query: 846  EIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTN 905
             +EN+ NEL         L+N+ D +  +  L KEL + + +L+ ++ ++K YE +IST 
Sbjct: 810  TLENVQNELT--------LANSKDVSEEKRALEKELSEVKSQLEKSNLEVKEYENVIST- 860

Query: 906  ENVLKELNGELKKAKEDCETK-IQLENKEKGAKEEELSHLRKELDEIRCLQPKLREGASY 964
                         +K   E K IQ E++ K       S L  EL E   LQ  L    + 
Sbjct: 861  -------------SKRSFENKSIQYEDRIKALA----SKLDSELRERTTLQENLSTLQAR 903

Query: 965  LVLQSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEE-----------------SSQYQSE 1007
            +V+Q +++      + E++   D +    + ++ +E                 S  Y+  
Sbjct: 904  MVVQQDELTSNNNTLSELRVSYDSLLLEQKTFKDKEAELRSVIAVKTGNYDSLSKSYERI 963

Query: 1008 LKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISN 1067
            ++ N +LS+ V+ L +E    +T   + +  L  T+ ++ + +  W EEK  +E ++ + 
Sbjct: 964  MQENSELSK-VVELLREEVKNRTSNGEKEGDLEDTESIIKKGQDVWDEEKKVFEVQITNL 1022

Query: 1068 IEQTESLRVENSVLIEKIDGATEGSNS---------NEKYLELVSLFSNLRHERSSLETK 1118
             E+   L  EN  L+ +++   +G+NS         NE+ L      + LR ER+SL  K
Sbjct: 1023 NERLSELLEENESLLARLESQDKGNNSPSAETNAAGNEETL------AALRSERTSLIEK 1076

Query: 1119 LTTCKRDLALLRQK 1132
            LT  +++   +R K
Sbjct: 1077 LTAAQKEERSVRHK 1090

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 42/55 (76%)

Query: 1449 KRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSGSNE 1503
            K++ +AEENLKKRIRLP+EE+I  II KRK ELE  FE+K+KE  KSL+    ++
Sbjct: 1230 KKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDD 1284

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1674

 Score =  159 bits (401), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 186/685 (27%), Positives = 338/685 (49%), Gaps = 56/685 (8%)

Query: 153 LLEMENILQVCKSNAVSLQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVDEVTKTSY 212
           +L ++  L+  KS  +  Q + + + ++ EL  ++ +W EE L    ++ +    T+   
Sbjct: 103 ILTLQRELERAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEELM----TQKQS 158

Query: 213 LQNLEEKLNQTQTENESVSTY---NKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEF 269
           +  +EEK  +       VS     N  LL +N++LS  V+EKL+EIK   D  +T++ EF
Sbjct: 159 ILKMEEKDQEIDNLRHEVSILKKNNDLLLGKNQELSENVQEKLIEIKQKSDDYSTKQQEF 218

Query: 270 SKEMTLQKKMNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKS 329
             E+ L+ ++N  L +QL   ++  S++ ++          E   + E+LID + +L+ S
Sbjct: 219 LHEIGLKDRINSSLETQLKEIQQEKSIQNEDN-----TSRAESQKIMEQLIDTRKQLKDS 273

Query: 330 KEECQLLKNIVSDCIEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQKFQVQNQLK 389
           + EC  LK+ V++ I +               +  S+   LK++L+K + QK  ++ Q++
Sbjct: 274 RNECTRLKSYVNEFIND------------VNGEYSSSSSLLKKELLKVKEQKDYLETQVE 321

Query: 390 DFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEA 449
           +F+ ELE K P + S +++ + LE EL   T L++ +S+ +   EK+  S ++K    + 
Sbjct: 322 NFITELEIKVPVIDSLEKKNKDLEKELSDVTSLVDRISIERESLEKEFQSFKRKSEHNDG 381

Query: 450 NIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIII 509
            I +L  QR DLA Q++ LL  +    TT + LS DE   +R+L E++      DSQ II
Sbjct: 382 MIQTLTTQRSDLAHQIQFLLLILGEQATTNALLSKDETDFIRRLTENDTYARNNDSQSII 441

Query: 510 TEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXXXXXXXM 569
           +E+L++F +I ELQ++NM++L  +R LA +LE  E         IE +T          +
Sbjct: 442 SERLLKFADITELQKQNMDILATVRHLAGQLEEQEKLRQADHHTIERKTLEEAKKALLDL 501

Query: 570 ESINSKLALRVNILTRERDSYKLLASANDNKTHADTE--GITEATYEKKIRELQSKLSST 627
           +   + L  ++    +ERD YKLL+      ++  +E   I + T  K    LQ++L  T
Sbjct: 502 QEYTNSLERKLETFRKERDVYKLLSKGKSPSSNKPSECNDIDKHTTGK----LQNELQQT 557

