Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.185.703ON57157129220.0
Suva_9.385.703ON56957124920.0
YIL150C (MCM10)5.703ON57157124490.0
Smik_9.195.703ON57257224120.0
NCAS0G002205.703ON59257014950.0
KAFR0D022105.703ON58458914320.0
TDEL0B021705.703ON56757914170.0
NDAI0F002805.703ON61061613520.0
Kpol_1043.715.703ON58559313431e-180
ZYRO0G06578g5.703ON56957713191e-176
KNAG0L021505.703ON61661913221e-176
CAGL0H06589g5.703ON58359812831e-171
TPHA0E002105.703ON54455612551e-167
TBLA0G010205.703ON59460012221e-161
SAKL0E14938g5.703ON57458911341e-148
KLTH0E01034g5.703ON58357111231e-147
Kwal_55.196915.703ON46647310211e-133
AFR287W5.703ON6116209121e-115
KLLA0A00572g5.703ON5775848671e-108
SAKL0E01870g6.41ON65869742.4
TBLA0E030806.42ON68973732.8
SAKL0E01892g6.42ON64772723.7
SAKL0B09504g7.102ON65784723.9
YFL047W (RGD2)8.4ON714104706.0
Smik_6.298.4ON714104706.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.18
         (571 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...  1130   0.0  
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   964   0.0  
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   947   0.0  
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   933   0.0  
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   580   0.0  
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   556   0.0  
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   550   0.0  
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   525   0.0  
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   521   e-180
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   512   e-176
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   513   e-176
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   498   e-171
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   488   e-167
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   475   e-161
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   441   e-148
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   437   e-147
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   397   e-133
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   355   e-115
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   338   e-108
SAKL0E01870g Chr5 complement(140327..142303) [1977 bp, 658 aa] {...    33   2.4  
TBLA0E03080 Chr5 (774631..776700) [2070 bp, 689 aa] {ON} Anc_6.4...    33   2.8  
SAKL0E01892g Chr5 complement(144899..146842) [1944 bp, 647 aa] {...    32   3.7  
SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {...    32   3.9  
YFL047W Chr6 (40421..42565) [2145 bp, 714 aa] {ON}  RGD2GTPase-a...    32   6.0  
Smik_6.29 Chr6 (55868..58012) [2145 bp, 714 aa] {ON} YFL047W (REAL)    32   6.9  

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score = 1130 bits (2922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/571 (95%), Positives = 546/571 (95%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA
Sbjct: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60

Query: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDXXXXXXXXXXXXPSNTTGYFMQKFQNA 120
           IEVPQSPAKNRNIMKSQNTMKRDMRPAASNIND            PSNTTGYFMQKFQNA
Sbjct: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDLKLSQLQQKQELPSNTTGYFMQKFQNA 120

Query: 121 KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH 180
           KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH
Sbjct: 121 KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH 180

Query: 181 EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH 240
           EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH 240

Query: 241 TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI 300
           TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI 300

Query: 301 GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 361 KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM 420
           KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM
Sbjct: 361 KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM 420

Query: 421 LANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL 480
           LANL             TALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL
Sbjct: 421 LANLDSKRRKIIDSKKSTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL 480

Query: 481 QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK 540

Query: 541 RSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571
           RSHREEVWQKHFGSKDTDEVSDASTSDLEIV
Sbjct: 541 RSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  964 bits (2492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/571 (80%), Positives = 500/571 (87%), Gaps = 2/571 (0%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           MDDPRE L  DPYNNVTSDE+DEQ IAKELEFMERKKQAL+ERLKRKQ+FK+ EDPNFEA
Sbjct: 1   MDDPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA 60

Query: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDXXXXXXXXXXXXPSNTTGYFMQKFQNA 120
           +EVPQSPAK   + KSQ+ +K+ +RP ASNIN+            PSNTT YFMQKFQ+A
Sbjct: 61  VEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLSQQSQES--PSNTTTYFMQKFQDA 118

Query: 121 KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH 180
           KRNE+KQ AKYE MMNARVHTFGTD KEY+  I NELE FSN+WVKKRYIPE+DLKRALH
Sbjct: 119 KRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWVKKRYIPEEDLKRALH 178

Query: 181 EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH 240
           EIKILRL KLFAKIRPPKFQEPDYANWA VGLISHKSD+KFTSS+KP KFFMFTITDFQH
Sbjct: 179 EIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 238

Query: 241 TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI 300
           +LDVYIFGKK VERYYNLRLGDVIAILNPEVLPWRPSG+GNFIKSFNLRISHDFKCILEI
Sbjct: 239 SLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 298

Query: 301 GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVN+K +++CGSPIN  +H CCDYHREVQFRGT AKRIELNGGYALGAPT
Sbjct: 299 GSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRGTGAKRIELNGGYALGAPT 358

Query: 361 KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM 420
           KVD+QP+LYRAKGEN FN+VRS RK LSEEEER+K+NSHNF NSNSAKAFFDEKFQNPDM
Sbjct: 359 KVDSQPSLYRAKGENQFNIVRSTRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDM 418

Query: 421 LANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL 480
           LANL             TALSRELGKIMRRK SSGLEDK + EKQK+KQTTESALQTGL+
Sbjct: 419 LANLDSKRRKIIDTKKSTALSRELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLI 478

Query: 481 QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHGKISKVLKSSVPGGE     + GKKTVI+DLL YKKEKVILAPSKNEWFKK
Sbjct: 479 QRLGFDPTHGKISKVLKSSVPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKK 538

Query: 541 RSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571
           RSHREEVWQ+HFGSK+T+  SDAS SDLEIV
Sbjct: 539 RSHREEVWQRHFGSKETEVASDASGSDLEIV 569

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/571 (78%), Positives = 499/571 (87%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           M+DPRE L  DPYNN+TSDE+DEQ IA+ELEFMERK+QALVERLKRKQEFK+ +DPNFEA
Sbjct: 1   MNDPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA 60

Query: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDXXXXXXXXXXXXPSNTTGYFMQKFQNA 120
           IEVPQSP KNR  + S N  ++  +   SNIN+            P++TT YFM+KFQNA
Sbjct: 61  IEVPQSPTKNRVKVGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPASTTTYFMEKFQNA 120

Query: 121 KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH 180
           K+NE+KQ AK+E+MMNARVHTF TD+K+Y   I NELE FSN+WVKKRYIPEDDLKRALH
Sbjct: 121 KKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWVKKRYIPEDDLKRALH 180

Query: 181 EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH 240
           EIKILRLGKLFAKIRPPKFQEP+YANWA VGLISHKSD+KFTSS+KP KFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 241 TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI 300
           TLDVYIFGKK VERYYNLRLGDVIAILNPEVLPWRPSG+GNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 301 GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVN+K ++ CGSPINI+LHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 361 KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM 420
           KVD+QP+LY+AKGEN FN+++  RK LSEEEER+KK+SHNF NSNSAKAFFDEKFQNPDM
Sbjct: 361 KVDSQPSLYKAKGENGFNIIKGTRKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 421 LANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL 480
           LANL             TALSRELGKIMRR+ SSGLEDK   E+QK+K+TTESALQTGL+
Sbjct: 421 LANLDNKRRKIIETKKSTALSRELGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLI 480

