Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.175.706ON1118111858190.0
Smik_9.185.706ON1118111851590.0
YIL151C5.706ON1118111851360.0
Suva_9.375.706ON1117111850860.0
TDEL0B021405.706ON1147114726190.0
ZYRO0B16412g5.706ON137297526030.0
KAFR0H001805.706ON124198125100.0
Smik_11.3605.706ON118095124520.0
CAGL0G02541g5.706ON129594324270.0
Skud_11.3365.706ON118895324080.0
Suva_11.3335.706ON118794324020.0
KNAG0C066305.706ON1281122123870.0
SAKL0E15004g5.706ON1196119023790.0
NCAS0A031705.706ON1319103023770.0
Kpol_1043.735.706ON126095923680.0
YKR096W5.706ON119594623390.0
TPHA0E001905.706ON136198722860.0
KLTH0E00968g5.706ON114896422580.0
Kwal_55.196785.706ON117896322510.0
AFR290W5.706ON121797722350.0
Ecym_40155.706ON125798021940.0
KLLA0A00528g5.706ON122998021110.0
CAGL0H06611g5.706ON128296018120.0
NDAI0E050705.706ON155638011661e-137
TBLA0E017105.706ON152640910461e-120
TPHA0D046405.706ON9629353732e-35
TBLA0C071005.10ON148571791.5
YOR326W (MYO2)7.68ON1574122744.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.17
         (1118 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...  2246   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...  1991   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...  1982   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...  1963   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1013   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1007   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   971   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   949   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   939   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   932   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   929   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   924   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...   920   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   920   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   916   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   905   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   885   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...   874   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...   871   0.0  
AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...   865   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...   849   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...   817   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   702   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   453   e-137
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   407   e-120
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   148   2e-35
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}            35   1.5  
YOR326W Chr15 (925721..930445) [4725 bp, 1574 aa] {ON}  MYO2One ...    33   4.8  

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score = 2246 bits (5819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1084/1118 (96%), Positives = 1084/1118 (96%)

Query: 1    MVDPMAPVNDDPSNKTDYLRFNDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVK 60
            MVDPMAPVNDDPSNKTDYLRFNDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVK
Sbjct: 1    MVDPMAPVNDDPSNKTDYLRFNDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVK 60

Query: 61   RRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRRPSISRKAMETTPKVNTASISTI 120
            RRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRRPSISRKAMETTPKVNTASISTI
Sbjct: 61   RRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRRPSISRKAMETTPKVNTASISTI 120

Query: 121  DVPKSPYYMNKSAITRNMEVVSRGNYAENTTSQMRTDESMATSNGIYSNSQPQSQVTLSD 180
            DVPKSPYYMNKSAITRNMEVVSRGNYAENTTSQMRTDESMATSNGIYSNSQPQSQVTLSD
Sbjct: 121  DVPKSPYYMNKSAITRNMEVVSRGNYAENTTSQMRTDESMATSNGIYSNSQPQSQVTLSD 180

Query: 181  FRTAPAFATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTEL 240
            FRTAPAFATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTEL
Sbjct: 181  FRTAPAFATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTEL 240

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300
            KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQL 420

Query: 421  LIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK
Sbjct: 421  LIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 481  DKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540
            DKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL
Sbjct: 481  DKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 541  PXXXXXXXXXXXXXXSGATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLD 600
            P              SGATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLD
Sbjct: 541  PKYLKLKRHKREKKKSGATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLD 600

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIH 660
            SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIH 660

Query: 661  FLRRTMPWNSMVNLANVLVCYMLDNIHPFLERELERFYSLELDDLIEYFNENENLPEIWK 720
            FLRRTMPWNSMVNLANVLVCYMLDNIHPFLERELERFYSLELDDLIEYFNENENLPEIWK
Sbjct: 661  FLRRTMPWNSMVNLANVLVCYMLDNIHPFLERELERFYSLELDDLIEYFNENENLPEIWK 720

Query: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGV 780
            CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGV
Sbjct: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGV 780

Query: 781  AKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXXXTIEI 840
            AKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFK                    TIEI
Sbjct: 781  AKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKLDEYEENDHNDNNELDELYDTIEI 840

Query: 841  NEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVG
Sbjct: 841  NEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 901  NGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATSWLRHF 960
            NGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATSWLRHF
Sbjct: 901  NGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATSWLRHF 960

Query: 961  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRF 1020
            AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRF
Sbjct: 961  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRF 1020

Query: 1021 TGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYAVLVT 1080
            TGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYAVLVT
Sbjct: 1021 TGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYAVLVT 1080

Query: 1081 DDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118
            DDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN
Sbjct: 1081 DDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score = 1991 bits (5159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 944/1118 (84%), Positives = 1013/1118 (90%)

Query: 1    MVDPMAPVNDDPSNKTDYLRFNDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVK 60
            MVD M PVNDDPSN+TDY R N++ +  V DMRPTT A LHQKRHSSSSHNDTPESSF K
Sbjct: 1    MVDLMVPVNDDPSNETDYPRSNNNYSQTVTDMRPTTTAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRRPSISRKAMETTPKVNTASISTI 120
            RRVPGVVEPVGKGFIDG+ +GQ+S QNTPSK DD+SRRPSISRK ME+TP+  TASIST+
Sbjct: 61   RRVPGVVEPVGKGFIDGVTNGQISAQNTPSKVDDVSRRPSISRKVMESTPQAKTASISTM 120

Query: 121  DVPKSPYYMNKSAITRNMEVVSRGNYAENTTSQMRTDESMATSNGIYSNSQPQSQVTLSD 180
            DVPKSPYY+N++A+ RNMEVVS+ +Y EN   QMR DES+  SNGIY+NSQPQSQVTL D
Sbjct: 121  DVPKSPYYVNRTAVARNMEVVSKESYDENANPQMRIDESLVASNGIYNNSQPQSQVTLPD 180

Query: 181  FRTAPAFATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTEL 240
             R AP  A+SPPPV RQLPSAQPNQTFIKKLQEIY+IIVVQETELQQRCL+LTTSQTTEL
Sbjct: 181  IRKAPVVASSPPPVVRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300
            KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIY +EKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLD 300

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLKNFSNFMDPEVCCQFIIYAFISVS+MLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQD FTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420

Query: 421  LIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDR S+GTNNNETAH+NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK
Sbjct: 421  LIENIYQSAFIDRGSSGTNNNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 481  DKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540
            +KFGKDFNGND+FDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL
Sbjct: 481  NKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 541  PXXXXXXXXXXXXXXSGATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLD 600
            P              S ATE PQYRDPF D+ S ESYFQNID+L+SNFDDIPTNLNIWL+
Sbjct: 541  PKYLKLKKDKREKKRSSATETPQYRDPFHDKKSPESYFQNIDALSSNFDDIPTNLNIWLE 600

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIH 660
            SLNHINMTSIQCSIHVLTKFLHAP V+ALPHFLTWL+F+VAILK+LET+NSK V  FWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIH 660

Query: 661  FLRRTMPWNSMVNLANVLVCYMLDNIHPFLERELERFYSLELDDLIEYFNENENLPEIWK 720
            FLRRTMPWNSMV+LANVLVCYMLDN+HPFL++ELE FYS ELDDLIE+FNENENLPEIWK
Sbjct: 661  FLRRTMPWNSMVSLANVLVCYMLDNLHPFLKKELESFYSFELDDLIEHFNENENLPEIWK 720

Query: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGV 780
            CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFW+RS+R I +LKG+
Sbjct: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGI 780

Query: 781  AKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXXXTIEI 840
            AKKFPDLGLKVNFQAPVFCRRNDI  DYFL+ FTFK                    TIEI
Sbjct: 781  AKKFPDLGLKVNFQAPVFCRRNDIPQDYFLRKFTFKLDAYDEGNNNDNNELDELYETIEI 840

Query: 841  NEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NEKI+ VN DLRATPNLSVV GE+IFEYTGYTRL PDYHCFDKNGGFNSAFIYSQWSNVG
Sbjct: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 901  NGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATSWLRHF 960
            NG+ +DVS+E +YD  +N+LS HWEKIFFDRI  A  N D+N NC++YFV+DATSWLRHF
Sbjct: 901  NGVPIDVSNEPIYDVTDNDLSLHWEKIFFDRIAAAYKNCDENDNCTIYFVVDATSWLRHF 960

Query: 961  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRF 1020
            AHIFKLAKN+IL FAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDE+KIIP+RF
Sbjct: 961  AHIFKLAKNSILDFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDERKIIPMRF 1020

Query: 1021 TGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYAVLVT 1080
            TGNIAT+VEENLEFEEQITW+THVDEFVIDAIAKLNQNFQTER+I +NKNKN  +AVLVT
Sbjct: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERMIAENKNKNKQFAVLVT 1080

Query: 1081 DDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118
            DDDNM+ KAKDKMIKTCNTKYLFSLGSK+GINSGLCTN
Sbjct: 1081 DDDNMNKKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score = 1982 bits (5136), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 941/1118 (84%), Positives = 1003/1118 (89%)

Query: 1    MVDPMAPVNDDPSNKTDYLRFNDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVK 60
            MVD M P NDDPSN+TDY R N+++  +V+DMRPT+ A LHQKRHSSSSHNDTPESSF K
Sbjct: 1    MVDLMVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRRPSISRKAMETTPKVNTASISTI 120
            RRVPG+V+PVGKGFIDGI + Q+S QNTPSKTDD SRRPSISRK ME+TP+V T+SI T+
Sbjct: 61   RRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTM 120

Query: 121  DVPKSPYYMNKSAITRNMEVVSRGNYAENTTSQMRTDESMATSNGIYSNSQPQSQVTLSD 180
            DVPKSPYY+N++ + RNM+VVSR  Y +N   QMR DE +  SNGIYSNSQPQSQVTLSD
Sbjct: 121  DVPKSPYYVNRTMLARNMKVVSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSD 180

Query: 181  FRTAPAFATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTEL 240
             R AP  A SPPP+ RQLPSAQPNQTFIKKLQEIY+IIVVQETELQQRCL+LTTSQTTEL
Sbjct: 181  IRRAPVVAASPPPMIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 240

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300
            KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD
Sbjct: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLKNFSNFMDPEVCCQFIIYAFISVS+MLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 301  VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQD FTPSQQTLQL
Sbjct: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 420

Query: 421  LIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDRSS   NNNE AHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK
Sbjct: 421  LIENIYQSAFIDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480

Query: 481  DKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540
            DKFGKDFNGND+FDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL
Sbjct: 481  DKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540

Query: 541  PXXXXXXXXXXXXXXSGATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLD 600
            P              S ATE   Y DPFD QISSESYFQNID+L S+F+DIPTNLNIWLD
Sbjct: 541  PKYLKLKKDKREKKRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLD 600

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIH 660
            SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLE VNSK V  FWIH
Sbjct: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIH 660

Query: 661  FLRRTMPWNSMVNLANVLVCYMLDNIHPFLERELERFYSLELDDLIEYFNENENLPEIWK 720
            FLRRTMPWNS+V L NVLVCYMLDN+HPFL++ELE+FYSLELDDLIEY+NENENLPEIWK
Sbjct: 661  FLRRTMPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLELDDLIEYYNENENLPEIWK 720

Query: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGV 780
            CWG+LWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDE+GE+FW+RS+R +L+LKG+
Sbjct: 721  CWGTLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI 780

Query: 781  AKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXXXTIEI 840
            AKKFPDLGLKV+FQA VFCRRNDI PDYFLKN TFK                    TIEI
Sbjct: 781  AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIEI 840

Query: 841  NEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NE+IE VN D +ATPNLSVVSGE+IFEYTGYTRL PDYHCFDKNGGFNSAFIYSQWSNVG
Sbjct: 841  NEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 901  NGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATSWLRHF 960
            NG+ LDVS ES+YD ANNNLS HWEKIFFD+I  A    D+N NC++YFVIDATSWLRHF
Sbjct: 901  NGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWLRHF 960

Query: 961  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRF 1020
            AHIFKLAKNN LKFAICLTTFQELRYLRGSKDD VVEAATRSVITIRQLYDEKKIIP+RF
Sbjct: 961  AHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRF 1020

Query: 1021 TGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYAVLVT 1080
            TGNIAT+VEENLEFEEQITW+THVDEFVIDAIAKLNQ FQ ERL D+NKNK   +AVLVT
Sbjct: 1021 TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAVLVT 1080

Query: 1081 DDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118
            DDDNM+ KAKD+MIKTCNTKYLFSLGSK+GINSGLCTN
Sbjct: 1081 DDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN 1118

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score = 1963 bits (5086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 932/1118 (83%), Positives = 1009/1118 (90%), Gaps = 1/1118 (0%)

Query: 1    MVDPMAPVNDDPSNKTDYLRFNDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVK 60
            MVD MA VNDDPSN+TDY R +++  SVVNDMRPTT A LHQKRHSSSSHNDTPESSF K
Sbjct: 1    MVDIMAQVNDDPSNETDYSRSSNNPTSVVNDMRPTTAAFLHQKRHSSSSHNDTPESSFAK 60

Query: 61   RRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRRPSISRKAMETTPKVNTASISTI 120
            RRVPGVVEPVGKGFIDGI + Q+S+QN P K +DISRRPSISRKAMETTP+++T+S S +
Sbjct: 61   RRVPGVVEPVGKGFIDGITTSQISMQNIPFKAEDISRRPSISRKAMETTPQLHTSSNSAM 120

Query: 121  DVPKSPYYMNKSAITRNMEVVSRGNYAENTTSQMRTDESMATSNGIYSNSQPQSQVTLSD 180
            D+PKSPYY+N++AITRNMEVVS+ ++ EN   Q R D+S+ TS GIY+NSQPQSQ+TLSD
Sbjct: 121  DIPKSPYYVNRTAITRNMEVVSKESHDENG-PQTRADDSLTTSTGIYANSQPQSQITLSD 179

Query: 181  FRTAPAFATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTEL 240
             R AP  A S P VTRQLPSAQPNQTFIKKLQEIY+IIVVQETELQQRCL+LTTSQTTEL
Sbjct: 180  TRAAPIVANSLPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL 239

Query: 241  KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 300
            KSLWAIY+LNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD
Sbjct: 240  KSLWAIYKLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD 299

Query: 301  VLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 360
            VLK+FSNFMDPEVCCQFI YAFI +S+MLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
Sbjct: 300  VLKSFSNFMDPEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI 359

Query: 361  DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQL 420
            DWRLSAEYWYTESMKYIYGCGKLYYHIAT+QQNSLEAFVNLGKSVFCQD FTPSQQTLQL
Sbjct: 360  DWRLSAEYWYTESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL 419

Query: 421  LIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK 480
            LIENIYQSAFIDRSS  TNNNETAHRNSQLIDYLKHTEVMLLPSFLEN+DLQHVVL+YFK
Sbjct: 420  LIENIYQSAFIDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFK 479

Query: 481  DKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL 540
            DKFGKDFNGND+F TKDMFCQNPESLRYYFRHAPAFAESQ+LQLIGFGNPKNPFALLFQL
Sbjct: 480  DKFGKDFNGNDVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQL 539