Query: 628 RVESSAIIQNL---NGQLLTYK-------------KSQTDGKIALQEFENFKVLVAEKEA 671
           R   +  I+ L   N  +L  K             K   +GK  L   EN  +++ E   
Sbjct: 558 REYLTKEIEKLTRTNKDILNKKKELEYSMKKMESAKEYAEGKAEL--IENNLLMLQENRK 615

Query: 672 MLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLI 731
            + E+ +HL+  L ++    A   QD     L +L+   N    L+   ++ + ++  L 
Sbjct: 616 SVLEQNDHLQQLLSQKEAKLAELTQD-----LHELTSQYN---LLQIRFTDTQSQSNSLR 667

Query: 732 AMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELN 791
              ++  ++L    +EK  L VK+ E E S NE   I  + EL+ + R+   + + ++L 
Sbjct: 668 TQHQTTQKELFEVVEEKNALKVKIHELEISRNECKGIQATVELKLNERLTEYQLHEQDLL 727

Query: 792 VRLESKEQEIKTLQSSKNSQLKWAQ 816
             +E +E +I+ ++  +  +L W Q
Sbjct: 728 KIIEKQEDQIRDMEVKRAEELNWYQ 752

 Score =  101 bits (251), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 114/455 (25%), Positives = 207/455 (45%), Gaps = 52/455 (11%)

Query: 1072 ESLRVENSVLIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQ 1131
            + L  +N++L E+++   +  ++  K  ++  +   ++ ER +L+ KL   +R+  +LR+
Sbjct: 991  DDLCTQNNLLHEQLNATLDLEDTQNKD-DIKDIIVCMKRERDTLQKKLAIVEREGEVLRE 1049

Query: 1132 KNASLEK---SIGDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAILHKSL 1188
            + A L+    ++   Q+ + +P + +                  +V++LRENN  L   +
Sbjct: 1050 RCAGLKSELDAVSKGQQWHNLPLSNLLTG------HEKILDELKEVHLLRENNVSLLTEV 1103

Query: 1189 KNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLS 1248
              +   N  +  EL  +++    LQ     T+        ++  Y+ EIE+ K+R+Q + 
Sbjct: 1104 NQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDEIERWKKRWQQMV 1163

Query: 1249 QQQKLT------HKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASK 1302
             +Q  T       KNE + L  +I +              L  KF  LKKQAHEKLDA+K
Sbjct: 1164 HRQDDTLGLEANFKNEIDSLKGLIEE-------RTKEKEKLSEKFQLLKKQAHEKLDANK 1216

Query: 1303 KQQTALTNELNELKETKDKLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPF 1362
                 L N+L+E+K +  +LEE +  ++ K+ ++EL LKE+   + +  KD   ++ K F
Sbjct: 1217 IHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELTLKEN---LEKFDKDEKLVSEKTF 1273

Query: 1363 VE---------------------EIESLKKELQVFRNANDASDAFXXXX-----XXXXXX 1396
             E                     E+ SL++E+ V R  +D ++                 
Sbjct: 1274 KENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKKDDETNQLISTMKLDFEREKDRL 1333

Query: 1397 XXXXXXXXTKDFEKKLQDAXXXXXXXXXXXXXXXHIXXXXXXXXXXXXXXTVKRIKEAEE 1456
                     + FE    +                ++              T++RI+EA+E
Sbjct: 1334 IEEKVRELNEKFESGRNEVLSKQSENVTNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKE 1393

Query: 1457 NLKKRIRLPSEERIQKIISKRKGELEQEFERKLKE 1491
            NLK+ IRLPSEE+IQ+II KR+ ELE +F+++++E
Sbjct: 1394 NLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEE 1428

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  139 bits (349), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 309/1306 (23%), Positives = 577/1306 (44%), Gaps = 155/1306 (11%)

Query: 149  LQRKLLEMENILQVCKSNAVSLQFKYD-TASQEKELWLQNKKWTEE-----RLSSCNQKA 202
            L+ +L  ++N L++ K   ++LQ + D T +    L L+N     E      L+S  Q  
Sbjct: 95   LRAELENLQNDLELLKDKDLALQSERDSTVALLDGLKLENSALRAEIEQAKELASIRQHD 154

Query: 203  L-VDEVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDT 261
               D  +KT  L + EE+L   ++E  S       L+ Q ++LS  + ++  +I+ L D 
Sbjct: 155  YEADLDSKTGALVSKEEELRLAKSERAS-------LISQTERLSQELLQRDADIRQLVDA 207

