Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.1637.128ON1801809481e-132
Smik_9.1857.128ON1821827511e-102
YIL009C-A (EST3)7.128ON1811827303e-99
Suva_9.1957.128ON1891896627e-89
NCAS0E021507.128ON1851884571e-57
NDAI0E036907.128ON1961904153e-51
Zrou_YGOB_EST37.128ON1681763942e-48
KNAG0L009607.128ON1851843736e-45
TDEL0H029007.128ON1881873651e-43
KAFR0L004807.128ON1801823526e-42
Sklu_YGOB_EST37.128ON1961863416e-40
Kpol_1062.557.128ON1821843223e-37
TPHA0C043107.128ON2012033208e-37
CAGL0C03828g7.128ON1801833032e-34
Kwal_YGOB_EST37.128ON1921832729e-30
ADL016C7.128ON2021942702e-29
KLLA0D14289g7.128ON1841862422e-25
Kthe_YGOB_EST37.128ON1931842381e-24
TBLA0A009607.128ON2152122401e-24
ZYRO0C05258gsingletonOFF87901995e-20
Sklu_YGOB_Anc_7.128singletonOFF98971404e-11
Kwal_55.20848singletonOFF96961212e-08
KLTH0F12606gsingletonOFF96961063e-06
Kpol_1066.527.246ON68046672.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.163
         (180 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 b...   369   e-132
Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 b...   293   e-102
YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp...   285   3e-99
Suva_9.195 Chr9 complement(324112..324381,324353..324373,324377....   259   7e-89
NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 ...   180   1e-57
NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 ...   164   3e-51
Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [5...   156   2e-48
KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558...   148   6e-45
TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 ...   145   1e-43
KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,...   140   6e-42
Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196...   135   6e-40
Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 ...   128   3e-37
TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa...   127   8e-37
CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 a...   121   2e-34
Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [57...   109   9e-30
ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, ...   108   2e-29
KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} simil...    98   2e-25
Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026...    96   1e-24
TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 ...    97   1e-24
ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa] {OF...    81   5e-20
Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF} ...    59   4e-11
Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa] {OF...    51   2e-08
KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa] {...    45   3e-06
Kpol_1066.52 s1066 complement(101570..103612) [2043 bp, 680 aa] ...    30   2.8  

>Skud_9.163 Chr9 complement(305622..305891,305890..306159) [540 bp,
           180 aa] {ON} YIL009C-A (REAL)
          Length = 180

 Score =  369 bits (948), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 180/180 (100%), Positives = 180/180 (100%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQILTN 60
           MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQILTN
Sbjct: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQILTN 60

Query: 61  PCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETINCLMI 120
           PCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETINCLMI
Sbjct: 61  PCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETINCLMI 120

Query: 121 IGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFPFVYKFL 180
           IGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFPFVYKFL
Sbjct: 121 IGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFPFVYKFL 180

>Smik_9.185 Chr9 complement(310275..310544,310543..310818) [546 bp,
           182 aa] {ON} YIL009C-A (REAL)
          Length = 182

 Score =  293 bits (751), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/182 (76%), Positives = 162/182 (89%), Gaps = 2/182 (1%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHR--PSERVIPSLTRQDLLVPHMSAQIL 58
           MPR++LESHSKP DSIFLQPWIKALV+DNS+ H+  PS+ VIP LT QDL +PHMSA+IL
Sbjct: 1   MPRVVLESHSKPTDSIFLQPWIKALVEDNSEHHQYHPSDHVIPVLTEQDLKLPHMSAKIL 60

Query: 59  TNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETINCL 118
           TNPCHF KITRFY+V +YKVCASIRDSTHQILLVEFS ECVS+FER HNCRIT+ET+NCL
Sbjct: 61  TNPCHFAKITRFYNVCDYKVCASIRDSTHQILLVEFSPECVSNFERIHNCRITAETVNCL 120