Query: 481 QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHGKIS+VLKSSV G EP+N ++G KKTVI+DLL+YKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGKISQVLKSSVSGSEPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 541 RSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571
           RSHREEVWQKHFGSK+T E SD S SDLEI+
Sbjct: 541 RSHREEVWQKHFGSKETKETSDGSASDLEII 571

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/572 (77%), Positives = 496/572 (86%), Gaps = 1/572 (0%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           MDDPRE L  DPYN+VTSDE+DEQ IAKELEFMERK+QAL+ERLKRKQ FK+  DPNFEA
Sbjct: 1   MDDPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA 60

Query: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDXXXXXXXXXXXXPSNTTGYFMQKFQNA 120
           IEVPQSP K+R    SQN +K+  R   SN N+            P NTT YFMQKFQNA
Sbjct: 61  IEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLSQIQKQPELPINTTTYFMQKFQNA 120

Query: 121 KRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEEFSNIWVKKRYIPEDDLKRALH 180
           K++E++Q AK+E+MM+ARVHTFGTD K+Y+  IANELE FSN+WVKKRYIPEDDLKR+LH
Sbjct: 121 KKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWVKKRYIPEDDLKRSLH 180

Query: 181 EIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDFQH 240
           EIKILRLGKLFAK+RPPKFQ P+YANWA VGLISHKSD+KFTSS+KP KFFMFTITDFQH
Sbjct: 181 EIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSEKPVKFFMFTITDFQH 240

Query: 241 TLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCILEI 300
           TLDVYIFGKK VERYYNLRLGD+IAILNPEVLPWRPSG+GNFIKSFNLRISHDFKCILEI
Sbjct: 241 TLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSGRGNFIKSFNLRISHDFKCILEI 300

Query: 301 GSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360
           GSSRDLGWCPIVN K ++ CGSPINI+LHKCCDYHREVQFRGTSAKRIELNGGYALGAPT
Sbjct: 301 GSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRGTSAKRIELNGGYALGAPT 360

Query: 361 KVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDM 420
           KV++QP+LY+AKGEN FN++R  RK LSEEEERMKK+SHNF NSNSAKAFFDEKFQNPDM
Sbjct: 361 KVNSQPSLYKAKGENRFNIIRDARKGLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDM 420

Query: 421 LANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLL 480
           LANL              AL+REL KIMRRK SSGLEDK D EKQK+KQTTE+ALQTGL+
Sbjct: 421 LANLDNKRRKITDTKKSKALNRELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLI 480

Query: 481 QRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKK 540
           QRLGFDPTHG+ISKVLKSSVPGGE +N ++ GKKTVI+DLL+YKKEKVILAPSKNEWFKK
Sbjct: 481 QRLGFDPTHGEISKVLKSSVPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKK 540

Query: 541 RSHREEVWQKHFGSK-DTDEVSDASTSDLEIV 571
           R+HREEVWQ+HFG K + +E SDAS SDLEI+
Sbjct: 541 RNHREEVWQRHFGPKGEAEEASDASASDLEII 572

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/570 (52%), Positives = 396/570 (69%), Gaps = 21/570 (3%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           M+DPRE L  DPY+NV+SDE DE+ I ++LE +ERK+Q L+ R+K KQE K+  DPNF+ 
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQQ 60

Query: 61  IEVPQSPAK--NRNIMKSQNTMKRDMRPAASNINDXXXXXXXXXXXXPSNTTGYFMQKFQ 118
           ++VP SP K    N+  +      +M     N N+            PSNTT YFM+KFQ
Sbjct: 61  LQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELRIREKSGQL--PSNTTTYFMEKFQ 118

Query: 119 NAKRNEEKQRAKYENMMNARVHTFGTD--KKEYRATIANELEEFSNIWVKKRYIPEDDLK 176
            +K+ EE +  K ENMMNARVHTF     K+E++    NE+EE+SNIW+KKRYIP+ +L+
Sbjct: 119 KSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNIWLKKRYIPQSELR 178

Query: 177 RALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTIT 236
           + LH IKILRL KLFAK+RPPKF EP Y+NWA +G+IS K D KFT++DKP K+  FT+T
Sbjct: 179 KMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTTTDKPKKYLKFTMT 238

Query: 237 DFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKC 296
           DFQH LDVYIFGK  VERYYNLR+GDVIAILNPEV PWRPSG+G FIKSFNLRI+HDFKC
Sbjct: 239 DFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQFIKSFNLRINHDFKC 298

Query: 297 ILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYAL 356
           ILEIGSS+DLG+C + +R     C +PIN++    CDYH+E++FR  ++KRIELNG +AL
Sbjct: 299 ILEIGSSKDLGFCKVTSRNGTL-CNTPINMSKEDRCDYHQEIRFRDNNSKRIELNGSFAL 357

Query: 357 GAPTKVDAQPTLYRAK-GEN--------NFNLVRSIRKTLSEEEERMKKNSHNFRNSNSA 407
           GAPTKV+  PTLYR K GE         NF++  S     S  +++    + +F N+NSA
Sbjct: 358 GAPTKVENNPTLYRKKNGETRHSRKNRQNFSVSASFG---SINKDQFDLRNRHFSNNNSA 414

Query: 408 KAFFDEKFQNPDMLANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEKQKI 467
           KAFFDEKFQNPDML NL             T + +EL K +  + S  L ++   E +++
Sbjct: 415 KAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKELSKAIGNRASDDLGERSAMEVKQM 474

Query: 468 KQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGE--PRNKVMGGKKTVIDDLLNYKK 525
           K+ TE+ LQ+G++QRLGFDPTHGKI+ VL+++    E    ++ M GKK  ++DLL+++K
Sbjct: 475 KRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKEEKDTLSEQMSGKKDKVNDLLHFRK 534

Query: 526 EKVILAPSKNEWFKKRSHREEVWQKHFGSK 555
             VILAP++NE  ++R  RE +WQ++FG K
Sbjct: 535 SHVILAPTRNELIERRDRRERIWQENFGQK 564

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/589 (48%), Positives = 388/589 (65%), Gaps = 23/589 (3%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           M DPRE    D Y N+T D++D + I  ELE +E  K+ L+ERL RK+      DPNF  
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNFTG 60

Query: 61  IEVPQSPAKNRNIM---KSQNTMKRDMRPAASNIN------DXXXXXXXXXXXXPSNTTG 111
           ++VP SP K   +    +    +K   R   SN N                    + +T 
Sbjct: 61  VQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPNELCLQQRFQKQTARLNDSNASTE 120

Query: 112 YFMQKFQNAKRNEEKQRAKYENMMNARVHTFG--TDKKEYRATIANELEEFSNIWVKKRY 169
           YFM+KF++AKR E+    K+E+MM +RVHTF     K EY+  I +ELE++SN+W+ KRY
Sbjct: 121 YFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDELEQYSNLWINKRY 180

Query: 170 IPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAK 229
            P  +LK  LHE+KILRL KLFAK+RPPKF+EP Y+NW VVG++S KSD+KFT+S+KP K
Sbjct: 181 TPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKSDIKFTASNKPQK 240

Query: 230 FFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLR 289
           +  FT+TDF+H +D YIFGK+ VERYYNLR+GD+IA+LNPE+LPWRPSG+ N+IKSFNLR
Sbjct: 241 YLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPSGKQNYIKSFNLR 300

Query: 290 ISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIE 349
           ISH +KCILEIG SRDL  CPIV R  ++ CG PIN  + +CC+YHRE++ R   +KR++
Sbjct: 301 ISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEYHREMEIRKGPSKRLD 360

Query: 350 LNGGYALGAPTKVDAQPTLYRAKGE-----NNFNLVRSIRKTLSEEEERMKKNSHNFRNS 404
           L+G YALGAPTK+++QP LYR          NF L  S  +      ++  + S  F N 
Sbjct: 361 LSGQYALGAPTKLESQPALYRGHTAQNVKIQNFKLTPSYSQNNPHLIDKYGEKSKFFSNR 420

Query: 405 NSAKAFFDEKFQNPDMLANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEK 464
           N+AKAFFD++FQNPDM++NL               L+REL +++R+     LE K  EE 
Sbjct: 421 NAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKSNVLNRELDRLLRK--DQDLEGKTREEV 478

Query: 465 QKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSS--VPGGEPRNKVMGGKKTVIDDLLN 522
           +K+KQTT+  LQ+GL Q++GFDPT GKIS++LK+      GEP  K +  K   +DDL+ 
Sbjct: 479 EKMKQTTQRTLQSGLFQKVGFDPTGGKISRILKNKERSKDGEP--KFLSQKDRTVDDLMA 536

Query: 523 YKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571
           +KKE +ILAPSK +   K++ RE+VWQ++FG   +++ S+ S SDLEIV
Sbjct: 537 FKKEYIILAPSKVDLLNKKNKREKVWQENFGQNKSNDNSE-SDSDLEIV 584

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/579 (48%), Positives = 391/579 (67%), Gaps = 20/579 (3%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           M+DPRE +  DP+  +TSDE+D++ +  ++  +ER+K+ LVERLK K++ K ++DPNF+A
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKRQLK-SKDPNFDA 59

Query: 61  IEVPQSPAKN--RNIMKSQNTMKRDMRPAASNINDXXXXXXXXXXXXPSNTTGYFMQKFQ 118
           I+V  SP K    +I    +  KR +     +I +            P+NTT YF+  F+
Sbjct: 60  IQVESSPVKKPAESIKVEPSRTKRVL-----DIENLNEKKVESRSQIPANTTSYFIDNFR 114

Query: 119 NAKRNEEKQRAKYENMMNARVHTF-GTD-KKEYRATIANELEEFSNIWVKKRYIPEDDLK 176
           N+K+ E+K + + + +++ RVHTF G D   +++A    E+EE+S++WVK+RYI +DDL+
Sbjct: 115 NSKKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDLWVKQRYISQDDLR 174

Query: 177 RALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTIT 236
           + LHE+KILRL KLFAKI+PPKF EP Y+NWA +G+IS K  VKF+SS KP K+F FT+T
Sbjct: 175 KVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSSSGKPMKYFKFTLT 234

Query: 237 DFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKC 296
           DFQ+ LDVY+FGKK VERYYNLR+GD++AILNPEVLPWRPS +GNFIKSFNLRISHDF C
Sbjct: 235 DFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRPSEKGNFIKSFNLRISHDFPC 294

Query: 297 ILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYAL 356
           ILEIG SRD+ WC   N+ +N+ CG+PIN    KCCD+HRE+QFR   AKRIELNG +AL
Sbjct: 295 ILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQFRSNHAKRIELNGSFAL 354

Query: 357 GAPTKVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNSH----NFRNSNSAKAFFD 412
           GAPTKVD+ P LYR K        R+ +   +  ++ + KNS     +F N N+AKAFF+
Sbjct: 355 GAPTKVDSGPALYREKSAGAH---RNFKVLPNHYQKSVGKNSDLRGIHFSNGNAAKAFFN 411

Query: 413 EKFQNPDMLANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTE 472
           ++FQNPD+L NL               L ++L +I  R  +  +E K  ++ ++I +TTE
Sbjct: 412 DEFQNPDILNNLDSKRRKRQDDKKSLILQQQLKRINSRHAAIEIE-KGSKKYEEICETTE 470

Query: 473 SALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAP 532
           + LQ+GL+Q LGFDPTHG+I  VLK +    +  N  +  K+  +  LL +KKE V L P
Sbjct: 471 ATLQSGLIQNLGFDPTHGEIGNVLKQAAK-DKSNNGQLNKKQKEVSSLLKFKKEHVELKP 529

Query: 533 SKNEWFKKRSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571
           +K    +++  RE  WQ++FG K  +  SD S SD+EIV
Sbjct: 530 AKEVLLQRKRDRERAWQENFGDKSVNLSSD-SDSDIEIV 567

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/616 (47%), Positives = 398/616 (64%), Gaps = 51/616 (8%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           M+DPRE    DP+ +++  E++E  + +ELE ++R+K  L+ RLK  +E ++  DPNF+ 
Sbjct: 1   MNDPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFDE 60

Query: 61  IEVPQSPA-KNRNIMKSQNTM--KRDMRPAAS-----------NINDXXXXXXXXXXXX- 105
           +++P +P  KN NI  S+ T+   RD +               N N+             
Sbjct: 61  VQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKL 120

Query: 106 PSNTTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTF-GTDKK------EYRATIANELE 158
           PSNTT YFM+KFQ+ K+ EE +  + E M+ ARVH F G +K       EY+   ANE+E
Sbjct: 121 PSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 159 EFSNIWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSD 218
           E+S + ++KRYIP+ +L      IKILRL KLFAK+RPPKF+EP Y+NW  +G+I+ K  
Sbjct: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 219 VKFTSSDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSG 278
           +KFTSSDKP K+F FTI+DF++ +D++IF K AVERYYNLR+GD+IAILNPEVLPWRPS 
Sbjct: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPSN 300

Query: 279 --QGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNRKKNEN--CGSPINIALHKCCDY 334
              G  IKSFNLRI+H++ CI+E+G S+DLG+CPI N K NE+  C +PI+I+    C Y
Sbjct: 301 NKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPN-KINESGTCHTPIDISKEDRCSY 359

Query: 335 HREVQFRGTSAKRIELNGGYALGAPTKVDAQPTLYR-----AKG---ENNFNLVRS--IR 384
           H+E++FR   +KRIELNG +ALGAP KV AQP LYR      +G    N FN+V+   IR
Sbjct: 360 HQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVYHGNRFNVVKGSEIR 419

Query: 385 KTLSE-EEERMKKNSHNFRNSNSAKAFFDEKFQNPDMLANLXXXXXXXXXXXXXTALSRE 443
           K  S+  EER ++    F ++NSAKAFFDEKFQNPDML NL               L +E
Sbjct: 420 KNESKLMEERRRR---YFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRSNYLDQE 476

Query: 444 LGKIMRRKGSSGLE-DKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPG 502
           L K +  K S+ L  +K  +E  K+K  TE+ LQTG++QRLGFDPTHGKI+KVL++    
Sbjct: 477 LSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVLQTGKDS 536

Query: 503 GEPRNKVMGGKKT-VIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS------K 555
           G  ++ V    K   + DLL +KK KV+LAP+K E  K+++ REEVWQKHFGS      +
Sbjct: 537 G--KDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFGSGKRLAEQ 594