Query: 541  PXXXXXXXXXXXXXXSGATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLD 600
            P              SGA E+P YRDPFDDQ SSESYFQNID+L S+F+D PTN+ IWLD
Sbjct: 540  PKHLKFKKDKREKKKSGAAEIPHYRDPFDDQGSSESYFQNIDTLNSDFNDPPTNIGIWLD 599

Query: 601  SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIH 660
            SLN+INMTSIQCSI VLTKFLHAPL VALPHFL WLHFI+A+LKKLET+NS+ V+ FWIH
Sbjct: 600  SLNYINMTSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIH 659

Query: 661  FLRRTMPWNSMVNLANVLVCYMLDNIHPFLERELERFYSLELDDLIEYFNENENLPEIWK 720
            FLRRTMPWNSMV  +NVLVCYMLDN+HPFLE++LE+FYSLELDDLIEYFNENENLPE+WK
Sbjct: 660  FLRRTMPWNSMVTFSNVLVCYMLDNLHPFLEKQLEKFYSLELDDLIEYFNENENLPEVWK 719

Query: 721  CWGSLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGV 780
            CWGSLWFDA+KKCDVMEIPGVQDHLFFDSPLDGIVFD+KDEIGE+FWIRS+RTIL LKG+
Sbjct: 720  CWGSLWFDAVKKCDVMEIPGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKGI 779

Query: 781  AKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXXXTIEI 840
            AKKFPDLGLKVNFQA VFCRRNDISPDYFLKN TFK                    TIEI
Sbjct: 780  AKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKLDPYEEDAFNDNNELDELYDTIEI 839

Query: 841  NEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVG 900
            NE IE VN DL+ATP LSVVSGE+IFEYTGYTRLT DYHCFDKNGGFNSAFIY+QWSNVG
Sbjct: 840  NELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYTQWSNVG 899

Query: 901  NGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATSWLRHF 960
            NG+ LDVSSES+YD+  N+LS HW KI FD++ T G N D +G+CSVYFVIDATSWLRHF
Sbjct: 900  NGVTLDVSSESLYDSTTNDLSLHWAKILFDKVFTIGKNTDDDGSCSVYFVIDATSWLRHF 959

Query: 961  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRF 1020
            AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIP+RF
Sbjct: 960  AHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPMRF 1019

Query: 1021 TGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYAVLVT 1080
            TGNIAT++EENLEFEEQITW+THVDEFVIDAIAKLNQNFQTER IDKNK ++  +AVLVT
Sbjct: 1020 TGNIATHIEENLEFEEQITWKTHVDEFVIDAIAKLNQNFQTERTIDKNKGRSKEFAVLVT 1079

Query: 1081 DDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118
            DDDNM+ KAKDKMIKTCNTKYLFSLGSK+GINSGLCTN
Sbjct: 1080 DDDNMNQKAKDKMIKTCNTKYLFSLGSKLGINSGLCTN 1117

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1013 bits (2619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1147 (47%), Positives = 721/1147 (62%), Gaps = 115/1147 (10%)

Query: 42   QKRHSSSSHNDTPESSFVKRRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRRPSI 101
            QKRHSS+ +N + ES+ VKRRV    + + + F+D  A     + NTP K    SRRPS 
Sbjct: 46   QKRHSSNPYN-SAESTGVKRRVANHDDGITQ-FLDNGA-----IPNTPCKEPVSSRRPSA 98

Query: 102  SRKAMETTPK-------------------------------VNTASISTIDVPKSPYYMN 130
            +R+ +  TP+                               VN++ +S  +V + P +++
Sbjct: 99   TRRTVNRTPRSTTSYVADASASPYCYSPNNSNLRIDHLSRMVNSSGVSIPNVCRDPSFLS 158

Query: 131  KSAITRNMEVVSRGNYAENTTSQMRTDESMATSNGIYSNSQPQSQVTLSD---------- 180
            K A      +VS G   +  T  + + E    S    +N + +     +D          
Sbjct: 159  KEA-----HIVSDGQ--DTGTISINSGEVNDQSQDNSANDEGRDDNNENDSIRNKNSNND 211

Query: 181  ----FRTAPAFATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQ 236
                         + P V   +PS + +Q  ++KLQ+IY++IV QE ELQ+RC  LT SQ
Sbjct: 212  NDNNRENNKDNNGNVPSVV--VPSKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQ 269

Query: 237  TTELKSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGII 296
            TTELK LW IY++N++LI NY+ FI TALL  Q   DL +GQEI++IYRIE+RLWVYG I
Sbjct: 270  TTELKQLWVIYKVNSDLINNYVTFITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTI 329

Query: 297  TFLDVLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYP 356
            TFLDVLKNFSNFMDPEVC QFI + FIS+S+ML DIP +Y+I W QRLGDLSRMAI+LYP
Sbjct: 330  TFLDVLKNFSNFMDPEVCAQFITHVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYP 389

Query: 357  SGFIDWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQ 416
            SGFIDW+LSAE+WY E+MKYIYG GKLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ
Sbjct: 390  SGFIDWKLSAEHWYMEAMKYIYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQ 449

Query: 417  TLQLLIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVL 476
             +QL+I+NIYQ AF++R       N   HRNSQLI+YLKH+EVMLLPSFLE+ DLQ VVL
Sbjct: 450  YMQLVIDNIYQRAFVER-------NNGNHRNSQLIEYLKHSEVMLLPSFLESTDLQQVVL 502

Query: 477  MYFKDKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFAL 536
            +YF+DKFG D N N+IFDT+ MF QNP+ L+Y+FRHAPAFAES +LQL+GFG+PKNPFAL
Sbjct: 503  IYFRDKFGMDTNENNIFDTRQMFDQNPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFAL 562

Query: 537  LFQLP-----------XXXXXXXXXXXXXXSGATEVPQYRD-PFDDQISSESYFQNIDSL 584
            LF+LP                         + A +  +Y D  F      + +F NIDSL
Sbjct: 563  LFELPRCLKDRRDKKEKRKTKSSVTTETSSAMAIDEEEYIDSSFSLGAQVQQFFDNIDSL 622

Query: 585  TSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILK 644
            TS +   P +L +W  SL ++N+TS+ CS+ VL KFL  P+VVALPH L W +FI+A++ 
Sbjct: 623  TSPY-LFPPSLEVWNCSLKYLNITSLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVS 681

Query: 645  KLETVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYMLDNIHPFLERE--LERFYSLEL 702
            K++ +   A   FW+  + R  PWN++VN  NVL+ Y LDNIHP L  +   E   ++ L
Sbjct: 682  KVQHITDGASREFWLELVNRIFPWNTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGL 741

Query: 703  DDLIEYFNENENLPEIWKCWGSLWFDAI-----KKCDVMEIPGVQDHLFFDSPLDGIVFD 757
            D L+E+FN NE+LPE+WKCWG LWFDAI      + D  E  G++DH+F D P+DGI FD
Sbjct: 742  DQLVEHFNNNEDLPEVWKCWGLLWFDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFD 801

Query: 758  EKDEIGERFWIRSIRTILILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKX 817
              DE G +FW R+ R I + K +A+ F    L V+ QA V CRR D   ++ LK+F FK 
Sbjct: 802  RDDESGIKFWKRACRVIFLFKRIAENF-QTRLVVSSQAQVHCRRTD-PMNHVLKSFCFK- 858

Query: 818  XXXXXXXXXXXXXXXXXXXTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPD 877
                               TIE+ E+    N+D++ TP LSV+  E+IF Y GY RL  D
Sbjct: 859  -----LRDTFYNSNSVLQNTIEVFEEGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSD 913

Query: 878  YHCFDKNGGFNSAFIYSQWSNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTA-- 935
              C+D+ G F S  +Y+ W N  +   +  S  +    AN         +F + I T+  
Sbjct: 914  LSCYDRGGEFVSTSLYTSWGNETSKNEIPQSEPTQQQTANE------ADLFIEGINTSLT 967

Query: 936  GHNGD----KNGNCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSK 991
              N D    K      +FV+DATSWLRHFAH++KLA N +L+FAICLTTFQELR+LR SK
Sbjct: 968  EFNIDFPECKMNGKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSK 1027

Query: 992  DDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDA 1051
            D+NVVEAATR+VIT+RQLY E +I+PLRFTGN+AT++EE+LEFEEQITW +HVDEFV +A
Sbjct: 1028 DENVVEAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEA 1087

Query: 1052 IAKLNQNFQTERLIDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGI 1111
            I K       E       N++  + VLVTDD NM  KA+   I T +T+++F+  + +G 
Sbjct: 1088 IKKAQARLSQE-------NRDFHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCNAVGN 1140

Query: 1112 NSGLCTN 1118
               +CTN
Sbjct: 1141 RLKICTN 1147

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1007 bits (2603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/975 (51%), Positives = 668/975 (68%), Gaps = 64/975 (6%)

Query: 198  LPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNY 257
            +PS + +Q  ++KLQ+IY++IV QE ELQ+RC  LTTSQTTELK+LW IY++N++LI NY
Sbjct: 408  VPSKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSDLINNY 467

Query: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            + F+ TALL +Q   D+++G+EI++IYRIE+RLWVYG ITFLD+ KNFSNFMDPEVCCQF
Sbjct: 468  VTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPEVCCQF 527

Query: 318  IIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+S+ML DIP KY I W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ 
Sbjct: 528  ITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFT 587

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAG 437
            Y  GKLYYH++TVQQN+LEAFVNLGKSVFCQD F PSQQ +QL+I+NIYQ AF++R    
Sbjct: 588  YSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVER---- 643

Query: 438  TNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKD 497
               N   HRN+QLI+YLKH+EVMLLPSFLE+ DLQ VVL+YFK KFG D N  +IFDT+ 
Sbjct: 644  ---NNGNHRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRK 700

Query: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPX---------XXXXXX 548
            MFCQNP+ LRY+FRHAPAFAES +LQL+GFG+PKNPFALLF+LP                
Sbjct: 701  MFCQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTK 760

Query: 549  XXXXXXXSGATEVPQYRDPFDDQISS-ESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINM 607
                   S    +    D   D++S+ E +F NI++L   +  +P+NL IW +SLN+INM
Sbjct: 761  STTVTETSSTMAIDDLEDEQSDRMSTPEGFFGNIETLRFPY-SVPSNLEIWNESLNYINM 819

Query: 608  TSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMP 667
            TS++CS+ VL KFL  PLVVALPHF+ W +FI+++  K++ +N ++   FW+ F+ R  P
Sbjct: 820  TSLKCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFP 879

Query: 668  WNSMVNLANVLVCYMLDNI--HPFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSL 725
            WN++V+  NVL+ YMLDN      ++    ++ S+ L+DL++YFN NE LPE+WKCWG+L
Sbjct: 880  WNTIVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTL 939

Query: 726  WFDAI-----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGV 780
            WFD I        + +E  G+++H+F D+P+DGI FD  DE GE FW R+ R I + KG+
Sbjct: 940  WFDTICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGL 999

Query: 781  AKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXX---------XXXXXXX 831
            A+ FP +G+ ++  APV+CRRND+SP + LK+F+FK                        
Sbjct: 1000 AENFP-IGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDL 1058

Query: 832  XXXXXTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAF 891
                 T+EI E+    N  +   P LSV+ GE+IF+Y GY RL PDY  +DKNG F SA 
Sbjct: 1059 DHLKNTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSAS 1118

Query: 892  IYSQW---SNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNG--------- 939
            +Y+ W   +N  N  V+      + D+  + +    E   F++I   G+ G         
Sbjct: 1119 LYTSWYANNNTNNTGVIPAHGSDV-DSQRDAVQSVQEMHIFNQIMEPGYCGGFADDLFLR 1177

Query: 940  ----DKNGNCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNV 995
                    + + YFV+D T+WLRHF HI+KLA + +LKFAICLTTF ELR+LR  KD+NV
Sbjct: 1178 DALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRKPKDENV 1237

Query: 996  VEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKL 1055
            VEAATR++IT+RQLY E K++PLRFTGN+AT++EE+LEFEE+ITW +HVDEFVI+A+ K 
Sbjct: 1238 VEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVIEAVYKA 1297

Query: 1056 NQNFQTERLID------------KNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLF 1103
               FQ    +              +      + VLVTDD NM  KA+D+ ++T +TK++F
Sbjct: 1298 QSKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTFSTKFVF 1357

Query: 1104 SLGSKIGINSGLCTN 1118
            SL + IG+ S +CTN
Sbjct: 1358 SLCNSIGLRSKICTN 1372

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 58/112 (51%), Gaps = 12/112 (10%)

Query: 43  KRHSSSSHNDTPESSFVKRRVPGVVE--PVGKGFID----GIASGQVSVQNTPSKTDDIS 96
           KR SS+++N    ++FVKRR+P   E  P    F+D    G  +  +SV NTPSK    S
Sbjct: 102 KRSSSNTYNYV-SANFVKRRLPNQEEIFPQQSQFLDTSLTGAINQSISVPNTPSKAP-TS 159

Query: 97  RRPSISRKAMETTPKVN--TASISTIDVPKSPYYM--NKSAITRNMEVVSRG 144
           RRPS+ +KA++T+   N   A         SPY    N S    N+++ S+ 
Sbjct: 160 RRPSLPKKAIDTSSASNYGGAGGGGTYALGSPYCSLPNVSTFVSNVDLASKA 211

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/981 (51%), Positives = 651/981 (66%), Gaps = 78/981 (7%)

Query: 200  SAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYIN 259
            + + ++  I+KLQ IY+IIV QE ELQQRC  LTTSQTTELK+LW+IY+LNT+LI NYI 
Sbjct: 277  TKKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTDLINNYIT 336

Query: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319
            FI TALL +Q + D+ +G+EI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVC QFI 
Sbjct: 337  FITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFIT 396

Query: 320  YAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379
            + FIS+S+ML D+P K+SI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y 
Sbjct: 397  HVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYS 456

Query: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTN 439
             GKLYYH++TVQQN+LEAFVNLGKSVFCQD FTPSQQ +QL+I+NIYQ  F+DR+  G  
Sbjct: 457  HGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNKNGN- 515

Query: 440  NNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMF 499
                  RNS LIDYLKH+EVMLLPSFLEN DLQ VVL YF D+FG D+N N+IF+T+DMF
Sbjct: 516  -----VRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDMF 570

Query: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLP--------XXXXXXXXXX 551
             Q P SLR+YFRHAPAFAES +LQL+GFGNPKNPFALLF LP                  
Sbjct: 571  FQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKSS 630

Query: 552  XXXXSGATEVPQYRDPF--------DDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLN 603
                + + +    R P         +  I +E YF NIDSL    D    N+ +WL SL 
Sbjct: 631  TEISTMSIDTNDSRGPILNTSAYVNEGNIVTE-YFDNIDSLRLPIDH--PNILVWLKSLE 687

Query: 604  HINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLR 663
            H+NMTS++CS+ VL KFL  PL++ALPH L W +FI+A   K ++  + +   FW   +R
Sbjct: 688  HLNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMR 747