Query: 119 MIIGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFPFVYK 178
           MIIGDA LI  TS++V + FKIR+SSIS N+++PVL+INQ TIFDIDQVGSLS FPFVYK
Sbjct: 121 MIIGDASLINATSSRVKSHFKIRLSSISSNDLVPVLQINQVTIFDIDQVGSLSAFPFVYK 180

Query: 179 FL 180
           +L
Sbjct: 181 YL 182

>YIL009C-A Chr9 complement(335666..335935,335937..336212) [546 bp,
           181 aa] {ON}  EST3Component of the telomerase
           holoenzyme, involved in telomere replication
          Length = 181

 Score =  285 bits (730), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 136/182 (74%), Positives = 161/182 (88%), Gaps = 3/182 (1%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNS--DQHRPSERVIPSLTRQDLLVPHMSAQIL 58
           MP++ILESHSKP DS+FLQPWIKAL++DNS  DQ+ PS  VIPSLT+QDL +PHMS  IL
Sbjct: 1   MPKVILESHSKPTDSVFLQPWIKALIEDNSEHDQYHPSGHVIPSLTKQDLALPHMSPTIL 60

Query: 59  TNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETINCL 118
           TNPCHF KIT+FY+V +YKV ASIRDS+HQIL VEFS+ECVS+FER+HNCRITSET NCL
Sbjct: 61  TNPCHFAKITKFYNVCDYKVYASIRDSSHQIL-VEFSQECVSNFERTHNCRITSETTNCL 119

Query: 119 MIIGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFPFVYK 178
           MIIGDADL+YVT+++ M+ FKI +S+IS  EI+PVL +NQ TIFDIDQVGSLSTFPFVYK
Sbjct: 120 MIIGDADLVYVTNSRAMSHFKICLSNISSKEIVPVLNVNQATIFDIDQVGSLSTFPFVYK 179

Query: 179 FL 180
           +L
Sbjct: 180 YL 181

>Suva_9.195 Chr9
           complement(324112..324381,324353..324373,324377..324652)
           [567 bp, 189 aa] {ON} YIL009C-A (REAL)
          Length = 189

 Score =  259 bits (662), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 152/189 (80%), Gaps = 9/189 (4%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHR-PSERVIPSLTRQDLLVPHMSAQILT 59
           MPR+ LES+S+  DSIFLQPWIK L+ DNS+ H  PS+ VIP+L +QDL +PHM  QILT
Sbjct: 1   MPRVFLESNSRQVDSIFLQPWIKLLIDDNSEHHHIPSDHVIPALAQQDLALPHMCPQILT 60

Query: 60  NPCHFTKITRFYDVSNYKVCASIRDSTHQIL--------LVEFSEECVSDFERSHNCRIT 111
           NP HF +ITRFY+V +Y+V AS+RDSTHQIL        LVEFSE+CVSDFER +N RIT
Sbjct: 61  NPFHFARITRFYNVCDYRVYASVRDSTHQILSVFREMCILVEFSEKCVSDFERINNFRIT 120

Query: 112 SETINCLMIIGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLS 171
           SET NCLMIIGDADL YVTS Q +ARF IR+SSIS +E +P+L INQ TIFDIDQVGSL+
Sbjct: 121 SETTNCLMIIGDADLAYVTSTQALARFMIRLSSISTSETVPILIINQATIFDIDQVGSLN 180

Query: 172 TFPFVYKFL 180
            FPFVYK+L
Sbjct: 181 NFPFVYKYL 189

>NCAS0E02150 Chr5 complement(411717..411992,411994..412275) [558 bp,
           185 aa] {ON} Anc_7.128 YIL009C-A
          Length = 185

 Score =  180 bits (457), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 92/188 (48%), Positives = 132/188 (70%), Gaps = 11/188 (5%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQ--HRPS--ERVIPSLTRQDLLVPHMSAQ 56
           MPR+IL S     DSIFLQPWI+ L++++  +  + P   +R +PSL   DL  P  S +
Sbjct: 1   MPRVILSSKLSQTDSIFLQPWIEGLLRESLQKKTYLPGNQQREVPSLNEADLRAPQCSPK 60