Query: 556 DTDEVSDASTSDLEIV 571
             ++  D S SDLEIV
Sbjct: 595 PLNDDVDTSESDLEIV 610

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  521 bits (1343), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 284/593 (47%), Positives = 394/593 (66%), Gaps = 42/593 (7%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           M+DPRE    D Y+N++SDE ++  I+++L+ +ER+KQ L+ERLK+K+E K   DPNF  
Sbjct: 1   MNDPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF-- 58

Query: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDXXXXXX------XXXXXXPSN--TTGY 112
           ++VP SP K+R +         +++P +  I++                   SN  TT Y
Sbjct: 59  VQVPSSPKKSRVV---------ELKPTSKPIDNNEEEEEENPNEVALMTKDDSNYGTTSY 109

Query: 113 FMQKFQNAKRNEEKQRAKYENMMNARVHTF-GT-DKKEYRATIANELEEFSNIWVKKRYI 170
           FM+KF N+K++ E++   Y +MM++RVHTF GT  KKE++ T  +EL+++SN+W++ RYI
Sbjct: 110 FMEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYI 169

Query: 171 PEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKF 230
           P D+L   L +IKILRL KLFAK+RPPKF EP Y+NW V G+I+ K D+K+TSS KP K+
Sbjct: 170 PVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKY 229

Query: 231 FMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPS----GQGNFIKSF 286
           F FTI+DFQH LDV+IFG K VE+YYNLR+GDV+AILNPE+LPWRPS    G G+ IKSF
Sbjct: 230 FKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGGSGSTIKSF 289

Query: 287 NLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAK 346
           NLRISH F CILEIG+SRDLGWCPI N  KN  C +PIN +    C YHRE+QFR T++ 
Sbjct: 290 NLRISHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSN 349

Query: 347 RIELNGGYALGAPTKVDAQPTLYRAKGENNFNLVRSIRKTLSEEEERMKKNS-------H 399
           R+EL+G YALGAPTKVDA+P LY+ +G +N + V+     +S+   + +K+S       H
Sbjct: 350 RVELSGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMH 409

Query: 400 NFRNSNSAKAFFDEKFQNPDMLANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDK 459
           +F   NSAKAFFDE FQNPD+L NL             + + R L K ++        DK
Sbjct: 410 HFSTMNSAKAFFDEDFQNPDILNNL----DSKRRKIKDSKMERNLVKALK-----NTVDK 460

Query: 460 CDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDD 519
             +  + +K  T++ LQTG+LQRLGFDPT GK+S V+++S    E  NK    KK  +DD
Sbjct: 461 ESKNFKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDD 520

Query: 520 LLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKDTD-EVSDASTSDLEIV 571
           L+ ++K+ V L PSK++  K+R  R+  W+K FG + +  + +D S SDL+I+
Sbjct: 521 LMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFGKQQSSIDNNDDSGSDLKIL 573

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  512 bits (1319), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 268/577 (46%), Positives = 376/577 (65%), Gaps = 15/577 (2%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           M DPRE L  D Y+ +TS+ ++E  I  ++  +ER+K+ L++RL  K+   +  DPN   
Sbjct: 1   MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLSH 60

Query: 61  IEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDXXXXXXXXXXXXPSNTTGYFMQKFQNA 120
           I+V  SP K  N +      +++ R    N N             P+NTT +F++K+  +
Sbjct: 61  IQVESSPKKVTNSVLPPTVQQQEPRGEVRNEN-LNELKAQSQEQIPANTTSFFIEKYSTS 119

Query: 121 KRNEEKQRAKYENMMNARVHTFGTDKK--EYRATIANELEEFSNIWVKKRYIPEDDLKRA 178
           KR ++ +    E++++ RVHTF   ++  EY+    NELEEFSN+W+ KRYIP+++ +  
Sbjct: 120 KRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNLWISKRYIPKEEQRSI 179

Query: 179 LHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDF 238
              IKILRL KLFAK++PPKF EP Y+NWAV+GLIS+K +VKFTS+  P K+F FT+T+F
Sbjct: 180 FANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTSAASPKKYFKFTLTNF 239

Query: 239 QHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFIKSFNLRISHDFKCIL 298
           Q+++D YIFGK+ VERYYNLR+GD+IAILNP+VLPWRPSG    IKSFNLRISH F+CIL
Sbjct: 240 QYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAHIKSFNLRISHKFECIL 299

Query: 299 EIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNGGYALGA 358
           EIG+SRDLGWCP+ N+ KNE C +PIN     CC+YHRE++FR T+AKR+EL+G YALGA
Sbjct: 300 EIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKFRSTNAKRVELSGTYALGA 359

Query: 359 PTKVDAQPTLYRAKGEN---NFNLVRSIRKTLSEEE-ERMKKNSHNFRNSNSAKAFFDEK 414
           PT++DAQP LYR        N+N++ +     S +E   +  N+ +F N N+AKAFFDE+
Sbjct: 360 PTRIDAQPALYRGGSSQKNLNYNIITNGADGGSNKEINPLDINARHFSNRNAAKAFFDER 419

Query: 415 FQNPDMLANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESA 474
           FQNP+ L NL               L+REL    ++     ++ K  EE  +IK+TTES 
Sbjct: 420 FQNPETLRNLENKRRKLRDNRKSNILNREL----KKNSELDIKHKSAEEIDEIKRTTEST 475

Query: 475 LQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSK 534
           + +G+++ LGFDPT GKI+ V K      +   K +  K + +  LL++KK+ V L PSK
Sbjct: 476 MGSGMMKNLGFDPTQGKIASVFKHQRSDSD--KKPLTEKDSSVASLLSFKKDNVKLKPSK 533

Query: 535 NEWFKKRSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571
               K++  RE VW++HFGS   ++  D S SDLEIV
Sbjct: 534 EILIKQKRRRERVWKEHFGSGGDEK--DDSDSDLEIV 568

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  513 bits (1322), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 274/619 (44%), Positives = 382/619 (61%), Gaps = 56/619 (9%)

Query: 3   DPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA-I 61
           DPR+ + ADPY+N+TSDED+E  I +ELE MER+K+ L +RLK K+   +  D N +  +
Sbjct: 4   DPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQLDV 63

Query: 62  EVPQSPAK--------------------NRNIMKSQNTMKRDMRPAASNINDXXXXXXXX 101
           +VP SP K                     RN+  + NT ++       N+N+        
Sbjct: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQK------VNLNEARFAQLDG 117

Query: 102 XXXXPS--NTTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELEE 159
                S   TT YF++KFQ +K+ E+ +    E M++ARVHTF    KE++    NELE+
Sbjct: 118 DDGKQSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQ 177

Query: 160 FSNIWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDV 219
           FS++W+ KRYIP+  L+ +L ++K+LRL KLFAK+RPPKFQEP Y+NWAV+ +IS KS+V
Sbjct: 178 FSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEV 237

Query: 220 KFTSSDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSG- 278
           KFT+S  P KF  FT+T+FQ  LD+++FG   V+RYYNLR GD++A+LNPE+LPWRPSG 
Sbjct: 238 KFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGG 297

Query: 279 --QGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHR 336
             Q   IKSFNL+I+H FKCILEIG SRDLG+CP+  +  NE CGS IN+A  + C+YHR
Sbjct: 298 SQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHR 357

Query: 337 EVQFRGTSAKRIELNGGYALGAPTKVDAQPTLYR-AKG---ENNFNLVRSIRKTLSEE-- 390
           E+Q R  S+KR++LNGG+ALGAPTKV  QP L+R A G   ++  +L R   K    E  
Sbjct: 358 ELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPS 417