Query: 664  RTMPWNSMVNLANVLVCYMLDNIHPF--LERELERFYSLE-LDDLIEYFNENENLPEIWK 720
            R +PWN++ +  NVL+ Y+LDN +    + +  E + + E   +L++YFN NENLPEIWK
Sbjct: 748  RILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNFENFYELLDYFNRNENLPEIWK 807

Query: 721  CWGSLWFDAIK-----KCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTIL 775
            CWG+LWFD I        D     G++DH+F D PLDGI FDE DE GE FW R++R + 
Sbjct: 808  CWGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIVF 867

Query: 776  ILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXX 835
            + KG+A+     GL+V+  APV CRR+DI P++ LK+F+FK                   
Sbjct: 868  LFKGIAENL-QTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINK 926

Query: 836  XTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQ 895
              + + E I+  N D  A P LSVV GENIFEY GY +L  + H FD+NG   S+ IY+ 
Sbjct: 927  L-LPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTA 985

Query: 896  W---------SNVGNGMVLDV-----------------------SSESMYDAANNNLSPH 923
            W         ++ GN    ++                       S+E   D  N  L  +
Sbjct: 986  WVIDNDNSLNNSQGNQYTSNMQMTQQQRQLLPPEQQNFQMRNFASNEDTEDDFNFELYMN 1045

Query: 924  WEKI--FFDRITTAGHNGDKNGNCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTF 981
             EK+    D+ +      D+      YFV DATSWLRHFAHI+KL+ NN+L FA+CLTTF
Sbjct: 1046 PEKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAVCLTTF 1105

Query: 982  QELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWE 1041
            QELR+LR SKD+NVV AA R++IT+RQLY E K++PLRFTGN+AT++EE+LEFEEQITW 
Sbjct: 1106 QELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEEQITWR 1165

Query: 1042 THVDEFVIDAIAKLNQNFQTERLIDKNKN----KNNAYAVLVTDDDNMDGKAKDKMIKTC 1097
            +HVDEFVI+A+ K    F     I  N++    K   + VLVTDD NM  KA+++ IKT 
Sbjct: 1166 SHVDEFVIEAVVKAQNKF-----ISANESVTLRKGFNHVVLVTDDINMKRKAQEQGIKTF 1220

Query: 1098 NTKYLFSLGSKIGINSGLCTN 1118
             T ++FS+  K+GI   +CTN
Sbjct: 1221 TTHFIFSVCRKLGIQDNVCTN 1241

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 61/120 (50%), Gaps = 9/120 (7%)

Query: 22  NDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVKRRVPGVVEPVGKGFIDGIASG 81
           N++N  +   + P+  A L QKRH S+S+    +    +     +   +   +ID   + 
Sbjct: 28  NNNNIDIFRPISPS--AALRQKRHGSNSYIYKNQKRIARPDDKILNANININYIDH--NS 83

Query: 82  QVSVQNTPSKTDDISRRPSISRKAMETTPKVNTASISTIDVPKSPYYMNKSAITRNMEVV 141
            V+   TP K+  +SRRPS+S+K+   TP+    S    + PKSP+Y+   + T N++V 
Sbjct: 84  IVNENATPVKSV-LSRRPSLSKKSNNVTPQ---PSFLVTEPPKSPFYVTNQSYT-NIDVA 138

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  949 bits (2452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/951 (50%), Positives = 640/951 (67%), Gaps = 63/951 (6%)

Query: 206  TFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265
              I+KLQE+YR+IV QE ELQ+RC  LT SQTTELKSLW IY++NTEL+ NY+ FI TAL
Sbjct: 255  ALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTFITTAL 314

Query: 266  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS+
Sbjct: 315  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFISL 374

Query: 326  SSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385
            S+M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY Y  GKLYY
Sbjct: 375  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNHGKLYY 434

Query: 386  HIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAH 445
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++          
Sbjct: 435  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 487

Query: 446  RNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPES 505
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG +IF+ +DMF QNP+ 
Sbjct: 488  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDF 547

Query: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPX-----XXXXXXXXXXXXXSGATE 560
             +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+LP                   S  TE
Sbjct: 548  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTE 607

Query: 561  VP-----QYRDPFDDQISSESYFQNIDSLTSNFDDI--------PTNLN--IWLDSLNHI 605
                      +  D+ +SS +   + D L   F+DI        P+ L    WL++L  +
Sbjct: 608  SSTGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPILPSMLTNEAWLETLKFL 667

Query: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRT 665
            NMTS++C + VL KFLH PL VALPH L W++FI++I  K   +N      FWI  ++R 
Sbjct: 668  NMTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRM 727

Query: 666  MPWNSMVNLANVLVCYMLDN--IHPFLERELERFYSLELDDLIEYFNENENLPEIWKCWG 723
             PW++MV   NVL+ Y+LDN   +  +      +  L L +L+  FNENE+LPEIW CWG
Sbjct: 728  FPWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWG 787

Query: 724  SLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTIL 775
            +LWFDAI + +   I         G++D++  DSP DGI+FD+KDE GE+FW R+ R I 
Sbjct: 788  TLWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIF 847

Query: 776  ILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXX 835
            + + V++ FP LG+ V     V C  + +  +  L++  +K                   
Sbjct: 848  LFREVSRSFP-LGVIVRHDPLVNC--SSLQSNNILRDLVYK-LEPLTNIRSSVPVLSTLE 903

Query: 836  XTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQ 895
               +I+E    +N DL A P LSV++G+NIF Y GY +L PDY CFDKNG F SA +Y+ 
Sbjct: 904  SIFDISEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTS 963

Query: 896  W--SNVGNGMVLDVS------SESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSV 947
            W   N  N +  ++S      +E+++     ++ P       D  TT             
Sbjct: 964  WYVPNCNNNLETNISYANERENEALFLECMKSVHPEIAYPEIDFKTT------------- 1010

Query: 948  YFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIR 1007
            YFV DATSWLRH A IFKLA+N +L+FAICLTTFQELR+LR SKD+NV+EAATR +ITIR
Sbjct: 1011 YFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIR 1070

Query: 1008 QLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDK 1067
            QLY E K++PLRFTGN+AT++EENLEFEEQITW THVDEFVI++I K  +  +  +  + 
Sbjct: 1071 QLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENAKQPNI 1130

Query: 1068 NKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118
            + ++ N Y VL++DDD M  KA++K I+T +T+++FSL +K+G    LCT+
Sbjct: 1131 SSHRFN-YVVLISDDDTMKKKAEEKKIRTLSTRFVFSLCTKLGEQRHLCTD 1180

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/943 (50%), Positives = 645/943 (68%), Gaps = 34/943 (3%)

Query: 200  SAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYIN 259
            S +P Q  ++KLQ+IY+ IV QE ELQ++C  LT+SQTT+L S+W+IYR+N EL+ NY+ 
Sbjct: 363  SNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTNYVT 422

Query: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319
            FI TALL++Q   DL++GQEI++ YRI +RLWVYG ITFLDVLKNFS+FMDPEVC QFI 
Sbjct: 423  FISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQFIT 482

Query: 320  YAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379
            + FIS+S+ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LS+EYWY +++KY YG
Sbjct: 483  HVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYG 542

Query: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTN 439
             GKLYYH++T+QQN+LEAFVNLGKSVFCQD F PS Q +QL+I+NIYQ AFI+R   G+N
Sbjct: 543  YGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIER---GSN 599

Query: 440  NNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMF 499
            N     RNSQLI+YLKH+EVMLLP+F+ N +LQ VV+ YF+ KFG D +  +IF  +D+F
Sbjct: 600  NT----RNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIF 655

Query: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSGAT 559
             QNPE+L+Y+FRHAPAFAES +LQ +GFG+ KNPFALLF LP              + ++
Sbjct: 656  LQNPENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSS 715

Query: 560  EVPQYRDPF--------DDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQ 611
              P   +          D  ISS+ YF N++S+   +   P   +IWL SL+++N+T++Q
Sbjct: 716  GEPTSNESVMSLDNISTDSLISSDQYFSNLESMQHPYLP-PPRYDIWLKSLSYLNLTAVQ 774

Query: 612  CSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSM 671
            C + VL KFLH P VVALPH + W +FI+++  K ET+  +    FW  F+RR +P NS+
Sbjct: 775  CGVIVLRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSI 834

Query: 672  VNLANVLVCYMLDNIH--PFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDA 729
            V+  NVL+ Y LDN +    +    E   S++L +L+  FN NE LPE+WKCWG+LWFDA
Sbjct: 835  VSFLNVLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDA 894

Query: 730  I-----KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKF 784
            I        +  E  GV DHLFFDSP+DGIVFD KDE GE+FW R++R I + K +A+ F
Sbjct: 895  ITDKSNTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETF 954

Query: 785  PDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXX-XXXTIEINEK 843
             D+G+ ++  APV+CRR+D+  ++ L +F+FK                      IE+ E 
Sbjct: 955  -DIGITLSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEM 1013

Query: 844  IERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVGNGM 903
               VN  + ATP +S+   ENIFEYTGY R+ P+   FDKNG   SA  Y+ W +    +
Sbjct: 1014 PNEVNITMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIV 1073

Query: 904  VLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNC--------SVYFVIDATS 955
                +S     A ++       +   + I +   N ++N           +  FV+DATS
Sbjct: 1074 PKSAASPENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSFVLDATS 1133

Query: 956  WLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKI 1015
            WLRH AHI+KLA N+ L F+ICLTTFQELR+LR SKD+NV+EAA R++I IRQLY + K+
Sbjct: 1134 WLRHSAHIYKLASNSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQLYSDGKV 1193

Query: 1016 IPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAY 1075
            IPLRFTGNIAT++EE+LEFEEQITW +HVDEFVI++I+K  + F  +  +    + ++ +
Sbjct: 1194 IPLRFTGNIATHIEEHLEFEEQITWRSHVDEFVIESISKAQKKF-LQPFVQNPVDNDSRF 1252

Query: 1076 AVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118
             VLV+DD+NM  KA +K I+T  T+++F+L S++G    +CTN
Sbjct: 1253 FVLVSDDENMKRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN 1295

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/953 (50%), Positives = 646/953 (67%), Gaps = 52/953 (5%)

Query: 196  RQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIK 255
            R   S + +   I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IYR+NTELI 
Sbjct: 258  RSANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELIN 317

Query: 256  NYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCC 315
            NY+ FI TALL +QP++DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCC
Sbjct: 318  NYVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 377

Query: 316  QFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMK 375
            QFI + F+S+S+M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MK
Sbjct: 378  QFITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMK 437

Query: 376  YIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSS 435
            YIY  GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++
Sbjct: 438  YIYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNN 497

Query: 436  AGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDT 495
                      RNS LI+YLKH+E MLLPSFLE+ DLQ+VV+ YF +KFG D NG +IF+ 
Sbjct: 498  GNL-------RNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNP 550

Query: 496  KDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXX 555
            +DMF QNP+  +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+LP              
Sbjct: 551  EDMFIQNPDFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKK 610

Query: 556  SGATEVPQYRDPFDDQ----------ISSESYFQNIDSLTSNFDDI--------PTNLN- 596
            S   +         +           +SS +   + D L   F+DI        P+ L  
Sbjct: 611  SSNNDSSVTESSTGNSRNDNNDDDEIMSSTASISDHDFLAEFFNDIDTLRRPILPSMLTS 670

Query: 597  -IWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVS 655
              WL++L  +NMTS++C + VL KFLH PL +ALPH L W++FI+A   K   ++     
Sbjct: 671  EAWLETLKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSK 730

Query: 656  GFWIHFLRRTMPWNSMVNLANVLVCYMLDN--IHPFLERELERFYSLELDDLIEYFNENE 713
             FW+  ++R  PW+++V   NVL+ Y+LDN  ++P +     ++ +L L  L+E FNE+E
Sbjct: 731  DFWMIIVKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESE 790

Query: 714  NLPEIWKCWGSLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIGER 765
             LPEIW CWG+LWFD I + +   I         G++D++  D+P DGI+FD+KDE GE+
Sbjct: 791  ELPEIWNCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEK 850

Query: 766  FWIRSIRTILILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXX 825
            FW R+ R I + + +++ FP +G+ V+    + C  +  S    L+N  +K         
Sbjct: 851  FWKRACRIIFLFRELSRTFP-IGVIVSNDPLIKCSSSQSS--IILRNLVYK-LEPLSNIR 906

Query: 826  XXXXXXXXXXXTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNG 885
                       +++I+E   + N DL A P LSV SG+NIF YTGY +L PDY CFD+NG
Sbjct: 907  SNTPILTALENSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNG 966

Query: 886  GFNSAFIYSQWSNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNC 945
             F SA +Y++W  + NG  +   SE++    N+++    E +F + +       D     
Sbjct: 967  EFLSASLYTRWY-LPNGNNI---SEAL---VNSDIEKGDEDLFLECMKPDCPGIDFE--- 1016

Query: 946  SVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVIT 1005
            + YFV DATSWLRH A IFKLA+N +LKFAICLTTFQELR+LR SKD+NV+EAATR +IT
Sbjct: 1017 TTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIIT 1076

Query: 1006 IRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLI 1065
            IRQLY E K++PLRFTGN+AT++EENLEFEEQITW THVDEFVI++I K  +  +     
Sbjct: 1077 IRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIKKAQEKLENAGQP 1136

Query: 1066 DKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118
                  +N Y VL++DDD M  KA++K IKT +TK++FSL +K+G    LCT+
Sbjct: 1137 HVTPRHSN-YVVLISDDDTMKKKAEEKEIKTLSTKFVFSLCTKLGEKRHLCTD 1188

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/943 (50%), Positives = 634/943 (67%), Gaps = 52/943 (5%)

Query: 206  TFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265
              I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IYR+NTEL+ NY+ FI TAL
Sbjct: 267  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTFITTAL 326

Query: 266  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 327  LPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 386

Query: 326  SSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385
            S+M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKY+Y  GKLYY
Sbjct: 387  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNHGKLYY 446

Query: 386  HIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAH 445
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++          
Sbjct: 447  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 499

Query: 446  RNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPES 505
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG +IF+ +DMF QNP+ 
Sbjct: 500  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDF 559

Query: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSG-------- 557
             +Y+FRHAP+FA+S +LQ++GFG PKNPFA+LF+LP              S         
Sbjct: 560  FKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITE 619

Query: 558  --ATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPT----------NLNIWLDSLNHI 605
               +      D  D+ +SS +     DSL   F+DI T              WL+SL  +
Sbjct: 620  SSTSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFL 679

Query: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRT 665
            NMTS++C + VL KFLH PL +ALPHFL W++FI++I  K   ++      FWI  ++R 
Sbjct: 680  NMTSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRI 739

Query: 666  MPWNSMVNLANVLVCYMLDN--IHPFLERELERFYSLELDDLIEYFNENENLPEIWKCWG 723
             PW++MV   N+L+  +LDN    P +    + +  L L +L++ F E E LPEIW CWG
Sbjct: 740  FPWDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWG 799