Query: 262  ANTEKSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEELID 321
                + E++ E+ LQK    LL+ Q+ S E+   L   E         PE+         
Sbjct: 208  DKLRQDEYTDEINLQKHRARLLQEQVASLEKEAKLVGHET-------EPEY--------- 251

Query: 322  AKLKLEKSKEECQLLKNIVSDCIEENXXXXXXXXXXXXXXKLFSNIKTLKRQLVKERSQK 381
               ++    EE  L +   S  I  +              +L +NI  L  +L +E   K
Sbjct: 252  ---EIPPPGEEVALQQR--SHSISMDSLLTGNDETSHSMSELNNNISILSNRLKRETLSK 306

Query: 382  FQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLE 441
             +++ Q+  FV ELE   P + SFK+++E  + ++      LE ++  K    +++   +
Sbjct: 307  QKLEKQVHKFVTELEQTAPIIKSFKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYK 366

Query: 442  QKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLES---EN 498
            +++         L R+R DLARQ++ LL N   ++ +  PL++ E   ++++L +   E 
Sbjct: 367  KQLEQISGQDKILRRERFDLARQLQYLLLN-GFVKDSDDPLTSSEFSYIKEILNTDPEEG 425

Query: 499  TVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEG--EADKTVAKIEN 556
              +  DSQ+II++++++FK+I ELQ++N+ LL  +R L+D+ ET E   E+  ++  I  
Sbjct: 426  NTSSTDSQLIISKRMLKFKSIVELQQQNINLLSAVRTLSDRAETLERKLESGDSIEAI-- 483

Query: 557  QTXXXXXXXXXXMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGITEATYEKK 616
                        ++  NS L  +V  LT +  + +   S  D +      G ++ +    
Sbjct: 484  ---NEAKQTLLDLQQYNSSLEAKVESLTNKLKANEHFTSIGDGEF-----GNSDLSDGNN 535

Query: 617  IRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEK------- 669
            I+ L++K  S   ESS  I +L  Q+   ++S++D     +   N K L+ ++       
Sbjct: 536  IQALKNKYDSLMAESSETIGHLYSQINNLQQSKSDLAKECESLINSKHLIEDRLKITQDM 595

Query: 670  -------EAMLQERINHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISN 722
                    + L+ RI +    L+++ +  +  ++ Y    L  ++    K+  ++ ++ N
Sbjct: 596  LDLSKNENSTLRNRIKNTSQALKEREVETSQTIKKY----LDCVA----KLDVIQRQLEN 647

Query: 723  LKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKV 782
               E   L   + S+   L +  KE+      + +       Q+      ++    +I  
Sbjct: 648  TLVEKDILQNAQSSIENKLNQALKERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDD 707

Query: 783  LEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGR 842
            LE    EL  ++++KE    +  ++  ++L+W Q   D    +  +++ ++    +TI  
Sbjct: 708  LELENTELRNKIDTKETSPSSALTNPKAELEWYQTKFDSLSGSNDALNEKMIECASTIET 767

Query: 843  LSLEIENLGNELRMTKLQYKFLS---NTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYE 899
            L+++ + L   L+    + K L       D N L   L  EL  ++  L D   +++   
Sbjct: 768  LTVKTQTLDILLQEANSKNKLLEARETVDDVNKLTGALETELATSRTRLTDTSRELEISS 827

Query: 900  EIISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEE------ELSHLRKELD-EIR 952
              I   ++ +K LN          E + +LEN+ K  ++E      EL+H   E + E  
Sbjct: 828  NTIRQYQSEIKVLN----------ERQSELENENKHLRDEIAILRDELTHNGGEFEREKE 877

Query: 953  CLQPKLREGASYLVLQSEKVG---DQAQRIQEMKNKIDKMAAI---IEAYQKEESSQYQS 1006
             L  KL   ++  + Q+E      D    I+++K  +DK A +   I+    EE  + Q 
Sbjct: 878  ALMKKL---SNLEIRQAELTKLEEDYTAEIEKLKLDLDKQAMLGKEIKLAHDEEVREVQ- 933

Query: 1007 ELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELIS 1066
                N++   +   LE        E+++TK  +   +EL  R   K + E+ + ++E + 
Sbjct: 934  ----NRNTETYRNELE------LVEIRQTKVFVEKEKELESRI--KILNEQIELDKERMK 981

Query: 1067 NIEQTESLRVENSVLI--EKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKR 1124
                 ESL  E   L+  EK     +   S E Y +LV   S+   E+ +LE+KL   + 
Sbjct: 982  QFSDEESLLREQVKLLADEKASDLVDAGVSPE-YTDLVRKLSD---EKKNLESKLFASQS 1037

Query: 1125 DLALLRQKNASLEKSIGDLQRANTVPRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAIL 1184
            +   LR++    E  I  L       + K +  A             AQ+  L+E+N  L
Sbjct: 1038 EKNRLREQLTKTESEIAVLNM--NYEQAKKEVAAEVNNESGRAEEHIAQLESLKESNMSL 1095