Query: 57  ILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETIN 116
           +LTN CHFTK+T+F+ ++NY + ASIRDS  Q LLVEF+ +CVS+FER H+ R+TSET+N
Sbjct: 61  VLTNHCHFTKVTKFFKINNYAISASIRDSRFQ-LLVEFTPKCVSNFERRHHRRLTSETLN 119

Query: 117 CLMIIGDADLIYVTSNQVMARFK----IRVSSISPNEILPVLKINQTTIFDIDQVGSLST 172
           CL++IGDA +IY + +Q+  +F     I   ++SP  ++P+L+INQ ++FD DQV  L +
Sbjct: 120 CLLVIGDAAIIYKSRDQITTQFGNIDFIISKNVSP--LVPILQINQASLFDGDQVQHLRS 177

Query: 173 FPFVYKFL 180
           FPFVY  L
Sbjct: 178 FPFVYSTL 185

>NDAI0E03690 Chr5 complement(796355..796663,796665..796946) [591 bp,
           196 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 196

 Score =  164 bits (415), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 124/190 (65%), Gaps = 14/190 (7%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKD--NSDQHRPSER--VIPSLTRQDLLVPHMSAQ 56
           MPR+IL S    +DS+FLQPWI  +++    +  + P  +   I  L+R+D+  P +S  
Sbjct: 1   MPRVILSSKQTVSDSVFLQPWIANIIRKEIQAKTYLPGNQRLSIARLSRRDMDAPEISET 60

Query: 57  ILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETIN 116
           IL N  HF K+T+F+ V+NYK+ ASIRDST+QI LVEF+ +CV +FER +  RITSET+N
Sbjct: 61  ILNNYSHFAKVTKFFSVNNYKIFASIRDSTYQI-LVEFTPQCVLEFERVYRSRITSETVN 119

Query: 117 CLMIIGDADLIYVTSNQVMARF-KIRVSSISPNE--------ILPVLKINQTTIFDIDQV 167
           CL +IGD  +IY T +Q+ + F K  + S++  +        + PVL+INQ ++FD DQV
Sbjct: 120 CLFVIGDCTVIYKTRSQIRSSFPKFDLQSLAGEKNSNKNGFGLFPVLQINQASLFDSDQV 179

Query: 168 GSLSTFPFVY 177
             L  FPF+Y
Sbjct: 180 QLLFEFPFIY 189

>Zrou_YGOB_EST3 Chr3 complement(410153..410401,410403..410660) [507
           bp, 168 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 168

 Score =  156 bits (394), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 118/176 (67%), Gaps = 10/176 (5%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQILTN 60
           MP+ I+    KP DS+FLQPWI+  + ++    R  +R+IP +  QDL  P +S+++L+N
Sbjct: 1   MPQAIVSV--KPFDSVFLQPWIQTALAEHDP--RLGDRLIPPVPTQDLSQPELSSKVLSN 56

Query: 61  PCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETINCLMI 120
             HF K+TRF+DV +Y V ASIRDS  Q LLVEF+ +CVSDFER +  RIT+ET NC+ I
Sbjct: 57  IRHFVKVTRFFDVDHYTVYASIRDSKAQ-LLVEFTPQCVSDFERRYYTRITAETTNCVFI 115

Query: 121 IGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFPFV 176
           I D  LIY + + +   +KI    ++  E  PVL++NQT IFD DQV SL T+P V
Sbjct: 116 IADCQLIYHSPSYIENHYKI----VTRGET-PVLRVNQTAIFDWDQVESLETYPLV 166

>KNAG0L00960 Chr12 complement(176345..176620,176622..176903) [558
           bp, 185 aa] {ON} Anc_7.128 YIL009C-A ribosomal
           frameshifting
          Length = 185

 Score =  148 bits (373), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 114/184 (61%), Gaps = 7/184 (3%)