Query: 724  SLWFD--------AIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTIL 775
            +LWFD        +I   D  E  G++D++  DSP+DGI+FD  DE GE+FW R+ RTI 
Sbjct: 800  TLWFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIF 859

Query: 776  ILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXX 835
            + + +++ F  +G+ +N ++ +   R+ +  +  L N ++K                   
Sbjct: 860  LFRELSRSF-QIGVIINNESSI--NRSSLQSNNILGNLSYK-LEPLSTLGSSIPTLNTLE 915

Query: 836  XTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQ 895
              I++ E     N DL A P LSV+ G +IF YTGY +L P+Y CFDKNG F SA +Y+ 
Sbjct: 916  GIIDVFETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTS 975

Query: 896  WSNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATS 955
            W  V NG      S +     N+N     E  F + + +     D N   + YFV DATS
Sbjct: 976  WY-VPNG------SNNPETNINSNCEKENEGQFLECLKSDDREIDLN---TTYFVFDATS 1025

Query: 956  WLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKI 1015
            WLRH A IFKLA+N +LKFAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY E K+
Sbjct: 1026 WLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1085

Query: 1016 IPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAY 1075
            +PLRFTGN+AT++EENLEFEEQITW THVDEFVI++I K  +  +    +  +  + N Y
Sbjct: 1086 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMKAQEKLENANQLPVSSCRFN-Y 1144

Query: 1076 AVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118
             +L++DDD M  KA++K IKT +T+++FSL +K+G    LCT+
Sbjct: 1145 VILISDDDTMKKKAEEKKIKTLSTRFVFSLCTKLGEQRHLCTD 1187

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1221 (42%), Positives = 710/1221 (58%), Gaps = 164/1221 (13%)

Query: 42   QKRHSSSSHNDTPESSFVKRRVPGVVEPVGKGFIDGIASGQVSVQNTPSKTDDISRR--- 98
            QKRH S+S++    +   KRR+    E   +  I   +   +  QNTP ++ D++R+   
Sbjct: 81   QKRHGSASYSFANANFPSKRRIANAEEDSKR--ISSYSDNLLLQQNTPRRSRDVARKSAS 138

Query: 99   ---------------PSISRKAMETTPKVNTASIST------------------IDVPKS 125
                           P  S   ME T   N   + T                  I   K 
Sbjct: 139  GSASGCRSASGSGSAPQESPFCMEFTSLANVDPLPTTGGAATGVNTPGGLGVDNISSGKQ 198

Query: 126  PYYMNKS--AITRNMEVVSRGNYAENTTSQMRTDESMATSNGIYSNSQPQSQ-------- 175
              +++KS  A  R      +G    N   ++  +   A ++G+ +N    +         
Sbjct: 199  TVFIDKSIGATHRYATETQQGEIDNNGEGEVAGNNDNADNDGLPTNGNGDNNEKNLSNDN 258

Query: 176  -VTLSDFRTAPAFATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTT 234
              + ++      +            + + +Q  ++KLQ+IY++IV QE ELQ+RC  LTT
Sbjct: 259  DNSNNNSNNNNNYPADQSDAQNTSVTRKSSQALVQKLQDIYKVIVKQEIELQERCSQLTT 318

Query: 235  SQTTELKSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYG 294
            SQTTELK+LW IY++NT+LI NY  FI TALL +QP  D+++G+EI++IYRIE+RLWVYG
Sbjct: 319  SQTTELKNLWTIYKINTDLINNYTTFITTALLPSQPAQDILIGEEIVEIYRIERRLWVYG 378

Query: 295  IITFLDVLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISL 354
             ITFLDVLKNFSNFMDPEVC QFI + FIS+S++L DIP K++I W QRLGDLSRMAI+L
Sbjct: 379  TITFLDVLKNFSNFMDPEVCSQFITHVFISLSAILIDIPPKHAIPWLQRLGDLSRMAIAL 438

Query: 355  YPSGFIDWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPS 414
            YPSGFIDW+LSAE+WY E+MK+ Y  GKLYYH++TVQQN+LEAFVNLGKSVFCQD FTPS
Sbjct: 439  YPSGFIDWKLSAEHWYMEAMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPS 498

Query: 415  QQTLQLLIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHV 474
            QQ +QL+I+NIYQ  F+DR++ G       +RN  LIDYLKH+EVMLLPSFL + DLQ V
Sbjct: 499  QQYMQLVIDNIYQRTFVDRNTGGN------YRNPDLIDYLKHSEVMLLPSFLGSKDLQQV 552

Query: 475  VLMYFKDKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPF 534
            VL YF+D+FG D++ N+IFDT+DMF Q P  LR++FRHAPAFAES +LQL+GFGNPKNPF
Sbjct: 553  VLNYFQDRFGIDYSENNIFDTQDMFFQPPSCLRFFFRHAPAFAESHILQLVGFGNPKNPF 612

Query: 535  ALLFQLPXXXXXXXXXXXXXXSGATEVPQYRD----PFDDQ------------------I 572
            ALLF+LP              S +T             DDQ                  +
Sbjct: 613  ALLFELPKYLKERRDKKEKNKSKSTSTADVSSTAPKTVDDQATDNVNEGTNDDHELTATL 672

Query: 573  SSESYFQNIDSLTSNFD--DIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALP 630
            S   Y  NI++L    +  DI T    W+ SL+ INMTS++CS+ VL KFLH PL++ALP
Sbjct: 673  SGPEYLDNIETLKYAIETPDICT----WIKSLDFINMTSLKCSMIVLKKFLHGPLLIALP 728

Query: 631  HFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYMLDNIH--P 688
            HFL W  FI+A   K+  + ++    FW   ++R  PW+++ +  NVL+ Y+LDN     
Sbjct: 729  HFLPWTVFIIACGIKVNELENEKNYKFWRILMKRIFPWDTITSFLNVLLAYVLDNYGNTT 788

Query: 689  FLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAI-----KKCDVMEIPGVQD 743
             +E    ++  ++LDD++ +FN++E+LPE+WKCWG+LW+DAI        D     G+ D
Sbjct: 789  IIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWGTLWYDAICNKNSVDADTFAGFGIGD 848

Query: 744  HLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDLGLKVNFQAPVFCRRND 803
            H+F D P+DGI FD +DE G +FW R++R I + KG++KKF D GLK++ +A V+C RN+
Sbjct: 849  HMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFKGISKKF-DFGLKISHEAGVYC-RNE 906

Query: 804  ISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXXXTIEINEKIERVNRDLRATPNLSVVSGE 863
             + D  L+ FTFK                     I + E++  +N D  ATP+LSVV GE
Sbjct: 907  KAADSPLRRFTFKLESYDEPTSSKFNEF------IPLCEEVSAINNDALATPSLSVVQGE 960

Query: 864  NIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWS-NVGNGMVL-------DVSSESMYD- 914
            NIFEY GY  L  D + FDKNG   S+ IY+ W  + G            +  SE   D 
Sbjct: 961  NIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMIDTGEAAAAASSATDNNAVSEGQGDL 1020

Query: 915  ------------AANNNLSPHW---------EKIFFDRITTAGHNGDKNG-----NCSVY 948
                        AA    + H          E   F +  + G   D+N          Y
Sbjct: 1021 AANGTPISASLSAAGKTTTSHVTDDQDPGLNENDLFKKFMSLGDPRDRNVYHNMITGKSY 1080

Query: 949  FV-------IDATSWLRHF------------AHIFKLAKNNILKFAICLTTFQELRYLRG 989
             V       +D    L+ F            AHI+K+A N +LKF +CLTTFQELR+LR 
Sbjct: 1081 LVKNLWESSVDELDRLKTFFIFDATSWLRHFAHIYKIATNGVLKFGVCLTTFQELRFLRK 1140

Query: 990  SKDDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVI 1049
            SKD+NVVEAA R++IT+RQLY E +++PLRFTGN+A ++EE+LEFEEQITW +HVDEFVI
Sbjct: 1141 SKDENVVEAAARAIITMRQLYRENRLLPLRFTGNVANDIEEHLEFEEQITWRSHVDEFVI 1200

Query: 1050 DAIAKLNQNFQTERLIDKNKNKNNA------------YAVLVTDDDNMDGKAKDKMIKTC 1097
            +A+ K    F T     + + +               Y  LVT+D NM  KA+D+ IKT 
Sbjct: 1201 EAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGGKRFHYVTLVTNDQNMKRKAQDQGIKTF 1260

Query: 1098 NTKYLFSLGSKIGINSGLCTN 1118
            +T ++FSL SK+G++  LCTN
Sbjct: 1261 STDFVFSLCSKLGMSLDLCTN 1281

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/1190 (43%), Positives = 730/1190 (61%), Gaps = 134/1190 (11%)

Query: 40   LHQKRHSSSSHNDTPESSFVKRRVPGVVEPVGKG---------FIDGIASGQVSVQNTPS 90
            LHQKRH+S+S+ D  +S + KRR   + + V +          F+D   +     + TPS
Sbjct: 30   LHQKRHNSNSY-DYYDSGYAKRRPNTLSQNVSQNDELAASAACFLDSNLTPSKHQECTPS 88

Query: 91   K----TDDISRR-------------PSISRKAMETTPKVNTASISTIDVP---------- 123
                 TD+  +              P+ S   +E   KV T   S++ +P          
Sbjct: 89   SFQRATDETPQPFYPADTPQSPFYLPTTSSSNLEAASKVITNDNSSVQLPDICIDNKQQP 148

Query: 124  --------KSPYYMNKSAITRNMEVVSRGNYAENTTSQMR----TDESMATSNGIYSNSQ 171
                    +     +   ITRN    + G   E+ T +++    T    +++    +N Q
Sbjct: 149  ERRQQQRLEKRVNHDDKKITRN---AANGEQKESITDELQGTDNTPHEQSSNTHADTNQQ 205

Query: 172  PQSQVTLSDFRTAPA------FATSPPPVTRQLPSAQPNQTFIKKLQEIYRIIVVQETEL 225
                 ++    +  +         S  P+   +P    +Q  ++KLQ+IYR IV QE EL
Sbjct: 206  SDQHNSVQQGSSGGSDDGENNRENSGIPIV-NVPPKHTSQALVQKLQDIYRSIVKQEIEL 264

Query: 226  QQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYR 285
            Q+RC  LT SQTT++K+LW IY++N ELI NYI+FI TALL +QP  DL++GQEI++IYR
Sbjct: 265  QERCSQLTNSQTTDMKNLWVIYKVNAELINNYISFITTALLPSQPEQDLLIGQEIVEIYR 324

Query: 286  IEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVSSMLEDIPLKYSILWRQRLG 345
            +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+S+ML D+P +YSI W +RLG
Sbjct: 325  VERRLWVYGTITFLDVLKNFSNFMDPEVCCQFISHVFMSISNMLGDVPPRYSIPWLERLG 384

Query: 346  DLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSV 405
            DLSRMAI+LYPSGFIDW+LSAE+WY++++ Y YG GKLYYH++TVQQN+LEAFVNLGKSV
Sbjct: 385  DLSRMAIALYPSGFIDWKLSAEHWYSQALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSV 444

Query: 406  FCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAHRNSQLIDYLKHTEVMLLPSF 465
            FCQD F PSQQ +QL+I+NIYQ AF +RS   +       RN  +++YLKH+EVMLLPSF
Sbjct: 445  FCQDTFIPSQQYMQLVIDNIYQRAFAERSGGSS-------RNFPIVEYLKHSEVMLLPSF 497

Query: 466  LENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLI 525
            LE+ +LQ VVL +F+ +FG   N  D FD K +F Q+ E LRY+F HAPAFAES +LQL+
Sbjct: 498  LESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIFIQDGEKLRYFFSHAPAFAESHILQLV 557

Query: 526  GFGNPKNPFALLFQLPXXXXXXXXXXXXXXSGATEVPQYRDPFDD-----QISSESYFQN 580
            GFG+P+NPFA+LF+LP                +   P      DD      IS + YF+N
Sbjct: 558  GFGDPRNPFAILFELP--KFLKERKERKERRRSKSSPPLPTNLDDGNGSSSISVDHYFEN 615

Query: 581  IDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIV 640
            IDS    +   P ++ IW  SL+++N+TS++CS+ VL KFLHAPL+ ALPH L W HF+V
Sbjct: 616  IDSHRVPY-SFPQDIQIWQQSLSYLNLTSMECSMSVLKKFLHAPLLTALPHLLPWAHFLV 674

Query: 641  AILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYMLDNIHPF--LERELERFY 698
            ++  ++ +++S A+  FW+ F+RR  PWNS+V+  N L+ ++LDN      +E+  E + 
Sbjct: 675  SVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFLNTLMAFLLDNSRNMSSVEKLCEEYN 734

Query: 699  SLELDDLIEYFNENENLPEIWKCWGSLWFDAIK-----KCDVMEIPGVQDHLFFDSPLDG 753
             ++L  L+E+F  +E LPE+WKCWG+LWFD I      K   ++  G++DHLF D+P+DG
Sbjct: 735  KMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNKSELKASSVQSTGIRDHLFLDAPIDG 794

Query: 754  IVFDEKDEIGERFWIRSIRTILILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNF 813
            I FD+ DE G +FW R+ R I + KG+AK+F   G++V+   P+  RR D++  + LK F
Sbjct: 795  ICFDQDDESGLKFWKRACRVIFMFKGMAKEF-HYGIRVS-DTPISTRR-DVTTLHALKRF 851

Query: 814  TFKXXXXXXXXXXXXXXXXXXXXTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTR 873
            +FK                     I++ E I  +N +  A P+LS++ GE+IFE+ GY R
Sbjct: 852  SFKFEELPQEWDNEVFLQSDNF--IKVFEPISPINSNFEAVPSLSMIDGESIFEFQGYRR 909

Query: 874  LTPDYHCFDKNGGFNSAFIYSQW----------------SNVGNGMVL----------DV 907
            + PDY+CF+KNG   +  +Y+                   +V NG++L          + 
Sbjct: 910  MYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVKRHVENGVLLAAHNSPVDCNER 969

Query: 908  SSESMYDAA-----NNNLSPHWEKIFFDRITTAGH---NGDKNGNCSVYFVIDATSWLRH 959
            + E+M + A     N  + P + +   D     G    N D N     YFV+DATSWLRH
Sbjct: 970  TPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGDLACNADSN---VTYFVLDATSWLRH 1026

Query: 960  FAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLR 1019
            FAH++KLA NN+LKFAICLTTFQELR+LR SKD++VVEAATR+VIT RQLY E+K++PLR
Sbjct: 1027 FAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVEAATRAVITARQLYYERKLLPLR 1086

Query: 1020 FTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNA----- 1074
            FTGNIAT++EE+LEFEEQITW +HVDEFVI+A+ K  + F+   L  +++ +        
Sbjct: 1087 FTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQRKFKGLNLQARDQGQEYIPTDPK 1146

Query: 1075 ------YAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118
                  + VLVTDD NM  KA+   I   +++++F+  +++G N  +C N
Sbjct: 1147 DDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFCNQLGYNQKVCIN 1196

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1030 (47%), Positives = 653/1030 (63%), Gaps = 124/1030 (12%)