Query: 391 -----------EERMKKNSHNFRNSNSAKAFFDEKFQNPDMLANLXXXXXXXXXXXXXTA 439
                      EE        F +SN+AKAFFD++FQNPDML NL               
Sbjct: 418 WNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQ 477

Query: 440 LSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLK-- 497
           L R+L +++ +       DK   E   +K+TTE+AL TGL+QRLGFDPTHG+ + V+K  
Sbjct: 478 LDRKLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKR 537

Query: 498 -SSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK- 555
            S    G   +  +  K+ ++++LL +K++K  L PS+ +   ++ HR EVW++ FG K 
Sbjct: 538 DSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKG 597

Query: 556 ---DTDEVSDASTSDLEIV 571
              D+  V +  + DLEIV
Sbjct: 598 TPVDSQPVDNDDSDDLEIV 616

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  498 bits (1283), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 267/598 (44%), Positives = 382/598 (63%), Gaps = 49/598 (8%)

Query: 2   DDPREFLVADPYNNVTSDEDDEQT-IAKELEFMERKKQALVERLK--RKQEFKRAEDPNF 58
           +DPRE  + DPY +++ D+ ++++ I +ELE +ERKKQ L+ RLK  +++   +  DPN 
Sbjct: 7   NDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNM 66

Query: 59  EAI------EVPQSPAK---------NRNIMKSQNTMKRDMRPAASNINDXXXXXXXXXX 103
           + I      EVP+SP +           N+ +  +    + + A  N  D          
Sbjct: 67  KNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHNQAANNKKANPNEEDIVRKELDVVA 126

Query: 104 XXPSNTTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTF--GTDKKEYRATIANELEEFS 161
                TT YF  KF+N+K +E +    Y+ MM+AR HTF   T   + +    +ELE +S
Sbjct: 127 -----TTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTIQCDELEPYS 181

Query: 162 NIWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKF 221
           N  +KKRYIP+D++ + LH IKILRL KLFAK+RPP F EP Y+NW  +G IS K DVK 
Sbjct: 182 NFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVAIGAISSKEDVKL 241

Query: 222 TSSDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGN 281
           T++ KP K+F FT+TDF+H LDVY+FGKK VERYYNLR+GD+IA+LNPE+LPWRPSG  N
Sbjct: 242 TNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNPEILPWRPSGCVN 301

Query: 282 FIKSFNLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFR 341
            IKSFNLRI HDF CILEIG+SRDLGWC +VN  +++ C SPIN    +CC++HRE+Q R
Sbjct: 302 GIKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINTKTDRCCEFHRELQMR 361

Query: 342 GTSAKRIELNGGYALGAPTKVDAQPTLYRAKGEN-NFNLVRSIRKTLS-------EEEER 393
            T++KRIEL+G YALGAPTKV  QP++Y+   ++ N N  +    +++       +E+E+
Sbjct: 362 STASKRIELSGSYALGAPTKVGTQPSIYKDNNKSRNTNPAKHKMFSITGHGSKKEQEKEK 421

Query: 394 MKKNSHNFRNSNSAKAFFDEKFQNPDMLANLXXXXXXXXXXXXXTALSRELGKIMRRKGS 453
            +  +H+F N  +AKAFFD+ FQ+P +LANL             + + R L K +     
Sbjct: 422 HEIEAHHFSNKRAAKAFFDDSFQDPSLLANL----ESKRRKIKASKMDRNLLKAL----- 472

Query: 454 SGLEDKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGK 513
           +G +    + KQ++K+ TE  LQTG++QRLGFDP+ G+I+KVL  S  G +  +  +  K
Sbjct: 473 NGEDASQSKNKQQVKEITEKTLQTGVIQRLGFDPSGGQIAKVLDKSR-GTKTDDPTISKK 531

Query: 514 KTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKDTDEVSDASTSDLEIV 571
             +I+DL+++KK+K+ L PS+    +KR  RE +W+KHF  +DT++    S SDLEIV
Sbjct: 532 MGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIWKKHF--QDTND----SDSDLEIV 583

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  488 bits (1255), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 256/556 (46%), Positives = 348/556 (62%), Gaps = 37/556 (6%)

Query: 41  VERLKRKQEFKRAEDPNFEAIEVPQSPAK---NRNIMKSQNTMKR---DMRPAASNINDX 94
           ++RLK K+E ++  DPNF  I++ +SP K   N N   +   +KR   D+ P  + +   
Sbjct: 1   MKRLKAKKEDQKKLDPNFTDIQIQRSPEKKKSNPNTTVNPIPLKRLVEDVNPNEAKV--- 57

Query: 95  XXXXXXXXXXXPSNTTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTFGTD--KKEYRAT 152
                      P+NTT YFMQ F  AK+ E KQ  +Y+  M++RVH+F      K+Y++ 
Sbjct: 58  -----VSNANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSI 112

Query: 153 IANELEEFSNIWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGL 212
           I  ELEE+S   + KRY+P++++ + LH IKILRL KLFAKIRPPKF EPDYANWAV G+
Sbjct: 113 IVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGI 172

Query: 213 ISHKSDVKFTSSDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVL 272
           I  K D+K TSS  P KFF FTIT+FQHTLD++IFG   VE+YYNLR+GD+I ILNPEVL
Sbjct: 173 ICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVL 232

Query: 273 PWRPSGQGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCC 332
           PWRP  +GN IKSFNLRISH F CILEI  S+D+ WC  +NRK    C +PIN +    C
Sbjct: 233 PWRPEFKGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVC 292

Query: 333 DYHREVQFRGTSAKRIELNGGYALGAPTKVDAQPTLYRAKGE------NNFNLVRSIRKT 386
           DYH+E+QFR  +AKR+EL+G YALGAPT++D++P LYR+K        NNFN+V   R  
Sbjct: 293 DYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYM 352

Query: 387 LSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDMLANLXXXXXXXXXXXXXTALSRELGK 446
             +E + +    H+F +SNSAKAFFDE FQNPDML NL               L R L +
Sbjct: 353 KKKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRALRE 412

Query: 447 IMRRKGSSG--LEDKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGE 504
            +   G+S   L+DK ++E Q ++ TT++ LQ G +Q+LGFDPT G+I  VL+ S     
Sbjct: 413 SV---GNSKLLLKDKSNQEIQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSA-DKS 468

Query: 505 PRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS---------K 555
            ++K+   K   +++L+ +KK  V L PS+    +K  HRE+ + ++  S         K
Sbjct: 469 TQSKLQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSFAQYKKSIIAAENRDRK 528

Query: 556 DTDEVSDASTSDLEIV 571
                +D  + DLEI+
Sbjct: 529 SASTKNDTDSDDLEII 544

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  475 bits (1222), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 247/600 (41%), Positives = 371/600 (61%), Gaps = 35/600 (5%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           M+DPRE    D ++N++ DED+E  + K++E +ER+K+ L ERL+ K++  RA DPNF +
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFIS 60

Query: 61  ------------IEVPQSP--AKNRNIMKSQNTMKRDMRPAASNINDXXXXXXXXXXXXP 106
                       I+VP SP   K ++   +   + +       N N+            P
Sbjct: 61  TEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIEPASVP 120