Query: 1185 HKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRY 1244
               +K    +N  I  EL  ++ +   ++  L + +  +S    K++  ++E  + K   
Sbjct: 1096 TNEVKLAQMRNGEIIAELNELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATS 1155

Query: 1245 QDLSQQQKLTHKNE-TEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASK- 1302
             D+ Q       +E    L + +  L  ++ N+++AN +LE++F RLK+QA E+LDASK 
Sbjct: 1156 HDMPQNGNKDSSSELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKV 1215

Query: 1303 -------------KQQTALTNEL----NELKETKDKLEENLHNEESKVVDLELKL----- 1340
                         K +TAL + +    +EL E + K++E++   E+  V  ELK      
Sbjct: 1216 TINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHI---ETSAVMKELKTELAAV 1272

Query: 1341 ----KEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRNANDA 1382
                K+   ++ E SK  + +      EEIESLK E+Q  + A+ A
Sbjct: 1273 MSKNKDIEAELNETSKSSNQLT-TALNEEIESLKHEVQYLKEASSA 1317

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  112 bits (279), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 128/479 (26%), Positives = 235/479 (49%), Gaps = 57/479 (11%)

Query: 384 VQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQK 443
           +++ +++++ ELE + P + +FK   E L+  L     ++E++   K+++ K + S+++ 
Sbjct: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273

Query: 444 INSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNER 503
           IN   ++I +L  QR DLA Q++ LL + S       PLS  E++ ++ L+  +      
Sbjct: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSS 333

Query: 504 DSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTXXXXX 563
           D Q +I+++L++FK+I  LQEKNMEL   IR LA  LE+ E E   +    +N T     
Sbjct: 334 DVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAK 393

Query: 564 XXXXXMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEGITEATYEKKIRELQSK 623
                ++  N+ L L +  L   +     L S+  N   ++ +      +   +++L+SK
Sbjct: 394 ETILSLQEYNNVLKLEIGTL---QSKISELQSSIPNSKESEKQHFN--YHSNLVKDLESK 448

Query: 624 LSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAMLQERIN----- 678
           LS     S + I+NLN  +      +TD  I L++ ++  +L  EK  +LQ   +     
Sbjct: 449 LSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLLTLE 508

Query: 679 ---------HLKTQLEKQRLSAAPPVQDYK--YSNLTDLSH-----SENKIGSLKYEISN 722
                     L+ QL ++  +    + DY    +NL D ++     + NK+G        
Sbjct: 509 NEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNNNKLG-------- 560

Query: 723 LKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKEL-QYSTRIK 781
           L++EN  L   K+ +  + E+         +K  +S++ H EQ+L     E+ +Y+ ++K
Sbjct: 561 LEEENNSL---KQEIKSNYEQ---------IKDLDSKSKHLEQSL---ENEISKYTDKVK 605

Query: 782 VLEKNLKELN-------VRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAEL 833
            LE N+ +LN        +L++K  EI  L SS   Q+ W Q  +D  EK +K++ + L
Sbjct: 606 ELELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRL 664

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 98/190 (51%), Gaps = 20/190 (10%)

Query: 1449 KRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSGSNEEEAED 1508
            KR+ EAEE LK++IRLPSEE+I  II  +  +LE+++++KL+  +         ++E ED
Sbjct: 1105 KRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKLETVSAESTDIEKIKQEFED 1164

Query: 1509 ELWNSPSKGSSE---KPSVVTDLIKQKNIKLQEQLKNVKNAVTFNDKRPKSENKENNIPD 1565
             L N+  K   E   + S+ T  ++ K  KL+ QL+N ++ VT  +   K+ + E + P+
Sbjct: 1165 NLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQNNESDVTDKEAEVKTTDNEKSNPE 1224

Query: 1566 SAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFSTDGSLPTFNIKSAFAAGTA 1625
                + + PS F+F  P  S          NPFT +     TD  +  F IK  F+ G  
Sbjct: 1225 LDKQEAK-PS-FTFSPPPNS----------NPFTTTQ---DTDSPVSVFGIKPTFSLG-- 1267

Query: 1626 GNTLKTSDPA 1635
             N  K S  A
Sbjct: 1268 ANPFKISPVA 1277

 Score = 57.0 bits (136), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 136/290 (46%), Gaps = 27/290 (9%)

Query: 1070 QTESLRVENSVLIEKIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALL 1129
            + ++L  +N +L+EK++ +          LE+  +F +LR+ER +L  ++   ++D+ ++
Sbjct: 734  RVQNLATQNRLLLEKLERSAN--------LEVDDIFVSLRYERDTLSDQVVNYEKDMQVI 785