Query: 205  QTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264
            +  ++KLQ+IY++IV QE ELQ+RC  LTTSQTT+LK+LW IY++N +LI NY+ FI TA
Sbjct: 298  EALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTFITTA 357

Query: 265  LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324
            LL++Q   DL +G+EI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + FIS
Sbjct: 358  LLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFIS 417

Query: 325  VSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384
            +S+ML DIP KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE WY E+MK+ Y  GKLY
Sbjct: 418  LSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNHGKLY 477

Query: 385  YHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETA 444
            YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 478  YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER-------NNGN 530

Query: 445  HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFG---------------KDFNG 489
            +RN QLI+YLKH+EVMLLP+FLEN +LQ VVL+YF++KFG                  N 
Sbjct: 531  NRNLQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNN 590

Query: 490  N----DIFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXX 545
            N    D+F ++DMF QNPE L+Y+FRHAPAFAES +LQL+GFG+PKNPFALLF+LP    
Sbjct: 591  NTRTIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLK 650

Query: 546  X----------------------------XXXXXXXXXSGATEVPQ-YRDPFDDQISSES 576
                                                   G  ++   + D   +Q++SE 
Sbjct: 651  ERKDKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEE 710

Query: 577  YFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWL 636
            +FQNI+ L  ++  IP +L IW+ SLNHIN+ S++CS+ VL KFLH PL++ALPH L W 
Sbjct: 711  FFQNIEQLRFDY-FIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWC 769

Query: 637  HFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYMLDNI---------- 686
            +FI++IL K E +  +    FWI  L+   PWN ++N  NVL+ Y LDNI          
Sbjct: 770  YFIISILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVND 829

Query: 687  ------HPFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAIKK-----CDV 735
                  + F+     ++ ++   DL+++FNENE+LPE+WKCWG+LWFD I        D 
Sbjct: 830  TKQKDMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADS 889

Query: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDLGLKVNFQA 795
             E  G++DH+F D P+DGI +  +DE GE FW R++R I + KG+A+ F  LGLKV++ A
Sbjct: 890  FENLGIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNA 949

Query: 796  PVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXXXT----------IEINEKIE 845
                R N++  D  LK F+FK                    T          ++I E I 
Sbjct: 950  GTEYRNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIH 1009

Query: 846  RVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVGNGMVL 905
              N +    P  S+++ E+IF+YTGY +L P+   FDKNG F+S  IY+ W    + ++L
Sbjct: 1010 ETNLNFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPMDYDQLIL 1069

Query: 906  -------DVSSESMYDAANNNLSPHWEKI-------FFDRITTAGHNGDKNGN-CSVYFV 950
                     +++ M D     LS             F D+ T       +  N    YFV
Sbjct: 1070 AQNNNNNTNATDEMTDLFTGTLSIDELSFRQLKRPEFRDKSTLLSSTSTEPFNRYKTYFV 1129

Query: 951  IDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLY 1010
             DATSWLRHFAHI+KLA N++LKFA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY
Sbjct: 1130 FDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAIITMRQLY 1189

Query: 1011 DEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKN 1070
             +  ++PLRFTGN+AT++EE+LEFEEQITW +HVDEFVI+A+ K  + F   + ++  + 
Sbjct: 1190 SDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSKTVENMEG 1249

Query: 1071 KNN----------------------AYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSK 1108
             +N                       Y VL+TDDD+M  KA+ K I T  T+ +FS+ S 
Sbjct: 1250 TSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQVVFSVCSM 1309

Query: 1109 IGINSGLCTN 1118
            +GI+ G+CTN
Sbjct: 1310 MGIDEGVCTN 1319

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 12/108 (11%)

Query: 40  LHQKRHSSSSHNDTPESSFVKRRVPGVVEPVGKGFIDGIASGQVSV--------QNTPSK 91
           + QKRHSS+S+++   +  VKRR+    E V   +ID +  G  +         Q TPSK
Sbjct: 52  IRQKRHSSNSYSNAKNNPAVKRRI-AKPEEVSLKYIDNMEYGTATTGNNSIICQQQTPSK 110

Query: 92  TDDISRRPSISRKAMETTPKVNTASISTIDVPKSPYYMNKSAITRNME 139
              +SRRPS+ +K M +TP+  +  +S  +VP SP+Y+  ++ + N E
Sbjct: 111 -GTLSRRPSLIKKQMNSTPQPMSYVVS--EVPASPFYLPANSFSNNYE 155

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/959 (49%), Positives = 639/959 (66%), Gaps = 71/959 (7%)

Query: 198  LPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNY 257
            +P  + +Q  ++KLQ+IY+II+ QE ELQ+RC  LT SQTTE+K+LW IY+LN +LI NY
Sbjct: 309  VPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNADLINNY 368

Query: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            + FI TAL  +Q  +DL++G+EI+DIY+IE+RLWVYG ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 369  VTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPEVCCQF 428

Query: 318  IIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+SSML+DIP KY+I W Q+LGDLSRMA++L+PSGFIDW+LSAE WY  +M+Y 
Sbjct: 429  ITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMAAMEYS 488

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAG 437
            YG GKLYYH++TVQQN+LEAFVNLGKSVFCQ+ F PSQQ LQL+I+NIYQ AF DR+S+ 
Sbjct: 489  YGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFADRNSSS 548

Query: 438  TNNNETAHRNSQ-LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDI--FD 494
             +      RN Q L+DYLKH+EVMLLP+F+E+ DLQ VVL+YF +KFG D+N N++  F 
Sbjct: 549  NS------RNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQ 602

Query: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXX 554
             + MF QN + L++YFRHA AFAE+Q+LQL+G+GNPKNPFALLF LP             
Sbjct: 603  PRQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKR 662

Query: 555  XS--------------GATEVPQYRDPFDDQI--SSESYFQNIDSLTSNFDDIPTNLNIW 598
                             +    +Y    +  +   SE +F NID L  N + +P ++++W
Sbjct: 663  KPKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAIN-NFMPNSISLW 721

Query: 599  LDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFW 658
             DSL + N T+ +CS+ VL KFL+ PL+VALPH L W++F+++I  ++E     A+  FW
Sbjct: 722  NDSLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFW 781

Query: 659  IHFLRRTMPWNSMVNLANVLVCYMLDNI--HPFLERELERFYSLELDDLIEYFNENENLP 716
              F++R  PWNSMV   NVL+ YM+DN   +  L    +++ SL L++L+  FN NE+LP
Sbjct: 782  YAFIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLP 841

Query: 717  EIWKCWGSLWFDAI------KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRS 770
            E+WKC GSLWFD I      + CD     G++D+ F D P+DGI FDE DEIG +FW RS
Sbjct: 842  EVWKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRS 901

Query: 771  IRTILILKGVAKKFPDLG-LKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXX 829
            +R I + +G+ ++F   G L +++ APV  RR  +  +  L  ++FK             
Sbjct: 902  VRVIFLFRGIVERFNGFGNLAISYNAPVINRRG-LGVNSHLVGYSFKLMAKSDDIMFDDM 960

Query: 830  XXXXXXXTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNS 889
                        E+I+  N D  A P LS++ GENIFEY GY R+  DY+ FDKNG   S
Sbjct: 961  LVSNF-------EEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLIS 1013

Query: 890  AFIYSQWS---NVG-NGMVL------------DVSSE-----SMYDAANNNLSPHWEKIF 928
               Y+ WS   + G NG  L            D  +E       +D   +++   W K  
Sbjct: 1014 TSFYNTWSINQDTGVNGGPLSNNSSSSNAASSDPMNEKELFNKCFDPEYDSVDEFWNKEI 1073

Query: 929  FDRITTAGHNGDKNGNCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLR 988
            +D I   G           YF++DATSWLRHFAH++K+A N+ILKF+ICLTTFQELR+LR
Sbjct: 1074 YDDI---GRKFGMELYEDTYFILDATSWLRHFAHVYKIATNSILKFSICLTTFQELRFLR 1130

Query: 989  GSKDDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFV 1048
             SKD+NVVEAATR++IT+RQL+ E K++PLRFTGN+AT++EE+LEFEEQITW +HVDEFV
Sbjct: 1131 KSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEFEEQITWRSHVDEFV 1190

Query: 1049 IDAIAKLNQNFQTERLIDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGS 1107
            I+A+ K     +T+R   +  N      VLVTDD NM  KA +K  KT +T+++F++ +
Sbjct: 1191 IEAVIKA----ETKRKEQEMHNMKGFQIVLVTDDSNMKNKALEKGSKTFSTRFVFAISN 1245

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 64/132 (48%), Gaps = 18/132 (13%)

Query: 40  LHQKRHSSSSHNDTPESSFVKRRVPGVVEPVGKG-FID------GIASGQVSVQNTPSKT 92
           L QKRH SSS+  TP  +++K+RV         G F+D      G  S Q S+QNTP   
Sbjct: 63  LGQKRHGSSSYYITP--NYIKKRVAKNSYNSATGNFLDSGSNGGGDISNQTSLQNTPLA- 119

Query: 93  DDISRRPSISRKAMETTPKVNTASISTIDVPKSPYYMNKSAITRNMEVVSRGNYAENTTS 152
              S +PSI++  +  T      +  T D   SP+ +N S +  N+++VS     EN   
Sbjct: 120 ---SPKPSIAKNNIINTSTTPQPTYITQDSMTSPFVLN-SNLPSNLDIVSN----ENLED 171

Query: 153 QMRTDESMATSN 164
            +R D+  +  N
Sbjct: 172 SIRKDQDFSQIN 183

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  905 bits (2339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/946 (50%), Positives = 636/946 (67%), Gaps = 57/946 (6%)

Query: 206  TFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITAL 265
              I+KLQE+Y++IV QE ELQ+RC  LT SQTTELKSLW IY++NT+L+ NY+ FI TAL
Sbjct: 274  ALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNYVTFITTAL 333

Query: 266  LTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISV 325
            L +QP +DL++GQEI++IYRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI + F+S+
Sbjct: 334  LPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITHVFVSL 393

Query: 326  SSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYY 385
            S+M+ DIP KYSI W QRLGDLSRMAI+LYPS FIDW+LSAE+WYTE+MKYIY  GKLYY
Sbjct: 394  STMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYIYNHGKLYY 453

Query: 386  HIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAH 445
            H++TVQQN+LEAFVNLGKSVFCQ+ FTPS Q +QL+I+NIYQ AF++R++          
Sbjct: 454  HMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNL------- 506

Query: 446  RNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPES 505
            RNS LI+YLKH+E MLLPSFLE+ DLQ+VVL YF +KFG D NG +IF+ +DMF QNP+ 
Sbjct: 507  RNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDF 566

Query: 506  LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXS--------- 556
             +Y+FRH P+FA+S +LQ++GFG PKNPFA+LF+LP              S         
Sbjct: 567  FKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTE 626

Query: 557  GATEVPQYRDPFDDQI-SSESYFQNIDSLTSNFDDI--------PTNLN--IWLDSLNHI 605
             +T   +  +  DD+I SS +   + D L   F+DI        P+ L    WL++L  +
Sbjct: 627  SSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFL 686

Query: 606  NMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRT 665
            NMTS++C I VL KFLH PL +ALPH L W++FI++I  K   ++      FW+  ++R 
Sbjct: 687  NMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRA 746

Query: 666  MPWNSMVNLANVLVCYMLDN--IHPFLERELERFYSLELDDLIEYFNENENLPEIWKCWG 723
             PW++MV   NVL+ Y+LDN   +  +    + +  L L +L+E FNE E LPEI  CWG
Sbjct: 747  FPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGCWG 806

Query: 724  SLWFDAIKKCDVMEIP--------GVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTIL 775
            +LWFD I + +   I         G++D++  DSP DGI+FDEKDE GE+FW R+ RTI 
Sbjct: 807  TLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIF 866

Query: 776  ILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXX 835
            + + +++ FP +G+ +     ++  R+       L +  FK                   
Sbjct: 867  LFRELSRSFP-IGVIIRNDPLIY--RSSFQNTNILGSLVFK-LEPLCNIHNNIPVLGALE 922

Query: 836  XTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQ 895
              I+I+E     N DL A P LSV  G+NIF Y GY +L  DY CFDKNG F SA +Y+ 
Sbjct: 923  SIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTT 982

Query: 896  WSNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDATS 955
            W       V + ++ ++ D  N N     E +F + I +     D     + YFV DATS
Sbjct: 983  W------YVPNSNNTNIEDNINYNSEKENEGLFLECIKSDYPEIDFK---TTYFVFDATS 1033

Query: 956  WLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKI 1015
            WLRH A IFKLA+N +L+FAICLTTFQELR+LR SKD+NV+EAATR +ITIRQLY E K+
Sbjct: 1034 WLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDENVMEAATRGIITIRQLYYENKV 1093

Query: 1016 IPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTE---RLIDKNKNKN 1072
            +PLRFTGN+AT++EENLEFEEQITW THVDEFVI+++ K  +  ++    RL  +  N  
Sbjct: 1094 LPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESVMKAQEKLESASEPRLSPRRFN-- 1151

Query: 1073 NAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGLCTN 1118
              Y VL++DDD M  KA++K IKT +T+++FSL +K+G    LCT+
Sbjct: 1152 --YVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCTKLGEQRHLCTD 1195

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/987 (48%), Positives = 645/987 (65%), Gaps = 88/987 (8%)

Query: 198  LPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNY 257
            +P  + +Q  ++KLQ+IY+ IV QE ELQ+RC  LT SQTTELK+LW IYR+N+EL+ NY
Sbjct: 375  VPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSELVDNY 434

Query: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            I FI TA+  TQP +D  +G+EI++IY+IE+RLWVYG ITFLD+LKNFSNFMDPEVCCQF
Sbjct: 435  ITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPEVCCQF 494

Query: 318  IIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+S+ML DIP KY + W Q+LGDLSRMAI+LYPS FIDW+LSAE WY  +M++ 
Sbjct: 495  IFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMAAMEFT 554

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAG 437
            YG GKLYYH++TVQQN+LEAFVNLGKS+FC++ F PSQQ LQL+I NIYQ A+ D     
Sbjct: 555  YGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYAD----- 609

Query: 438  TNNNETAHRNSQL-IDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFN--GNDIFD 494
             +NN    RN QL +DY+KH EV LLP+F E+ +LQ VVLMYF DKFG D+N   N++F 
Sbjct: 610  -SNNSNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFI 668

Query: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXX 554
            ++ MF QN +  + ++R++ AFAESQ+LQ++G+GN K+PF+LLF+LP             
Sbjct: 669  SRKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKR 728

Query: 555  XSGATEVPQYRDPF----------------DDQISSESYFQNIDSLTSNFDD-IPTNLNI 597
                  + +   P                 +  +++E +F+NID++  N+   +P +++I
Sbjct: 729  KPKTMLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTI--NYPSFMPNSVDI 786

Query: 598  WLDSLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGF 657
            W  SL + N  SI+CS+ V  KFLHAP ++ALPH L W +FI++I+ +L+   + A++ F
Sbjct: 787  WNHSLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEF 846