Query: 107 SNTTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTFGTD---KKEYRATIANELEEFSNI 163
           + +T YFM  F ++K+ E ++   YE +M+ARVH+FG     +KE +     E E++S +
Sbjct: 121 AGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQIINVEEKEKYSGL 180

Query: 164 WVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTS 223
           W+ +RY+ E+ + + L +IKILRL KLFAKIRPPKF+ P Y+NW  VG+I+ KS  K TS
Sbjct: 181 WISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAVGVITEKSGFKLTS 240

Query: 224 SDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGNFI 283
           S+ P K+F FTI DFQ  + +++F ++A+ +YYNLR+GD+I ILNP + PWRPS +  +I
Sbjct: 241 SNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPVIAPWRPSEENGYI 300

Query: 284 KSFNLRISHDFKCILEIGSSRDLGWCPI-VNRKKNENCGSPINIALHKCCDYHREVQFRG 342
           KSFNL I   + CI+EIG SRDLGWC + V  K  + CG+PIN    KCC++HRE +FR 
Sbjct: 301 KSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINKTKDKCCEFHRETEFRN 360

Query: 343 TSAKRIELNGGYALGAPTKVDAQPTLYRAK-----GENNFNLVRSIRKTLSEEEERMKKN 397
            +AKRIELNG +ALGAPTK D  P+LY+ K      +N FN+VR  R+   +E +    N
Sbjct: 361 AAAKRIELNGSFALGAPTKADTNPSLYKKKTNNIYSKNQFNVVR--RRNARKEGDSKLHN 418

Query: 398 SHNFRNSNSAKAFFDEKFQNPDMLANLXXXXXXXXXXXXXTALSRELGKIMRRKG--SSG 455
           S NFR++N AKAFF+++FQNPD+++NL             + L +EL K + ++   S  
Sbjct: 419 S-NFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLKDAKRDSELIKELNKTLTKEDNVSKN 477

Query: 456 LEDKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKT 515
           LE K  E+ ++++  TE+ +Q G+L+ +G+DPTHGK+  ++K S  G +P       +  
Sbjct: 478 LEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHGKMKYLMKKS-NGKDP--SYTSNRSN 534

Query: 516 VIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKDTDE----VSDASTSDLEIV 571
            ++DLL++KK+KV L P K++   K+  R+E+W ++FG +        +S    SDLEIV
Sbjct: 535 AVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFGDQSKSNRDIILSSGDDSDLEIV 594

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  441 bits (1134), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 238/589 (40%), Positives = 364/589 (61%), Gaps = 33/589 (5%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           M+DPRE    D ++ ++ DEDD+  + K L+ +ER+K+ L +RL+   + K+  DPNF  
Sbjct: 1   MEDPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFSG 58

Query: 61  IEVPQSPAKNRNIMKSQNTMKRDMR----PAASNINDXXXXXXXXXXXXPSNTTGYFMQK 116
           +EVP+SP+K++++   + +  +D R    PA  N+N+             S +T YF Q 
Sbjct: 59  VEVPRSPSKSKHVAVKETSRSKDDRESCFPAHENLNELQVQKKASLS---SISTPYFAQN 115

Query: 117 FQNAKRNEEKQRAKYENMMNARVHTF-GTD-KKEYRATIANELEEFSNIWVKKRYIPEDD 174
           F ++K+ +E +  +   M+N RVHTF G D  +EY     NE EEFS  W+ KRYI  + 
Sbjct: 116 FSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSGKWISKRYITAEQ 175

Query: 175 LKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFT 234
            ++ L E K+LRL KLFAK+RPP F EP Y+NW  +G+IS KS VK T+  KP+++F  T
Sbjct: 176 ARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMTTGTKPSRYFTLT 235

Query: 235 ITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPS------GQGNFIKSFNL 288
           +TDF+HT+++Y+FG K VE+YYNL++GD+IA+LNPE+ PWRPS           IKSFNL
Sbjct: 236 LTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHEQSSQAVIKSFNL 295

Query: 289 RISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRI 348
            I H+F  ILEIG+SRD G+C I N+ + + CG+PIN ++   C YH+EVQFR  +AKR+
Sbjct: 296 CIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQEVQFRQVNAKRL 355

Query: 349 ELNGGYALGAPTKVDAQPTLYRAKGENNFNLV--RSIRKTLSEEEERMKKNSHNFRNSNS 406
           ELNG  +L +PTK   +  LY       ++L+  R   +T S++ +    N   F N N+
Sbjct: 356 ELNGNKSLRSPTKNGVKHILYGKNKSGKYDLLPDRYAPQTQSKDSQ----NVLYFSNPNA 411

Query: 407 AKAFFDEKFQNPDMLANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEKQK 466
           A+AFFD+ +QNPD L NL               L ++L +++ +  S+  +++   ++ +
Sbjct: 412 ARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKLLQKQLQQVIGKSNSNLFKNETSTKQDE 471

Query: 467 IKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKE 526
           I++ T++AL++GL++++GFDPT G++S VLK++  G + +      K + ++++L  KKE
Sbjct: 472 IRRATKNALESGLIKKIGFDPTSGRMSSVLKNNSKGLKEQ-----AKNSAVEEILQIKKE 526

Query: 527 KVILAPSKNEWFKKRSHREEVWQKHFGSKDTD----EVSDASTSDLEIV 571
           K+ L PSK    +K   REEVW  HF  ++      E SD   S+LEIV
Sbjct: 527 KIELKPSKEALRQKFKKREEVWNHHFKKEENPNPGVESSDGD-SELEIV 574

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  437 bits (1123), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 237/571 (41%), Positives = 353/571 (61%), Gaps = 23/571 (4%)

Query: 3   DPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEAIE 62
           DPRE L  D ++ VTSDED++  I ++L+ +ER+++ L +RL++K   K+A+  + E +E
Sbjct: 6   DPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLERVE 65

Query: 63  VPQSPAKNRNIMKSQNTMK--RDMRPAASNINDXXXXXXXXXXXXPSNTTGYFMQKFQNA 120
           VP SP + R    S  + K  + +  AA++ ND            PSNTT YF++ F NA
Sbjct: 66  VPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPWKNG---PSNTTSYFVENFVNA 122

Query: 121 KRNEEKQRAKYENMMNARVHTF-GTDK-KEYRATIANELEEFSNIWVKKRYIPEDDLKRA 178
           ++ EE++     ++++ RVHTF G D  K  +    +E E +S   + +RY+   +L   
Sbjct: 123 RKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELYSGFNISRRYMSTSELDEI 182

Query: 179 LHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFTITDF 238
           + EIK+LRL KLF+K+RPPKF EPDYANW  +G+IS KS+VK TSS KP+K+F  T+TDF
Sbjct: 183 MREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVKLTSSSKPSKYFKMTLTDF 242

Query: 239 QHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSG------QGNFIKSFNLRISH 292
            H LD+YIF  K VE+YYNLR+GD+IAILNP++LPWRPS        G  +KSFNL I H
Sbjct: 243 THNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVNNDEFSGPVVKSFNLSIRH 302

Query: 293 DFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNG 352
           +F C+LEIG+S+DLG+C I N+   + CG+PIN A    C+YH++V+FR  +A+R+ELNG
Sbjct: 303 NFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEYHQDVRFRHVNAQRVELNG 362