Query: 1130 RQKNASLEKSIGDLQRANTV------PRNKVQCPAVXXXXXXXXXXXXAQVNILRENNAI 1183
                A LE    +L  AN+        R  VQ                 +++ L+E N  
Sbjct: 786  L---ADLESVQSELNAANSQILNFENQRAMVQDHKKGNVNEETLIEKLTELDELKERNME 842

Query: 1184 LHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQR 1243
            L + +  + E N A+  +L    E +  L+  + +    +    N +     + E  K R
Sbjct: 843  LTQEIHALNENNIALKCQLEESLERLKPLETKISELNILIEDKDNIINVSNEKAENWKTR 902

Query: 1244 YQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKK 1303
            + +L+   K    N+ E L N+   +E K       N +L ++FNRLKKQA+E+L ASK 
Sbjct: 903  FNELTLSAK---NNDNEDLINLQKQVEEK----SKENEELSDRFNRLKKQANERLHASKV 955

Query: 1304 QQTALTNELNELKETKDKLEENLHNEESKVVDLE--LKLKEHGL-QVGEV 1350
             Q  LT + NELK     LE NL  +  +  +LE  + LK+  L  +G++
Sbjct: 956  AQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISLKDQELGSIGDL 1005

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 73.2 bits (178), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 106/195 (54%), Gaps = 9/195 (4%)

Query: 364 FSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELL 423
            +NI  +K +L+KE+ +K  ++ +  DF+ ++E K P L     +   +E+E     ++ 
Sbjct: 280 INNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYL-----QNNSVENETNNGNKI- 333

Query: 424 ETMSLAKRKDEKKL--TSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAI-QTTTS 480
           E   +    D  KL   SL+ K+N +E+ + +L++QR DL  Q+  LL   S + +    
Sbjct: 334 EEQKIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNK 393

Query: 481 PLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKL 540
            L+ +EL  +R L+         ++Q II+E+L++F N+ +L  KN++L+  +R L +K+
Sbjct: 394 ILTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKM 453

Query: 541 ETNEGEADKTVAKIE 555
           E+ E +  +    +E
Sbjct: 454 ESIEKQNSQKFGDLE 468

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (77%), Gaps = 2/49 (4%)

Query: 1458 LKKRIRLPSEERIQKIISKRKGELEQEFERKLKENNKSLVFSGSNEEEA 1506
            LKKRIRLP+EE+I KII ++K +LE+EF  KL+E  KS+  SGS + EA
Sbjct: 1529 LKKRIRLPTEEKISKIIERKKEDLEKEFNEKLEEKVKSI--SGSEQMEA 1575

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 52/98 (53%), Gaps = 8/98 (8%)

Query: 368 KTLKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTE----LLEHELKCSTELL 423
           K LK+ LV E++   ++Q +L   +LEL  K P+L S KE+      + E+ +  + ELL
Sbjct: 210 KVLKKLLVHEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELL 269

Query: 424 ETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQRLDL 461
           +        +  K+ S+  KI  YE ++  L+ QR +L
Sbjct: 270 QQF----HSNTDKIASMNNKIVDYEQSLKQLLSQRTNL 303

 Score = 37.0 bits (84), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%), Gaps = 7/68 (10%)

Query: 1286 KFNRLKKQAHEKLDASKKQQTALTNELNEL-------KETKDKLEENLHNEESKVVDLEL 1338
            KF+RLK+QA+E+L+ASK  Q  L++ +  L       KE   KLE +++N  + +V+ E 
Sbjct: 670  KFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALVEAEK 729

Query: 1339 KLKEHGLQ 1346
            KL E  L+
Sbjct: 730  KLSEENLK 737

>NCAS0A02550 Chr1 complement(484341..486479) [2139 bp, 712 aa] {ON}
            Anc_4.268 YDL074C
          Length = 712

 Score = 39.7 bits (91), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 1227 ANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENK 1286
            ++K++   SE+   K+    L Q++KL   NE  K+++++ +LE++  N+Q  N++LE K
Sbjct: 559  SSKIINLNSELNNVKKSNYRL-QEEKLQQTNEATKVNSILNNLEIEKKNLQIENSNLEKK 617

Query: 1287 FNRLKKQAHEKLDASKKQQTALTNELNE 1314
            FN+LK+    K   SK Q      E NE
Sbjct: 618  FNKLKESIFNKNKDSKLQNNYTGMESNE 645

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
            Anc_6.16 YEL061C
          Length = 958

 Score = 39.3 bits (90), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 65/113 (57%), Gaps = 14/113 (12%)