Query: 658  WIHFLRRTMPWNSMVNLANVLVCYMLDNI-HPFLERELERFY-SLELDDLIEYFNENENL 715
            W+ F+RR  PWNS+V   NVL+ YM+DN     +  EL  FY S+ LD+L+ YFNENE L
Sbjct: 847  WVEFVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEEL 906

Query: 716  PEIWKCWGSLWFDAI---------KKCDVM----------EIPGVQDHLFFDSPLDGIVF 756
            PE+WKC GSLWFD I         K  +V+          +  GV+D+ FFD P+DG  F
Sbjct: 907  PEVWKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDF 966

Query: 757  DEKDEIGERFWIRSIRTILILKGVAKKFPDLG-LKVNFQAPVFCRRNDISPDYFLKNFTF 815
            DE DEIGERFW R+ R I + K +A+ +  LG L ++++APVF RR     D +  N   
Sbjct: 967  DESDEIGERFWKRAARVIFLFKKLAESYTGLGGLILSYEAPVFNRR----KDEYKVNTVC 1022

Query: 816  KXXXXXXXXXXXXXXXXXXXXTIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLT 875
            +                     IE  E  + VN D   TP LS+V G++IF+Y GY R+ 
Sbjct: 1023 QELLEFSFKLNASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYKRVC 1082

Query: 876  PDYHCFDKNGGFNSAFIYSQWS--NVGNGMVLD---------VSSESMYD--AANNNLSP 922
            P+++ FDKNG F S   ++ WS  N+ N +  +         +SS S  D  AA+ N  P
Sbjct: 1083 PNFYSFDKNGDFISTSFFNSWSIKNLTNELSRNTCSSITDDAISSGSGNDSAAASTNNDP 1142

Query: 923  HWEKIFFDRITTAGHNG-----------DKNGNCSV----YFVIDATSWLRHFAHIFKLA 967
              E + F+      +             D   N S+    YF++DATSWLRHFAHI+K+A
Sbjct: 1143 MNELLVFNECFDPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRHFAHIYKIA 1202

Query: 968  KNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATN 1027
             + ILKFAICLTTFQELRYLR SKD NVVEAATR++IT+RQLY E  ++PLRFTGN+AT+
Sbjct: 1203 TSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLRFTGNVATH 1262

Query: 1028 VEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKN-----KNKNNAYAVLVTDD 1082
            +EE+LEFEEQITW +HVDEFVI+A+ K  +  +T+RL D N     K K+    +LVTDD
Sbjct: 1263 IEEHLEFEEQITWRSHVDEFVIEAVLKAEEK-RTDRLNDINMDTDEKEKSIFGIILVTDD 1321

Query: 1083 DNMDGKAKDKMIKTCNTKYLFSLGSKI 1109
              M  KA D+ IKT +T+++FS+ + I
Sbjct: 1322 ITMKNKAMDRKIKTFSTRFIFSMANYI 1348

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/964 (47%), Positives = 635/964 (65%), Gaps = 67/964 (6%)

Query: 200  SAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYIN 259
            S+Q +Q  ++KLQ+IYR IV QE ELQ+RC  LT SQTT+LK+LW IY++NTELI NY+ 
Sbjct: 207  SSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVA 266

Query: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319
            FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLKNFSNFMDPEVCCQFI 
Sbjct: 267  FITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFIT 326

Query: 320  YAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379
            + FIS+S+ML D+P K++  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WYT+++ +I+G
Sbjct: 327  HVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFG 386

Query: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTN 439
             GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R      
Sbjct: 387  HGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER------ 440

Query: 440  NNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMF 499
             N    RNS +++YLKH+EVMLL SFLE+ +LQ VVL +F++KFG   N  D F  + +F
Sbjct: 441  -NGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499

Query: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSG-- 557
             Q+ E  +Y+FRHAPAFAES +LQ++GFGNPKNPFALLF+LP              S   
Sbjct: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSS 559

Query: 558  ----ATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCS 613
                + E P    P +       Y +++DS    + + PT+L IW  SL+HIN TSI+CS
Sbjct: 560  NSFTSMEAPSPTSPIE-------YLESVDSPRFVY-EFPTDLAIWQQSLSHINTTSIKCS 611

Query: 614  IHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVN 673
              VL KFLH PLV A  H L W +F++++  +++ + S  +  FWI   R+  PWNS+VN
Sbjct: 612  AVVLQKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVN 671

Query: 674  LANVLVCYMLDNI--HPFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAIK 731
              N+++ + LDN      ++   E+F S+++  L+++F++NE+LPE+WKCWG+LWFD I 
Sbjct: 672  FLNMIIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVIS 731

Query: 732  -KCDVMEIPG----VQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPD 786
             K DV++       VQDH+F D P+DGI FDE DE G RFW R+ R + I KG+A++F +
Sbjct: 732  DKSDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEF-N 790

Query: 787  LGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXXXTIEINEKIER 846
            +GL +    P+  RR+ ++  + L+NF FK                       I+E+   
Sbjct: 791  MGLTLA-SVPLQSRRS-LAAGHPLQNFCFKFEDPPVDSESYALISTQMPAFENISER--- 845

Query: 847  VNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWS----NVGNG 902
             N D  A P  S++ G+++FE  GY +L  D+ CF+K G   +  +Y+  S     +  G
Sbjct: 846  -NLDPNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGG 904

Query: 903  MVLDVSSESMYDAANNNLSPH------WEKIFFDRITTAGH----------NGDKNGNCS 946
               +    S  D  N   +P        E+++ D                  GD + NC 
Sbjct: 905  DDFNTERYSRSDELNKADNPQIKELDKMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCD 964

Query: 947  ---VYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSV 1003
                YFV DATSWLRHFAH++KLA N +L+FAICLTTFQELR+LR SKD++VVEAATR+V
Sbjct: 965  SGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAATRAV 1024

Query: 1004 ITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQT-- 1061
            IT+RQLY EK+++PLRFTGN+AT++EE+LEFEEQITW +HVDEFVI+A+ K    F+   
Sbjct: 1025 ITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALN 1084

Query: 1062 -------ERLIDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSG 1114
                      I   + +   +  LV+DD NM  KA  + I+T +++++F++ ++IG+   
Sbjct: 1085 AQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHH 1144

Query: 1115 LCTN 1118
             CTN
Sbjct: 1145 ACTN 1148

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/963 (47%), Positives = 643/963 (66%), Gaps = 62/963 (6%)

Query: 199  PSAQP-NQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNY 257
            PS+ P +Q  ++KLQ+IYR IV QE ELQ+RC  LTTSQTT+LK+LW IY++N ELI NY
Sbjct: 235  PSSSPTSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELINNY 294

Query: 258  INFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQF 317
            + FI TALL +QP  DL++GQEI++IYRIE+RLWV+G ITFLDVLKNFSNFMDPEVCCQF
Sbjct: 295  VAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQF 354

Query: 318  IIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYI 377
            I + FIS+S+ML D+P K+S  W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY++++ +I
Sbjct: 355  ITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALSHI 414

Query: 378  YGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAG 437
            +G GKLYYH++TVQQN+LEAFVNLGKSVFC+D F PS Q +QL+I+NIYQ AF +R    
Sbjct: 415  FGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAER---- 470

Query: 438  TNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKD 497
               N   HRNS +++YLKH+EVMLL SFLE+ +LQ VVL +F+ KFG   +  D F+ +D
Sbjct: 471  ---NGGNHRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRD 527

Query: 498  MFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSG 557
            MF Q+ E ++Y+FRHAPAFAES +LQ +GFG+PKNPFALLF+LP              S 
Sbjct: 528  MFLQDGERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSK 587

Query: 558  ATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVL 617
            ++      +     +S   Y +N+DS    + + P +L IW +SL+HIN+TS +CS  V 
Sbjct: 588  SSHSFTSIET-TSHLSPSEYLENVDSPRYAY-EFPEDLAIWRESLSHINITSARCSSIVF 645

Query: 618  TKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLANV 677
             KFL  PLVVA+ H L W +F++++  K++++ S  +  FWI  +R+  PWNS+V+  N+
Sbjct: 646  QKFLRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNM 705

Query: 678  LVCYMLDN---IHPFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAI---- 730
            L+ ++LDN     P ++   E+  S++   L+E+F+E+E+LPEIW+CWG+LWFD I    
Sbjct: 706  LMAFVLDNNWKTSP-IDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKS 764

Query: 731  --KKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDLG 788
              +  DV+   G +DH F+D P DGI FDE DE+GE+FW R+ R I I KG+A++F  LG
Sbjct: 765  NGEDGDVIN-SGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEF-SLG 822

Query: 789  LKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXXXTIEINEKIERVN 848
            L ++  AP    R  ++  + L+NF+F                      I + E+I   N
Sbjct: 823  LTLSAFAPQ--SRRPMTAGHPLQNFSFNFEEIPAQSQIQSFVRNQ----IPLFEEIATGN 876

Query: 849  RDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVGNGMVL--- 905
             D    P  S++ GE+IF++ GY ++  DY CF+K+G   S  +Y+    +  G +    
Sbjct: 877  LDPNIRPGQSMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTS-GKLERGPIQGGD 935

Query: 906  DVSSESMYDAANNNLSPHWEKIFFDRITTAGHN------------------GDKNGNCS- 946
            D ++E    + ++N   + +    +R+     +                  GD + NC  
Sbjct: 936  DFNTERYGRSEDSNKPENAQITELERLERDWLDNCMNPEFIEQAYEMKFPFGDLSCNCDS 995

Query: 947  --VYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVI 1004
               YFV+DATSWLRHFAH+FKLA NN+L+F ICLTTFQELR+LR SKD++VVEAATR+VI
Sbjct: 996  GVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATRAVI 1055

Query: 1005 TIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQT--- 1061
            T+RQLY +KK++PLRFTGN+AT++EE+LEFEEQITW +HVDEFVI+A+ K  + F+    
Sbjct: 1056 TVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEAINA 1115

Query: 1062 ------ERLIDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGSKIGINSGL 1115
                     I     +   +  LV+DD NM  KA  + I+T +T+++F++ ++IG+    
Sbjct: 1116 QAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLAHQA 1175

Query: 1116 CTN 1118
            CTN
Sbjct: 1176 CTN 1178

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/977 (48%), Positives = 628/977 (64%), Gaps = 85/977 (8%)

Query: 195  TRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELI 254
            T  + + Q +Q  ++KLQEIYR IV QETELQQRC  LTTSQTT+LK+LW IY++N ELI
Sbjct: 273  TVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELI 332

Query: 255  KNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVC 314
             NY  FI TALL TQP  DL++G+EI+++YRIE+RLWVYG ITFLDVLKNFSNFMDPEVC
Sbjct: 333  DNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVC 392

Query: 315  CQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESM 374
            CQFIIY FIS+S+ML DIP K+SI+W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++
Sbjct: 393  CQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEAL 452

Query: 375  KYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRS 434
            KY +G GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+
Sbjct: 453  KYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN 512

Query: 435  SAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFD 494
            S         HRN+ L++YLKHTEVMLLPSFLE+ +LQ VVL +F+ KFG   N  D FD
Sbjct: 513  SG-------HHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFD 564

Query: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXX 554
             + +F Q+ E L+++FRHA  +AES LLQL+GFG+P+NPFALLF+LP             
Sbjct: 565  PRLVFVQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKR 624

Query: 555  XSGATEVPQYRDPFDDQI---SSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQ 611
             S ++   QY    DD     +   +F+ IDS T      P ++NIW +SL++ N+T+++
Sbjct: 625  KSKSSTSTQYDTSIDDDCAFAAPSEFFETIDS-TKYIYKFPDDINIWKESLSYANVTAMK 683

Query: 612  CSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSM 671
            CS+ VL KFLH PL+ ALPH L W +F+ A   ++ T+    +  FW+  +R+  P+N++
Sbjct: 684  CSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTI 743

Query: 672  VNLANVLVCYMLDNIH---PFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFD 728
            +   NVL+ YM +      PF E   E+F  + L DL+ YF ENE LPE+W+CWG+LWFD
Sbjct: 744  ITFLNVLLLYMNNQTQANFPFDEY-FEQFIDMSLADLVGYFCENEELPEVWECWGTLWFD 802

Query: 729  AIKKCDVMEI-----PGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKK 783
            A+    +  +      GV+DH+F DSP+DGI FD  DE GE+FW R  R IL+ + +A +
Sbjct: 803  ALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALE 862

Query: 784  FPDLGLK-----VNFQAPVFCRRNDISP--DYFLKNFTFKXXXXXXXXXXXXXXXXXXXX 836
             P +GL+      N+++ VF      S   D +L+ FT                      
Sbjct: 863  CP-VGLREISGGRNWRSLVFKFEEPPSEWCDMYLEPFTL--------------------- 900

Query: 837  TIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYS-- 894
              +  E+I  VN D RATP   +    +I    GY  L PDY+CF++NG   +  +Y+  
Sbjct: 901  VFDTFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIG 960

Query: 895  -------QWSNVGNGMVLDVSSE--SMYDAANNNLSPHWEKIFFDRITTAGH-------- 937
                      +  NG  L  + E  S      N+L    E+   D      H        
Sbjct: 961  TLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWE 1020

Query: 938  ----NGDKNGNCS---VYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGS 990
                 GD +        YFV+DAT+WLRHF H++KLA NNILKFAICLTTFQELR+LR S
Sbjct: 1021 QMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKS 1080

Query: 991  KDDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVID 1050
            KD++V+EAATR+VIT+RQLY E+K++PLRFTGN+A ++EE+LE EEQ+TW +HVDEFVI+
Sbjct: 1081 KDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIE 1140

Query: 1051 AIAKLNQNFQ---------TERLIDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKY 1101
            AI K    F          +   I    ++   +  LVTDD NM  KA  + IK  +T++
Sbjct: 1141 AIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRF 1200

Query: 1102 LFSLGSKIGINSGLCTN 1118
            +FS+ +++G    +CTN
Sbjct: 1201 MFSVCNELGHAKNVCTN 1217

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/980 (46%), Positives = 638/980 (65%), Gaps = 89/980 (9%)

Query: 195  TRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELI 254
            T  +PS   +QT ++KLQEIY+ IV QETELQ+RC  LTTSQTT+LK+LW IY+LN ELI
Sbjct: 311  TVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAELI 370

Query: 255  KNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVC 314
             NY  FI TALL TQP  DL++GQEI+++YRIE+RLW+YG ITFLDVLKNFSNFMDPEVC
Sbjct: 371  DNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPEVC 430

Query: 315  CQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESM 374
            CQFI+Y FIS+S++L +IP  +S++W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++
Sbjct: 431  CQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQEAL 490

Query: 375  KYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRS 434
            KY +G GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+
Sbjct: 491  KYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN 550

Query: 435  SAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFD 494
            S         HR S +++YLKHTEVMLLPSFLEN++ Q VVL +F  KFG   + N  FD
Sbjct: 551  SG-------HHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSAN-FFD 602

Query: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXX 554
               +F Q+ E L+++FRHA  +AES +LQL+GFG+P+NPFALLF+LP             
Sbjct: 603  PSLIFVQDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKR 662