Query: 353 GYALGAPTKVDAQPTLYRAKG-ENNFNLVRSIRKTLSEEEERMKKNSHNFRNSNSAKAFF 411
             +L +P K   +  LY   G +    L+    K   + ++   +N+  F N N AKAFF
Sbjct: 363 STSLRSPVKNGKKQALYGTSGVKRKLQLLPD--KHAPQAQDGESQNTLFFSNPNYAKAFF 420

Query: 412 DEKFQNPDMLANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTT 471
           D+ +QNPDML NL               L  +L   + + G     +K  EE++++K  T
Sbjct: 421 DDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDAT 480

Query: 472 ESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILA 531
           E  L +GLL+ +GFDP  GK+ +VLK     G+  N  +  K + + +++++KK  V LA
Sbjct: 481 EQVLNSGLLRDIGFDPFRGKMREVLK----FGKNVNSGLNSKSSQVKEIMSFKKSNVSLA 536

Query: 532 PSKNEWFKKRSHREEVWQKHFGSKDTDEVSD 562
           PSK E  K+   RE+VW++HF   DT+++++
Sbjct: 537 PSKAEQKKRLLRREQVWREHF---DTEKLAN 564

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  397 bits (1021), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 211/473 (44%), Positives = 294/473 (62%), Gaps = 22/473 (4%)

Query: 114 MQKFQNAKRNEEKQRAKYENMMNARVHTF-GTDKKEYRATIA-NELEEFSNIWVKKRYIP 171
           M+ F N+++ EE +      M+++RVHTF G    + R  IA  E E  S +WV +RYI 
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 172 EDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFF 231
            D+L   L +IKILRL KLF+K+RPPKF EPDYANW  VG++ HKS VK TSS KP K+F
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 232 MFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSGQGN------FIKS 285
             TITDF H+LDVY+F    VE+YYNLR+GD+IAILN ++LPWRPS  GN       +KS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 286 FNLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSA 345
           FNL I  ++ C+LEIG+SRDLG+C I N+ K + CG+PIN A    CDYH+E++FR  +A
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 346 KRIELNGGYALGAPTKVDAQPTLYRAKG-ENNFNLVRSIRKTLSEEEERMKKNSHNFRNS 404
           +R+ELNG  +L +P K   +  LY + G +   NL+    K   ++++R  +N+  F N 
Sbjct: 241 QRVELNGSMSLRSPVKNGKKQALYGSSGVKRKLNLLPD--KHAPQQQDRESQNTLYFSNP 298

Query: 405 NSAKAFFDEKFQNPDMLANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEK 464
           N AKAFFD+ +QNPD+L NL               L  +L + + + G     +K  +E+
Sbjct: 299 NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQEQ 358

Query: 465 QKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYK 524
           +++KQ TE  + +GLL+ +GFDPT GK+  VLK     G+        K   + +++  +
Sbjct: 359 KQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKV----GKNSKNSTDTKSIQVREIIETR 414

Query: 525 KEKVILAPSKNEWFKKRSHREEVWQKHFGSKDTDEV------SDASTSDLEIV 571
           K  V LAPSK +  K+   RE+VW++HF +K TD        SD+S SDLEIV
Sbjct: 415 KTNVSLAPSKADQKKRLLRREQVWKEHFETK-TDPTANNQIPSDSSDSDLEIV 466

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  355 bits (912), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/620 (34%), Positives = 334/620 (53%), Gaps = 64/620 (10%)

Query: 1   MDDPREFLVADPYNNVTSDEDDE-----------------------QTIAKELEFMERKK 37
           ++DPRE +    Y+ + SDE+D                         T+   L+ +E ++
Sbjct: 6   LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64

Query: 38  QALVERLKRKQEFKRAEDPNFEAIEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDXXXX 97
             L+ RL+  +   + +      +EVP+SP K + +                   +    
Sbjct: 65  SDLLARLEELKHRSKKKAKKSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVEEPEENENE 124

Query: 98  XXXXXXXXPSNTTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTFGTDKK---EYRATIA 154
                   P  TT YF +KF  A+ +      + + ++  RV+TF +D+    EY     
Sbjct: 125 RYLLSANTP--TTSYFAEKFARARDSSASTMRRKQELLKRRVYTF-SDRDTAIEYTTFAV 181

Query: 155 NELEEFSNIWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLIS 214
           +E+E +SN+ + KRY+PE+DLKR LH+IK+LRL KLFAK+RPPKF EPDYANW  +G IS
Sbjct: 182 DEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAIS 241

Query: 215 HKSDVKFTSSDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPW 274
           +KSDVK TS +KPAK+F   ITDF + + + +FG+K VE+YY LR+GDVIAILNPE+ PW
Sbjct: 242 YKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPW 301

Query: 275 RPSGQG------NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIAL 328
           + S +          +SF L I H+  CILEIG S++LG+CP +N+ K   CG+PIN   
Sbjct: 302 KESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLK 361

Query: 329 HKCCDYHREVQFRGTSAKRIELNGGYALGAPTKVDAQPTLYRAKGENNFNL-----VRSI 383
            + C YH+E   R  +AKR+ELNG  +L APT+   Q   Y  +  +   +     V + 
Sbjct: 362 EQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAP 421

Query: 384 RKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDMLANLXXXXXXXXXXXXXTALSRE 443
           R   +E++ R      +F ++N+ +A+FD  + NPD+L NL               ++++
Sbjct: 422 RAPGAEQKFR-----EHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQ 476

Query: 444 LGKIMRRKGSSGLEDKCDEEK-QKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSVPG 502
           L  ++  K  + ++D+  EE  Q+ ++ T++ ++TG+L+ +GFDPT G+++ VL     G
Sbjct: 477 LSLVL-GKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHG 535

Query: 503 GEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHF---------G 553
             P + V   ++  I ++L  KK  + L PSK    K+   R EV+   F         G
Sbjct: 536 --PADTV---REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQG 590

Query: 554 SKDTDEVSDASTSD--LEIV 571
           S +T ++S A +SD  LEIV
Sbjct: 591 SCETAQLSSADSSDEELEIV 610

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  338 bits (867), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 202/584 (34%), Positives = 323/584 (55%), Gaps = 24/584 (4%)

Query: 1   MDDPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA 60
           + DPRE    DPY  ++ DE + + + + +  ++ +K+ L  RL   ++ +  +DPNF++
Sbjct: 5   LTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFDS 64

Query: 61  IEVPQSPAKNRNIMKSQNTMKR-----DMRPAASNINDXXXXXXXXXXXXPSNTTGYFMQ 115
           I+VP+SP K+ N  K    +K      D+  A  N+N+               TT YF +
Sbjct: 65  IDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNEDYVREKVKKL----GTTSYFTE 120

Query: 116 KFQNAKRNEEKQRAKYENMMNARVHTFGTDK-KEYRATIANELEEFSNIWVKKRYIPEDD 174
           K ++   NE +   + + ++  RV+TF  D   EY     +E ++ S + + +RY+P   
Sbjct: 121 KLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSGLVIDRRYVPLAV 180

Query: 175 LKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSDVKFTSSDKPAKFFMFT 234
           L++    IK+LRL KLF+K+R PKF EPDY NW V+G+IS K++ + T+S KP KFF  T
Sbjct: 181 LRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMTNSVKPVKFFSLT 240

Query: 235 ITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWR--PSGQGNFIKSFNLRISH 292
           I+DFQ  L+V  FGK  VE+YY LRLGD+IAILNPE++P +   +G      +F+L++S 
Sbjct: 241 ISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGASPSYATFSLKVSK 300

Query: 293 DFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYHREVQFRGTSAKRIELNG 352
           D   ILE+G S++ G C    + K + CG+PIN      C YH+E + R  S++R+E++ 
Sbjct: 301 DTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKEAKMRQNSSRRVEISS 360

Query: 353 GYALGAPTKVDAQPTLYRAKGENNFNLVRSIR---KTLSEEEERMKKNSHNFRNSNSAKA 409
             A+ AP     Q T+ +++  N    +R  +   K    E    + N   F ++N++ A
Sbjct: 361 SVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQNPDKPFVREPAAAETNRFLFSSANASTA 420

Query: 410 FFDEKFQNPDMLANLXXXXXXXXXXXXXTALSRELGKIMRRKGSSGLEDKCDEEKQKIKQ 469
           FFD+ ++NPD+LANL               L ++L K +  K  S  ED+ ++E +K   
Sbjct: 421 FFDDDYENPDILANLDNKRRKIQELRNNRNLEKKL-KGLSDKLLSKKEDRVNQEAKKT-- 477

Query: 470 TTESALQTGLLQRLGFDPTHGKIS-KVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKV 528
            T S  Q GL  ++G+DPT GK S ++L+ S     P+N     K+  I D+ N KK+ V
Sbjct: 478 ATLSMFQHGLANQIGYDPTKGKASLEMLEYSTENKAPKN----DKQLAITDICNIKKDNV 533

Query: 529 ILAPSKNEWFKKRSHREEVWQKHF-GSKDTDEVSDASTSDLEIV 571
            L PSK +  +K   R  ++ +   GS++  +  + S+ DLEI+
Sbjct: 534 SLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDKDEGSSDDLEII 577

>SAKL0E01870g Chr5 complement(140327..142303) [1977 bp, 658 aa] {ON}
           similar to uniprot|P39105 Saccharomyces cerevisiae
           YMR008C PLB1 Phospholipase B (lysophospholipase)
           involved in lipid metabolism required for deacylation of
           phosphatidylcholine and phosphatidylethanolamine but not
           phosphatidylinositol
          Length = 658

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 1/69 (1%)

Query: 496 LKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK 555
           L S+V    P N    G  T  DD+ N  +E V L+  ++EW KKR        + F ++
Sbjct: 10  LLSTVGAWSPTNSYTPGNVTCDDDI-NLVREAVGLSTDESEWLKKREVYTNSALEDFLNR 68

Query: 556 DTDEVSDAS 564
            T+  +D S
Sbjct: 69  ATENFTDNS 77

>TBLA0E03080 Chr5 (774631..776700) [2070 bp, 689 aa] {ON} Anc_6.42
           YMR008C
          Length = 689

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 34/73 (46%)

Query: 495 VLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGS 554
           VL S+     P N       +  DD+   ++    ++P++++W +KR+   EV  K F  
Sbjct: 12  VLTSTAEAWSPSNGYAPANVSCPDDINLVRRADGKISPNESDWLQKRNANTEVSLKEFLE 71

Query: 555 KDTDEVSDASTSD 567
           + T   SD S  D
Sbjct: 72  RATKNFSDTSFMD 84

>SAKL0E01892g Chr5 complement(144899..146842) [1944 bp, 647 aa] {ON}
           similar to uniprot|P39105 Saccharomyces cerevisiae
           YMR008C PLB1 Phospholipase B (lysophospholipase)
           involved in lipid metabolism required for deacylation of
           phosphatidylcholine and phosphatidylethanolamine but not
           phosphatidylinositol
          Length = 647

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 493 SKVLKSSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHF 552
           S  L ++V    P N    G  T  DD+ N  +E V L+  ++EW KKR        + F
Sbjct: 7   SVFLLATVGAWSPTNSYTPGNVTCDDDI-NLVREAVGLSTDESEWLKKREVYTNSALEDF 65

Query: 553 GSKDTDEVSDAS 564
            ++ T+  +D S
Sbjct: 66  LNRATENFTDNS 77

>SAKL0B09504g Chr2 complement(803571..805544) [1974 bp, 657 aa] {ON}
           some similarities with uniprot|P31376 Saccharomyces
           cerevisiae YAL011W SWC3 Protein of unknown function
           component of the Swr1p complex that incorporates Htz1p
           into chromatin required for formation of nuclear-
           associated array of smooth endoplasmic reticulum known
           as karmellae
          Length = 657

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 3/84 (3%)

Query: 343 TSAKRIELNGGYALGAPTKVDAQPTLYRAKGENNFNLVRS--IRKTLSEEEERMKKNSHN 400
           T  K  +L+G   LG P   D+ P L + K +  +   ++  + K  S EE+ M+  +  
Sbjct: 407 TQVKAEDLSGVTTLGKPAAADSSPKLDQPKPKRKYTKRKNVLVAKDESTEEKSMQLTTFQ 466

Query: 401 FRNSNSAKAFFDEKFQNPDMLANL 424
            +  N+A   F E  +NP++  NL
Sbjct: 467 QKYMNNADIVF-EYLENPNIRYNL 489

>YFL047W Chr6 (40421..42565) [2145 bp, 714 aa] {ON}
           RGD2GTPase-activating protein (RhoGAP) for Cdc42p and
           Rho5p
          Length = 714

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 54/104 (51%), Gaps = 11/104 (10%)

Query: 470 TTESALQTGLLQRLGFDPTHG-KISKVLKSSV--PGG----EPRNKVMGGKKTVIDDLLN 522
           T   AL+ G+LQ +  + TH   I+  ++S V  P      E R ++   +KT++ ++ N
Sbjct: 74  TVSRALR-GILQEMSQEGTHHLTIASNIESLVLQPFSKWCIEHRERIQYSEKTLLTNVNN 132

Query: 523 YKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKDTDEVSDASTS 566
           ++K K  +   + E+F K    EE  + HF   + DE+++A  S
Sbjct: 133 FRKSKKYVGKLEKEYFNKCRQLEEFKRTHF---NEDELANAMKS 173

>Smik_6.29 Chr6 (55868..58012) [2145 bp, 714 aa] {ON} YFL047W (REAL)
          Length = 714

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 54/104 (51%), Gaps = 11/104 (10%)

Query: 470 TTESALQTGLLQRLGFDPTHG-KISKVLKSSVP------GGEPRNKVMGGKKTVIDDLLN 522
           T   AL+ G+LQ +  + TH   I+  ++S V         E R ++   +KT++ ++ N
Sbjct: 74  TVSRALR-GILQEISQEGTHHLTIASNIESLVLQPFSKWCVEHRERIQYSEKTLLANVNN 132

Query: 523 YKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKDTDEVSDASTS 566
           ++K K  ++  + E+F K    EE  + HF   + DE+++A  S
Sbjct: 133 FRKSKKYVSKLEKEYFNKCRQLEEFKRTHF---NEDELANAMES 173

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,078,851
Number of extensions: 2878560
Number of successful extensions: 11424
Number of sequences better than 10.0: 76
Number of HSP's gapped: 11739
Number of HSP's successfully gapped: 76
Length of query: 571
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 456
Effective length of database: 40,294,809
Effective search space: 18374432904
Effective search space used: 18374432904
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)