Query: 1186 KSLKNVTEKNEAIYKELI--NMQEEISRLQGHLIQTKEQVSIN---------ANKVLAYE 1234
            K++KN  +    I K+++  N+  E+++++  L+ TK +  I           N + +Y+
Sbjct: 408  KNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYK 467

Query: 1235 SEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLE-VKLLNVQNANADLENK 1286
            +E+++CK+  + L+ Q  L  K++  K  N + DL+ +KL N+++A +DL +K
Sbjct: 468  TEVKECKRAIETLTSQNTLLLKDK--KASNEVNDLQRIKLQNMRDAMSDLYSK 518

>KLTH0F16500g Chr6 complement(1337865..1340381) [2517 bp, 838 aa]
           {ON} weakly similar to uniprot|P32380 Saccharomyces
           cerevisiae YDR356W SPC110 Inner plaque spindle pole body
           (SPB) component ortholog of human kendrin involved in
           connecting nuclear microtubules to SPB interacts with
           Tub4p-complex and calmodulin phosphorylated by Mps1p in
           cell cycle-dependent manner
          Length = 838

 Score = 38.5 bits (88), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 123/258 (47%), Gaps = 34/258 (13%)

Query: 706 LSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQ 765
           L  S+N + SL+ E+S L++E+   +          ER  KE++       E  TS +E+
Sbjct: 330 LKESQNALRSLRAELSTLRQESDRKLDDLSVAKEKSERVLKERL-------EERTSQSER 382

Query: 766 NLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTID----- 820
                   LQ   R   LE+N  EL+ RL+ ++Q IK L+       K  Q   D     
Sbjct: 383 --------LQ--QRANSLEQNAAELSSRLQLRDQRIKALEDEARELQKMNQRIQDLNDGK 432

Query: 821 DTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKFLSNTSDTNTLEPTLRKE 880
           D+EK L++ + +L    + I R+  E E L  E    KL+ + ++  + +  L+   RK 
Sbjct: 433 DSEK-LQAQNQKLDGLRSEIERIKNEKEEL--ERDNDKLKKRIVAQATKSPALKANSRKS 489

Query: 881 LKQTQIELKDAHSQIKAYEEIISTNENVLKELNGELKKAKEDCETKIQLENKE------K 934
           L++   E +   S+++  E+ +  +++ L +L    ++  +  E K+QLE  E      K
Sbjct: 490 LEKD-AEAEKLRSRVRELEQELRVSKDALNKLRHNYRRDTD--ELKLQLEGAETDQVSAK 546

Query: 935 GAKEEELSHLRKELDEIR 952
            + E+E+  L+ E+D +R
Sbjct: 547 RSLEKEIDRLKFEIDSLR 564

>KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {ON}
            Anc_5.414 YDR356W
          Length = 905

 Score = 37.4 bits (85), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 78/141 (55%), Gaps = 23/141 (16%)

Query: 876  TLRKELKQTQIELKDAHSQI-----KAYEEIISTNENVLKELNGELKKAKEDCETKI--- 927
             L+KELK++Q E+K+ H +I     K  +EI+   EN  +E+  +L++   D + K    
Sbjct: 549  ALKKELKKSQSEIKELHEKIISSASKKSQEILQIIENKDEEIR-KLERKIRDYDQKFSKE 607

Query: 928  ----QLENKEKGAKEEELSHLR---KELDEIRCLQPKLREGASYLVLQSEKVGDQAQRIQ 980
                 L+NK K  + E+L+ L    KE++E R    KL+E AS +V   E + D++ +I+
Sbjct: 608  SDIKDLQNKLKATENEKLTLLERHEKEVEEWRHELDKLQEDASQVVKLKEDLNDKSTKIE 667

Query: 981  EMKNKIDKMAAIIEAYQKEES 1001
            E+       A++I+ +QKE S
Sbjct: 668  EL------HASLIK-HQKENS 681

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1284

 Score = 36.2 bits (82), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 39/57 (68%)

Query: 1285 NKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLELKLK 1341
            ++FNRLKKQA+ +L +SK++Q AL  +++ LK+   +++  L  +   V +LE ++K
Sbjct: 989  DRFNRLKKQANARLHSSKEEQNALNEQISSLKKDLAEVQSKLEVQSKTVQELETQIK 1045

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 23/179 (12%)

Query: 1212 LQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQ-QKLTHK-NETEKLHNVIGDL 1269
            LQ  +  +  +++ + +K+ A   E ++ K +Y+ L ++ + LTH+ N T+K       L
Sbjct: 365  LQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTA---L 421

Query: 1270 EVKLLNVQNANADLENKF----------NRLKKQAHEKLDASKKQQTALTNELNELKETK 1319
            E +  NV +    LE  F           R  K A +    S+    A  NE+  LK+  
Sbjct: 422  ETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNH 481