Query: 555  XSGATEVPQYRDPFDDQISSE--SYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQC 612
             S +T   Q     DD    +   +F+ ++S  + +     +LNIW +SLN++N TS++C
Sbjct: 663  KSKSTASNQSDMSIDDTFLGDPVQFFETLNSTKTAY-RFSQDLNIWKESLNYVNKTSMRC 721

Query: 613  SIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMV 672
            S+ VL KFL++ L+ ALPH L W +F+VA+  +L+ + ++    FWI F+R+  PW S+ 
Sbjct: 722  SMVVLRKFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESIT 781

Query: 673  NLANVLVCYMLDNIHPF---LERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDA 729
            N  NVL+ Y+ D   P    ++  +  + ++ L +L+EYF ENE+LPE+W CWG+LWFD 
Sbjct: 782  NFLNVLLLYINDQ-KPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDV 840

Query: 730  IKKCDVMEI-----PGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKF 784
            I    V  +      GV+DH+F D+P+DGI FD  DE GE+FW R +R IL+ +G+A +F
Sbjct: 841  INSKHVSNLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQF 900

Query: 785  P----DLGLKVNFQAPVFCRRNDISPDY---FLKNFTFKXXXXXXXXXXXXXXXXXXXXT 837
            P    +     ++++ VF + N+   ++   +L +F+ +                     
Sbjct: 901  PFGFTEFNGSDDWKSLVF-KFNEPPAEWKEQYLGSFSKEYGEF----------------- 942

Query: 838  IEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIY-SQW 896
                E I  VN DL++ P+  +V G +I    GY +L PDY CF+KNG   +  +Y S  
Sbjct: 943  ----ESISFVNTDLQSPPHKGMVLGTDIRTLQGYKQLVPDYLCFNKNGDLITGSLYTSGM 998

Query: 897  SNVGNGMVLD----------------VSSE-----SMYDAANNNLSPHWEKIFFDRITTA 935
            S  G+G+  D                V+SE     ++ D     +   + K  +    + 
Sbjct: 999  SEGGSGVPNDSEDFGSTKRLLENELLVTSERRDYNNLLDKEETPIIDEFLKWRYSSTNSR 1058

Query: 936  GHNGDKNGNCS-------VYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLR 988
                   G+          YFV+DAT+WLRHF H++KLA +N+LKFAICLTTFQELR+LR
Sbjct: 1059 WEQCLPRGDLQYFTDTHVTYFVLDATTWLRHFGHVYKLATSNLLKFAICLTTFQELRFLR 1118

Query: 989  GSKDDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFV 1048
             SKD++V+EAATR+VIT+RQLY E+K++PLRFTGN+A ++EE+LE EEQ+TW +HVDEFV
Sbjct: 1119 KSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFV 1178

Query: 1049 IDAIAKLNQNFQT----------ERLIDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCN 1098
            I+AI K    F            E +   +  K N +  LVTDD NM  KA+ + I+  +
Sbjct: 1179 IEAIDKAQSKFNQLNKDAKASGRESITTIDDGKFN-FIALVTDDINMRNKARAQSIRAFS 1237

Query: 1099 TKYLFSLGSKIGINSGLCTN 1118
            TK++F++  +IG++  +CT+
Sbjct: 1238 TKFMFAICHEIGLSKKVCTD 1257

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/980 (46%), Positives = 622/980 (63%), Gaps = 102/980 (10%)

Query: 207  FIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITALL 266
             ++KLQEIY+ IV QETELQ+RC  LTT QTT+LK+LW  Y++N ELI NYI FI TALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 267  TTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVS 326
             +Q  + L +GQEI+D+YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFI Y FI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 327  SMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYH 386
            +MLED+P KYSI W +RLGDLSRMAI+LYPSGF+DW+LSAE+WY ES+K+ +G GKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 387  IATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAHR 446
            ++TVQQN+LEAFVNLGKSVFC+D+F PS Q +QL+I+NIYQ AF +R S+G       +R
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSG-------NR 516

Query: 447  NSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPESL 506
             + ++DYLKHTEVMLLPSFLE+ +LQ+VV+ YF+ KFG   +GN  FD   +F Q+ E L
Sbjct: 517  TNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGN-FFDPNLIFIQDAERL 575

Query: 507  RYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSGATEVPQYRD 566
            +++FRH+  F++S +LQL GFG+PKNPFA+LF+L               S  +      D
Sbjct: 576  KHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLD 635

Query: 567  PFD----DQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLH 622
            P +     Q S+E +F  IDS    + + P +L +W  SL++IN+TS++C + VL +FL+
Sbjct: 636  PVEFSSQQQASTEDFFSTIDSPKVPY-EFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLY 694

Query: 623  APLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCY- 681
             P+V ALPH L WL FI++I  +L+ VN   +  FWI F+RR  PW+S++   N L+ Y 
Sbjct: 695  GPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYC 754

Query: 682  MLDNIHPF-LERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAI-KKCDV---- 735
            M+     F ++  +  +  +  ++L+    ENENLPE W CWGSLWF+ I KK D+    
Sbjct: 755  MVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTT 814

Query: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILK---------GVAKKFPD 786
            +E  G+ D LF DSP +GI FD+ DE G ++W R  RT+L+           G       
Sbjct: 815  LESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKK 874

Query: 787  LGLKVNFQAPVFCRRNDISPD------YFLKNFTFKXXXXXXXXXXXXXXXXXXXXTIEI 840
            L  +      +  R ND + D      Y  +N +F                         
Sbjct: 875  LNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPF----------------------- 911

Query: 841  NEKIERVNRDLRATPNL-----SVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQ 895
             EK E ++ +L  + NL     S++ G +I    G+  + PDY CF+KNG   +A +Y++
Sbjct: 912  -EKFEIIS-NLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTK 969

Query: 896  W----SNVGNG------MVLD-----VSSESMYDAANNNLSPHWEKIF----FDRITTAG 936
                 +N+  G       +LD     V     Y +A + L   W + F    F +     
Sbjct: 970  GPLETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLN 1029

Query: 937  HNGDKNGNCSV-----YFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSK 991
             +   N NC       +FV+DAT+WLRHFAHI+KLA +++LKFAICLTTFQELR+LR SK
Sbjct: 1030 RSFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKSK 1089

Query: 992  DDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDA 1051
            D++V+EAATR+VI +RQLY E+K++ LRFTGN+A ++EE+LE EEQ+TW++HVDEFVIDA
Sbjct: 1090 DESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFVIDA 1149

Query: 1052 IAKLNQNFQT--ERLIDKNKN-----------KNNAYAVLVTDDDNMDGKAKDKMIKTCN 1098
            IAK    F       I+K K+           +   +  LVTDD NM  KA+   I+T +
Sbjct: 1150 IAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLGIRTFS 1209

Query: 1099 TKYLFSLGSKIGINSGLCTN 1118
            T+++F++  ++G  +G+CTN
Sbjct: 1210 TRFVFAICRELGRETGVCTN 1229

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 67/140 (47%), Gaps = 15/140 (10%)

Query: 40  LHQKRHSSSSHNDTPESSFVKRRVP-GVVEPVGKGFI----DGIASGQVSVQNTPSKTDD 94
           LHQKRH+S+S  D  +S+ +KRR   GV E V         +       S+  +PSK   
Sbjct: 14  LHQKRHNSNSV-DYYDSNIIKRRTGDGVPENVDISVAEIPQEPCQYLDTSLLTSPSKIRH 72

Query: 95  ISRRPSISRK---AMETTPKVNTASISTIDVPKSPYYMNKSAITRNMEVVSRGNYAENTT 151
             + PSI++     ME TP+      S  + P+SP+Y+  ++ T N E  +      N  
Sbjct: 73  HEKTPSITKPHTLQMEQTPQPRGVDTSG-EFPQSPFYLPTTSQT-NFEAAT----TVNEN 126

Query: 152 SQMRTDESMATSNGIYSNSQ 171
           S +R  +S+     + +N+Q
Sbjct: 127 SSIRRSDSVTRLTTVGNNTQ 146

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar
           to uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/960 (40%), Positives = 550/960 (57%), Gaps = 101/960 (10%)

Query: 34  PTTVALLHQKRHSSSSHNDTPESSFVKRRVPGVVE--PVGKGFIDGIASGQVSVQN--TP 89
           P     LHQKRH+SS++N T ++  VKRR+P   +  P+G  F+D  +     +Q   TP
Sbjct: 40  PGFTQGLHQKRHNSSANNHTRDT-IVKRRLPVQSDENPIG-NFLDSFSKNSSPLQQCRTP 97

Query: 90  SK--------------TDDISRRPSI------SRKAMETTPKVNTA-------------- 115
                           TD + R  +I      +  + ++  + N                
Sbjct: 98  GSRPHSVTKKTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDN 157

Query: 116 ---SISTIDVPKSPYYMNKSAITRNMEVVSRGNYAENTTSQMRTDESMATS--------N 164
              S + +D+P SP+Y+     +  +E            S     ES+           N
Sbjct: 158 IANSANRVDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYN 217

Query: 165 GIYSNSQPQSQVTLSDFRTAP------AFATSPPPVTRQ--------LPSA--QPNQTFI 208
               N +      +SDF + P        +T     TR         LP+   +  Q  I
Sbjct: 218 SNLENGEINYNTEVSDFESLPTKDANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQALI 277

Query: 209 KKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTT 268
            KLQ+IY+ I+VQE ELQ  C  +T+SQTT+LK +W +Y++N EL+ NY+ FI TALL +
Sbjct: 278 SKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTALLPS 337

Query: 269 QPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFISVSSM 328
           Q   DL++GQEI+D+Y+IE+RLWVYG ITFLDVLK+FSNFMDPE+CCQFII+ FIS+++M
Sbjct: 338 QSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFISIANM 397

Query: 329 LEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLYYHIA 388
            + IP K+SI W  RLGDLSRMA +LYP G  DW+LSAEYWY E+MKY YG GKLYYH+A
Sbjct: 398 SDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVGKLYYHMA 457

Query: 389 TVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETAHRNS 448
           TVQQNSL AF+NLGKSVFC+D F P+QQ LQL+I+NIYQ A+I R        E +  N 
Sbjct: 458 TVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRG-------EESSSNV 510

Query: 449 QLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFDTKDMFCQNPESLRY 508
           Q++DYLKH E+M+LP+F+EN +LQ +  +YF +KFG+DF GN+ FDT+ MF QN ES+++
Sbjct: 511 QILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLESVKF 570

Query: 509 YFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXSGATEVPQYRDPF 568
           YFRH+P FA++ +LQ++G+GN  N FALL++LP              S         D  
Sbjct: 571 YFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDNMSIDTL 630

Query: 569 DDQISSE------SYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLH 622
             Q+S         YF +++++   F  +P N++IW+ SL + N T I C + VL KFL 
Sbjct: 631 SFQVSGNEIHDVGEYFNSLENIDKEF-TLPPNVDIWIQSLQYTNTTGIFCGMMVLQKFLQ 689

Query: 623 APLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYM 682
            P V ALPH L W++F++++  K+ET+       FW  F+RR  PWN+++N  NVL+ ++
Sbjct: 690 GPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIINFLNVLIAFL 749

Query: 683 LDNIH--PFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAIK-KCDV---- 735
            DN      + +  E +  L LD+++  F+ENE LPE+W CWGSLWFD IK K +     
Sbjct: 750 KDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDTIKNKSETSYSG 809

Query: 736 MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDLGLKV---- 791
           ++  G++D  F D+P DGIVFDE+D+ G +FW R+ R + + KG A+KF D GL++    
Sbjct: 810 LKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKF-DQGLRLTNIN 868

Query: 792 ---NFQAPVFCRRNDISPDYFLKNF--TFKXXXXXXXXXXXXXXXXXXXXTIEINEKIER 846
              + +  +F ++ +     FL  F  T+                      +   E I  
Sbjct: 869 SLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYSLFTEKLPAFESISE 928

Query: 847 VNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQW---SNVGNGM 903
            N  L A P LSV+ GE+IF+Y GY +L P Y+ +DKNG  N   IYS W   + +GNG+
Sbjct: 929 NNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSNWEAFNQLGNGL 988

 Score =  212 bits (539), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 142/199 (71%), Gaps = 26/199 (13%)

Query: 946  SVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVIT 1005
            S YF+ DAT+WLRHFAHI+K+A + +L F ICLTTFQELR+LR S+D+NV+EAATR+VI 
Sbjct: 1084 STYFIFDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIV 1143

Query: 1006 IRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLI 1065
            IR LY  KK+IPLRF G IA+++EE+LEFEEQITW +HV+EFVI+A+AK  +N   + L 
Sbjct: 1144 IRLLYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELH 1203

Query: 1066 D--------------------KNKNKNNA------YAVLVTDDDNMDGKAKDKMIKTCNT 1099
            +                    K +  +NA       +VLVTDD NMD KAK++ I+TC+T
Sbjct: 1204 NESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCST 1263

Query: 1100 KYLFSLGSKIGINSGLCTN 1118
            +++FS+ S++G+  G+CTN
Sbjct: 1264 RFIFSICSQLGMKYGICTN 1282

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  453 bits (1166), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 231/380 (60%), Positives = 284/380 (74%), Gaps = 50/380 (13%)

Query: 205 QTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITA 264
           Q  I+KLQ+IY++IV QE +LQ RC  LTTSQTT+LK+LW IY++N +LI NYINFI  A
Sbjct: 396 QALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINNYINFITNA 455

Query: 265 LLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYAFIS 324
           LL TQ  NDL +G+EI++IYRIE+RLWVYG ITFLDVLK+FSNFMDPEVCCQFI + FI+
Sbjct: 456 LLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQFISHVFIA 515

Query: 325 VSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCGKLY 384
           +S +L DIP+KYSI W QRLGDLSRMAI+LYPSGFIDW+LSAE+WY E+MK+ Y  GKLY
Sbjct: 516 ISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKFTYSHGKLY 575

Query: 385 YHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNNETA 444
           YH++TVQQN+LEAFVNLGKSVFCQ+ FTPSQQ +QL+I+NIYQ AF++R       N   
Sbjct: 576 YHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVER-------NNGN 628

Query: 445 HRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFG-------------------- 484
           HRN QLI+YLKHTEVMLLP+FLE++DLQ+VVL+YF+ KFG                    
Sbjct: 629 HRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNGA 688

Query: 485 -----------------------KDFNGNDIFDTKDMFCQNPESLRYYFRHAPAFAESQL 521
                                  + F   DIF  +DMF QNP+ L+Y+FRH+  FA+S +
Sbjct: 689 NVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSHI 748

Query: 522 LQLIGFGNPKNPFALLFQLP 541
           LQL+GFG+PKNPFALLF+LP
Sbjct: 749 LQLVGFGDPKNPFALLFELP 768

 Score =  408 bits (1048), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 233/598 (38%), Positives = 329/598 (55%), Gaps = 98/598 (16%)