Query: 1320 DKLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRN 1378
            D  E  LHN    +   + KL E  + + E +KD          +E+ESL+++L+ FR+
Sbjct: 482  DDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKD--------LSQEMESLERQLEPFRD 532

>Suva_13.199 Chr13 complement(322643..325165) [2523 bp, 840 aa] {ON}
            YMR031C (REAL)
          Length = 840

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 10/109 (9%)

Query: 1185 HKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRY 1244
            H+ L+N  +++  + +E   +  EISRLQG ++  K ++S        YES+I+  K R 
Sbjct: 551  HEDLENAEKEHTTLLEERDAINTEISRLQGAIVDHKTKIS-------NYESDIDAQKNR- 602

Query: 1245 QDLSQQQKLTHKNET-EKLHNVIGDLEVKLLNVQNANADLENKFNRLKK 1292
             ++ +  KL    +T E L + + D  + L N     A+L  K  RLK+
Sbjct: 603  -NVREDDKLVELGQTKESLESHLNDDVIILANKAKEQAELSTKEARLKQ 650

>Kpol_297.3 s297 complement(4030..4761) [732 bp, 243 aa] {ON}
            complement(4030..4761) [732 nt, 244 aa]
          Length = 243

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 7/82 (8%)

Query: 1250 QQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLEN-----KFNRLKKQAHEKLDASKKQ 1304
            ++K  ++++ EKL N IG LE +L +++NAN +LE      + +   K  H  LD  K +
Sbjct: 69   KKKKIYESQLEKLENTIGSLEQQLFSIENANLNLETMKAMKQGSMAMKAIHNGLDIDKVE 128

Query: 1305 QTALTNELNELKETKDKLEENL 1326
             T   +E+ E  E  D++ E +
Sbjct: 129  DT--MDEVREQVELGDEISEAI 148

>ZYRO0C00814g Chr3 complement(61495..63636) [2142 bp, 713 aa] {ON}
            similar to uniprot|P39723 Saccharomyces cerevisiae
            YAL047C SPC72 Component of the cytoplasmic Tub4p (gamma-
            tubulin) complex binds spindle pole bodies and links them
            to microtubules has roles in astral microtubule formation
            and stabilization
          Length = 713

 Score = 34.7 bits (78), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 6/101 (5%)

Query: 1177 LRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKEQVSINANKVLAYESE 1236
            L++ N+ LHK + NV   N+ I+K+    + E ++ Q HL+   E V    +K+L  +S 
Sbjct: 544  LKDENSALHKLVFNVENINKTIHKQ----KSEFTKFQAHLLLHLENVYKTLSKILQKKS- 598

Query: 1237 IEQCKQRYQDLSQQQKLTH-KNETEKLHNVIGDLEVKLLNV 1276
            I+Q K + + L Q   L+  +N   KL ++   +E  L +V
Sbjct: 599  IDQSKHKLEVLRQMNDLSQMRNMQPKLESLYNFIETALESV 639

>Suva_2.263 Chr2 complement(455349..459356) [4008 bp, 1335 aa] {ON}
           YDR104C (REAL)
          Length = 1335

 Score = 34.7 bits (78), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 16/86 (18%)

Query: 852 NELRMTKLQYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKE 911
           N +  + + YKFL NT D     PT+  ++ QT+I +K            I+ NE   ++
Sbjct: 686 NSIHSSGMWYKFLLNTLDHRLFTPTINLKIPQTEISVK------------INLNEKAFRK 733

Query: 912 LNGELKKAKEDCETKIQLENKEKGAK 937
           L    K+ +E    K++L   EKG K
Sbjct: 734 LRALGKQEQE----KLKLCFLEKGYK 755

>TPHA0D00420 Chr4 complement(70327..72903) [2577 bp, 858 aa] {ON}
            Anc_8.39 YLR057W
          Length = 858

 Score = 33.9 bits (76), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 44/100 (44%), Gaps = 20/100 (20%)

Query: 1565 DSAAADNRVPSAFSFGKPLFSSNTSSFQSFHNPFTPSAANFST--DGSLP---------- 1612
            D  A    +PS  + G  LF  N +++  F +  T S    S+  DG++P          
Sbjct: 595  DMYAYSCELPSTLALGSRLF--NMTNYMDFASELTESCYILSSFFDGAMPDHMYFDACSK 652

Query: 1613 -----TFNIKSAFAAGTAGNT-LKTSDPANVGINEAKVME 1646
                 TF+I+S  A+ TAGN     SD   +  NE K+ E
Sbjct: 653  DDPTCTFSIESKIASITAGNYQYSPSDFNYIDSNEVKISE 692

>TPHA0N01410 Chr14 complement(310293..312917) [2625 bp, 874 aa] {ON}
            Anc_2.590 YKL050C
          Length = 874

 Score = 33.9 bits (76), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 4/74 (5%)

Query: 1273 LLNV-QNANADLENKFNR---LKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHN 1328
            LLN  +N   DLEN       L K   +++  ++K+  AL NE N + E+  KL E++ +
Sbjct: 537  LLNWNENRKVDLENAKKEQQILLKPYQDEITKAEKEHNALLNEKNIINESIQKLHESIES 596

Query: 1329 EESKVVDLELKLKE 1342
             +SK++DL+  LKE
Sbjct: 597  HKSKIIDLDADLKE 610

>TPHA0P00930 Chr16 complement(187009..190944) [3936 bp, 1311 aa] {ON}
            Anc_2.199 YNL091W
          Length = 1311

 Score = 33.5 bits (75), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 6/88 (6%)

Query: 1515 SKGSSEKPSVVTDLIKQKNIK-LQEQLKNVKNAVTFNDKRPKSENKENNIPDSAAAD-NR 1572
            SK  SE PS +  L+ Q N K   + +    N + F D+     NK N +P+ +    N 
Sbjct: 882  SKSISESPSHLHPLLAQNNFKTFSQSIGKNTNQINFPDEAIFDSNKFNTVPNGSFGSLNG 941

Query: 1573 VPSAFSFGKPLFSSNTS---SFQSFHNP 1597
            +P+  S   P+  SN     S+ SF +P
Sbjct: 942  IPTVLS-KPPIEQSNAYDRWSWNSFQSP 968

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
            uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
            protein CIN8 and some similarites with YEL061C
            uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
            Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 965

 Score = 33.1 bits (74), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 77/156 (49%), Gaps = 23/156 (14%)

Query: 1186 KSLKNVTEKNEAIYKELI--NMQEEISRLQGHLIQTKEQVSI-----NANKVLA----YE 1234
            K++KN  +    + K+++  N+  E+++L+   + TK +  I     + N+V+     Y+
Sbjct: 428  KNIKNKPQLGSFMMKDILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYK 487

Query: 1235 SEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANADLENKFNRLKKQA 1294
            +EI++ ++  + LS Q +L HK++      +    E + L ++N  + ++          
Sbjct: 488  TEIQESRREIEKLSSQNQLLHKDKKSSQDTI----ESQRLQIRNLQSSMD--------YL 535

Query: 1295 HEKLDASKKQQTALTNELNELKETKDKLEENLHNEE 1330
            +EK+D   K +  LTN + +LK+    ++  L   E
Sbjct: 536  YEKIDLKHKNEIELTNMIMKLKDAVRNMQGALKTHE 571

>KLLA0C17204g Chr3 (1504341..1506647) [2307 bp, 768 aa] {ON} some
           similarities with uniprot|Q06704 Saccharomyces
           cerevisiae YLR309C IMH1 Protein involved in vesicular
           transport mediates transport between an endosomal
           compartment and the Golgi contains a Golgi-localization
           (GRIP) domain that interacts with activated Arl1p-GTP to
           localize Imh1p to the Golgi
          Length = 768

 Score = 33.1 bits (74), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 104/243 (42%), Gaps = 61/243 (25%)

Query: 677 INHLKTQLEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGL---IAM 733
           +N+LK QLE  R + A  ++ Y           E K   L  EI++LKK  + L   +A 
Sbjct: 341 VNNLKLQLESLRSNNADNLKSY-----------ELKQNELNNEIASLKKNESSLRQTVAQ 389

Query: 734 KESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVR 793
           KE +   LE   KE                     + SKE +Y   I++ +K       R
Sbjct: 390 KEKIIDYLENQVKE---------------------YSSKESEYKNEIELQKKENSAFVKR 428

Query: 794 LESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNE 853
           +E+  +E            KW +N       NL+S   E        G+LS  +E L  +
Sbjct: 429 IENLNKETA----------KW-KNESQKNNGNLESYIKE-------NGKLSERLEVLQEK 470

Query: 854 LRMTKLQYKFLSNT-SDTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENVLKEL 912
           L         L N  S++N    T+RK+ ++   +LKDA+ +I + E+ ++ N N+L+E 
Sbjct: 471 LET-------LQNLKSNSNDQVETIRKQCEELSFKLKDANKKILSLEDELNENANILQER 523

Query: 913 NGE 915
           N E
Sbjct: 524 NRE 526

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 171,050,648
Number of extensions: 8068224
Number of successful extensions: 72189
Number of sequences better than 10.0: 2624
Number of HSP's gapped: 66002
Number of HSP's successfully gapped: 6330
Length of query: 1680
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1556
Effective length of database: 39,262,815
Effective search space: 61092940140
Effective search space used: 61092940140
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)