Query: 568  FDDQISS---ESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAP 624
            FD+  S+   E +F+NID L   +  IP  + IWL+SL +IN+ S++CSI VL KFL+ P
Sbjct: 856  FDNNYSNILCEEFFENIDLLQFPYK-IPQTIEIWLESLKNINLISLKCSIIVLKKFLNGP 914

Query: 625  LVVALPHFLTWLHFIVAILKKLE-TVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYML 683
            +++ALPH LTW+HFI++IL K+E ++       FW  FL+  +PWNS+VN  NVL+ Y+L
Sbjct: 915  ILIALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLL 974

Query: 684  DNIHP-------FLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDAIKKCDV- 735
            DNI+         L  +     S  L++++++FN+NENLPEIWKCWG+LWFD I   ++ 
Sbjct: 975  DNINDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNIN 1034

Query: 736  ----------------------------------MEIPGVQDHLFFDSPLDGIVFDEKDE 761
                                              +   G++DH   D PLDGI F   DE
Sbjct: 1035 SDTTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDE 1094

Query: 762  IGERFWIRSIRTILILKGVAKKFPDLGLKVNFQAPVFCRRNDISPDYFLKNFTFKXXXXX 821
             G  F+ RSIR I + K + + FP+LGLK++ +   +CR   I  ++ L NF FK     
Sbjct: 1095 DGINFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLY 1154

Query: 822  XXXXXXXXXXXXXXXT----------------------IEINEKIERVNRDLRATPNLSV 859
                                                   +I+E IE +N +L+  P LS+
Sbjct: 1155 DPSLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSI 1214

Query: 860  VSG-ENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQWSNVGNGM------------VLD 906
            + G ENIF Y GY RL  +   F +NG   S  IYS W    N              +++
Sbjct: 1215 LGGNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVN 1274

Query: 907  VSSESMYDAANNNLSPH------WEKIFFDRITTAGHNGDKNGNCS----------VYFV 950
             S+    +    +++P       + K+ F    +   N  +  N             +FV
Sbjct: 1275 DSTMKNENVTVGDITPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFV 1334

Query: 951  IDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGSKDDNVVEAATRSVITIRQLY 1010
             DATSWLRHFAHI+KL+KN  LKFA+CLTTFQELR+LR SKD NVVEA+TR++IT+RQLY
Sbjct: 1335 FDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLY 1394

Query: 1011 DEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKN 1068
             E K++PLRFTGN+AT++EE+LEFEEQITW +HVDEFVI+AI +  + F+T+ + + N
Sbjct: 1395 KEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERFKTKSIQNYN 1452

 Score = 32.7 bits (73), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 61/159 (38%), Gaps = 38/159 (23%)

Query: 22  NDSNASVVNDMRPTTVALLHQKRHSSSSHNDTPESSFVKRRVPGVVEPVGK--------- 72
           N++  S+ N++  +   +   KRHSS+S+N+     F KRR+     P+           
Sbjct: 61  NNTIDSINNNITNSIGNIARPKRHSSNSYNNYKTIPFTKRRI-AACTPININNNNDNYNN 119

Query: 73  ------------------GFIDGI---------ASGQVSVQNTPSKTDDISRRPS-ISRK 104
                              FID +          +     Q TPSK   ISRRPS I RK
Sbjct: 120 NENMILMNNNNNNNNINNSFIDNLDYLSNTNNNTNMSTMAQYTPSKGTTISRRPSIIIRK 179

Query: 105 AMETTPKVNTASISTIDVPKSPYYMNKSAITRNMEVVSR 143
             +   + +  + +TI  P +   +N +    N +  S 
Sbjct: 180 QQQQQQQSHFTTATTIKSPSNHTSVNITPQASNYDPASE 218

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  407 bits (1046), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/409 (51%), Positives = 276/409 (67%), Gaps = 69/409 (16%)

Query: 202 QPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFI 261
           + NQ  I+KLQ IY++IV QE ELQ +C  L+TSQ+T+LK LW+IY+LN +LI NYI FI
Sbjct: 264 KSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILFI 323

Query: 262 ITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFIIYA 321
           +T+L  +Q IND ++G+EIL+IY+IE+RLW+YG ITFLD+LKNF+NFMDPE+  QFI + 
Sbjct: 324 LTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITHV 383

Query: 322 FISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYGCG 381
           F S+S+M+ D+P+ +   W QRLGDLSRMAI+LYPS FIDW+LS+EYWY ESMK+ +  G
Sbjct: 384 FESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSHG 443

Query: 382 KLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNN- 440
           KLYYHI+TVQQN LEAFVNLGKSVFC D F PSQ+ +QL+I+NIYQ AFI+R+S  +++ 
Sbjct: 444 KLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSSN 503

Query: 441 ------------NETAHRNSQ---LIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGK 485
                         +  +N Q   LI+YLKH+EVMLLP+FLEN  L+ VVL YF + FGK
Sbjct: 504 NAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFGK 563

Query: 486 ----------------------------------------------------DFNGNDIF 493
                                                                 N  ++F
Sbjct: 564 IAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINLF 623

Query: 494 DTKDMFCQ-NPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLP 541
           + +++F Q N + L+Y+F+++  FAES +LQLIGFG+PKNPFALLFQLP
Sbjct: 624 NFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLP 672

 Score =  223 bits (568), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 138/332 (41%), Positives = 189/332 (56%), Gaps = 73/332 (21%)

Query: 842  EKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQW----- 896
            EK    N DL   P LS++  E++FEY GY R  PD+  FDKNG   S  +Y+       
Sbjct: 1151 EKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDTI 1210

Query: 897  -SNVGNGMVLDVSSESMYDAANNNLSPH-----------------------WEKIFFDRI 932
              +  N  +++ ++ +  D +NN+ S                          EK  F++I
Sbjct: 1211 NGSSSNANIINTTTNA-NDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269

Query: 933  TTAGHN-------GDKNGNCSV-----YFVIDATSWLRHFAHIFKLAKNNILKFAICLTT 980
                +        G+   + S+     YFV+DATSWLRHFAH++KLA N ILKFAICLTT
Sbjct: 1270 LDPDYKNIDEIWRGEMFHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICLTT 1329

Query: 981  FQELRYLRGSKDDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITW 1040
            FQELR+LR SKD+NV+EAATR++IT+RQLY EK+++PLRFTGNIAT++EE+LEFEEQITW
Sbjct: 1330 FQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQITW 1389

Query: 1041 ETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYA-----------------------V 1077
             +HVDEFVI+AI +     Q +R  ++N+  +N  +                       V
Sbjct: 1390 RSHVDEFVIEAIKRA----QLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFV 1445

Query: 1078 LVTDDDNMDGKAK----DKMIKTCNTKYLFSL 1105
            LVTDD +M  K +    D  I T +TK++FSL
Sbjct: 1446 LVTDDISMIKKRQEEKSDNDIITFSTKFVFSL 1477

 Score =  196 bits (498), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 100/262 (38%), Positives = 159/262 (60%), Gaps = 11/262 (4%)

Query: 565  RDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHVLTKFLHAP 624
             D   D +S + +F N++SL  +F  +P +L IW +SL +IN+ S+ CSI VL KFL+ P
Sbjct: 779  EDEMLDNLSPQDFFNNLESLKLSFF-LPNSLEIWNESLKYINIISLNCSIIVLKKFLNGP 837

Query: 625  LVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLANVLVCYMLD 684
            L V+LPH L W +FI+++  ++E++ +     FW+ F+R+  PWNS+V+  NV++  +LD
Sbjct: 838  LFVSLPHMLPWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLD 897

Query: 685  NIH--PFLERELERFYSLELDDLIEYFNENE-NLPEIWKCWGSLWFDAIKKC------DV 735
            N +    + + +  + +  LD+L+  FNENE  LPE+WKC+GSLWFD I +       D 
Sbjct: 898  NCYENSMITKLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDC 957

Query: 736  MEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDL-GLKVNFQ 794
             +   ++D    + P+DG+ FDE +E G  FW RS R I + K +  +F    GL ++  
Sbjct: 958  SKNISMKDTKCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTMITRFNGFGGLTISSN 1017

Query: 795  APVFCRRNDISPDYFLKNFTFK 816
              V+C R+DI  ++ L+ F FK
Sbjct: 1018 TSVYCNRSDIPNNHILRTFAFK 1039

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 199/935 (21%), Positives = 382/935 (40%), Gaps = 160/935 (17%)

Query: 227  QRCLFLTTSQTTELKSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRI 286
            Q  LFL  ++      L  +++L+T+++  Y  FI  AL       DLI G+E +   R+
Sbjct: 128  QALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIALNINNTQEDLIRGKEYVTKGRL 187

Query: 287  EKRLWVYGIITFLDVLKNFSNFM----------DPEVCCQFIIYAFISVSSMLEDIPLKY 336
             +RL  + +   L++++N+ N M          + +   +FI    I ++ MLE+IPLK+
Sbjct: 188  NERLINHCLKPLLEIIENYKNHMKINGINVSVINNDNIIEFIQSFIIDITHMLEEIPLKF 247

Query: 337  SILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY-----TESMKYIYGCGK--------- 382
               W   +GDL+R+ + L       +RL++ + Y       ++ Y    GK         
Sbjct: 248  HYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAPVVAVNYSPNNGKESDIKNHMC 307

Query: 383  -LYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRSSAGTNNN 441
              Y++++ VQ +SL   V L K +  ++     +   QL I+ I         +   N  
Sbjct: 308  NYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQLAIDKIISKLL----NKQVNLK 363

Query: 442  ETAHRNSQLIDYLKHTEVMLLPSFLENMD-LQHVVLMYFKDKFGKDFNGNDIFDTKDMFC 500
            ++    + L+ Y     +    +    +  ++   L YF ++F  +++ N     K + C
Sbjct: 364  QSMGGTTILMKYFTLLSLFFGSTSSSQLSGMERSSLHYFWNEFANEYHLNYSSLRKPVNC 423

Query: 501  QNPES----LRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPXXXXXXXXXXXXXXS 556
            +  +       +YF +AP F+   +++ I      NPF  +                   
Sbjct: 424  KYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFFCV------------------- 464

Query: 557  GATEVPQYRDPFDDQISSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQCSIHV 616
                   Y+   D +I S S   N   L    DD                 T +  +  +
Sbjct: 465  -------YKSSDDFEIKSVS-LSNWKILIEQMDD-----------------TLLHSNKLL 499

Query: 617  LTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSMVNLAN 676
              KFL   + ++ P  L WL F +++  ++  V  + V   W   L+  +PW+ +V   N
Sbjct: 500  FKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLLLWKDLLQNLLPWDDIVTYLN 559

Query: 677  VLVCYMLDNIHPF----LERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFDA--- 729
              +  +  N H      L   ++   S  L DL+ Y     N  EI  C G +WFD+   
Sbjct: 560  ESIDMV--NKHSINSKTLRALIKNIKSCSLYDLLYYMMYESNFQEISMCEGFIWFDSLAS 617

Query: 730  -IKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKKFPDLG 788
             IK+  +     +     +++  D +++D+ D++  + W R++  IL++K V   +P+L 
Sbjct: 618  KIKQASITTNESLMKFKSYNASEDSLIYDDDDQVYTKMWTRALLIILLIKNVINDYPEL- 676

Query: 789  LKVNFQAPVF----CRRN--DISPDYFLKNFTFKXXXXXXXXXXXXXXXXXXXXTIEINE 842
            + V+ +        C +N   ++ DY   ++ F+                     + I++
Sbjct: 677  IDVSIRGQSLTNSSCIKNSDSLTNDYLF-DWGFE---------------LNNNNAVIIDD 720

Query: 843  KIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNG----GF----NSAFIYS 894
             +   NR               IF+++      PD+  FDKNG    G+    N  +IYS
Sbjct: 721  TLHGRNR---------------IFKFS----YIPDFQDFDKNGDITWGYSLISNYDYIYS 761

Query: 895  Q-WSNVGNGMVLDVSSESMYDAANNNLSPHWEKIFFDRITTAGHNGDKNGNCSVYFVIDA 953
              +++  +G      S  +  +A+N+ S    K +  ++               YF++D 
Sbjct: 762  NDFNSEEDGNFFQRYSRRLL-SAHNDYSEDKSKKYLPKLENN------------YFMVDT 808

Query: 954  TSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRG-SKDDNVVEAATRSVITIRQLYDE 1012
             +WL+H   + +      +K  + ++   +L  L+  S+ ++V  +A+R +I I  LY  
Sbjct: 809  LAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELKNYSEHESVRSSASRVMIVINYLYAM 868

Query: 1013 KKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKN 1072
             +I  L+   +  +   +N++  + + +     +F  D + K N   Q   +I+   +  
Sbjct: 869  NQINILKEFESPISKALKNIDGSQILNFN---GKFKNDLLTKENGPGQQLNMIELRMDN- 924

Query: 1073 NAYAVLVTDDDNMDGKAKDKMIKTCNTKYLFSLGS 1107
                V+V+DD       K K     +TK LFS+ S
Sbjct: 925  ---VVVVSDDKLSLATFKKKGYNVVSTKVLFSVAS 956

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 5/71 (7%)

Query: 1017 PLRFTGNIATNVEENLEFEEQITWETHVDEFVIDAIAKLNQNFQTERLIDKNKNKNNAYA 1076
            P+ F GNI  N++   E+++ + WE+ V    ID+     Q  +T +  DKN +  N + 
Sbjct: 1306 PVLFRGNIRRNLDPFDEYQDDLLWESLVKAGAIDS-----QELETVKSQDKNSDAKNLHK 1360

Query: 1077 VLVTDDDNMDG 1087
              +    + DG
Sbjct: 1361 FHLNQSVDEDG 1371

>YOR326W Chr15 (925721..930445) [4725 bp, 1574 aa] {ON}  MYO2One of
            two type V myosin motors (along with MYO4) involved in
            actin-based transport of cargos; required for the
            polarized delivery of secretory vesicles, the vacuole,
            late Golgi elements, peroxisomes, and the mitotic spindle
          Length = 1574

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 55/122 (45%), Gaps = 27/122 (22%)

Query: 985  RYLRGSKDDNVVEAATRSVITIRQLYD------------------EKKIIPLRFTGNIAT 1026
            R+LR  KD  VV++  R     R+L                    E K+I L  T N+A+
Sbjct: 899  RFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIEL--TQNLAS 956

Query: 1027 NVEENLEFEEQITWETHVDEFVIDAIAKLN---QNFQTERLIDKNKNKNNAYAVLVTDDD 1083
             V+EN E  E+I  E  V    ++  AKL    +N + E LID +  K+    +  T ++
Sbjct: 957  KVKENKEMTERIK-ELQVQ---VEESAKLQETLENMKKEHLIDIDNQKSKDMELQKTIEN 1012

Query: 1084 NM 1085
            N+
Sbjct: 1013 NL 1014

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 124,910,397
Number of extensions: 5829917
Number of successful extensions: 19513
Number of sequences better than 10.0: 122
Number of HSP's gapped: 20035
Number of HSP's successfully gapped: 159
Length of query: 1118
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 998
Effective length of database: 39,721,479
Effective search space: 39642036042
Effective search space used: 39642036042
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)