Query: 1   MPRIIL-ESHSKPADSIFLQPWIKALVKDNSDQ---HRPSERVIPSLTRQDLLVPHMSAQ 56
           MP + L ++  K  + IF  PWIK LVK  +++    RP  ++IP LT  DL  P  S +
Sbjct: 1   MPAVKLSQTGHKFQEWIFTHPWIKNLVKLPTEEISLMRPVRQIIPKLTTNDLKNPTRSKR 60

Query: 57  ILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETIN 116
           +L N  HF K+ +FY V NYKV A IRDS  Q LLVEF  ECVS FER H+CRITS T+N
Sbjct: 61  VLKNKTHFAKVMKFYSVHNYKVFACIRDSECQ-LLVEFHPECVSYFERFHHCRITSGTVN 119

Query: 117 CLMIIGDADLIYVTSNQVMARFKIRVSSISPN--EILPVLKINQTTIFDIDQVGSLSTFP 174
           CL +IG+ DL Y +  +V   F+I +        + +PVL INQ T+ D  Q+ + +TFP
Sbjct: 120 CLFVIGNCDLEYRSVARVNDEFRINILPRKQKLMDQIPVLVINQATVADWGQMEAQTTFP 179

Query: 175 FVYK 178
           FV++
Sbjct: 180 FVHQ 183

>TDEL0H02900 Chr8 complement(482608..482892,482894..483175) [567 bp,
           188 aa] {ON} Anc_7.128 YIL009C-A
          Length = 188

 Score =  145 bits (365), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 78/187 (41%), Positives = 112/187 (59%), Gaps = 11/187 (5%)

Query: 1   MPRIILESHSKPADSIFLQPWIKA----LVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQ 56
           MP+ IL S SK  D++FL PWI+     L+ D SD   P    IP L  +DL  P +S +
Sbjct: 1   MPKTILSSSSKQKDTVFLLPWIEKSIGPLIADESDIRLPVFNFIPKLQLKDLRKPQLSPR 60

Query: 57  ILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETIN 116
           IL NP HF K+ +F+ V+ ++V A++RDS HQI LVEF+ +CVS+FER+H  RIT ET +
Sbjct: 61  ILRNPSHFVKVVKFHSVNRFQVFATVRDSAHQI-LVEFTPQCVSEFERTHRSRITLETEH 119

Query: 117 CLMIIGDADLIYVTSNQVMARFKIRVSSISPN------EILPVLKINQTTIFDIDQVGSL 170
            L II D  L +   N ++  F I + +            +PVL +NQ + F++DQ+ S 
Sbjct: 120 SLFIISDCKLYHRDRNYILKNFGIDMKNWQSAANHKRCSTIPVLIVNQASQFEMDQIESF 179

Query: 171 STFPFVY 177
             FP++Y
Sbjct: 180 EHFPYLY 186

>KAFR0L00480 Chr12 complement(87343..87603,87605..87886) [543 bp,
           180 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 180

 Score =  140 bits (352), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 81/182 (44%), Positives = 111/182 (60%), Gaps = 10/182 (5%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQH-RPSERVIPSLTRQDLLVPHMS-AQIL 58
           MP + L S     DSIF+  WIK L+ +N     RP  R IP +   ++  P  S   +L
Sbjct: 1   MPTVKLTSQHTRPDSIFIHDWIKPLLDENCQGLLRPIYRAIPPINNTNVRNPLSSRPSLL 60

Query: 59  TNP--CHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETIN 116
           T    CHFTKI +FY V N+K+ ASIRD+  QIL VEF+  CVS FER++ CR+TS+T N
Sbjct: 61  TTKVKCHFTKIVKFYKVENFKIFASIRDTRFQIL-VEFTPHCVSTFERTNRCRLTSDTTN 119

Query: 117 CLMIIGDADLIYVTSNQVMARFKIRVSSISPNE-ILPVLKINQTTIFDIDQVGSLSTFPF 175
           C ++IGD  + Y +S+++   +++      PN+ +LPVL INQ +I D DQ   L  FPF
Sbjct: 120 CTLLIGDCSIEYKSSHEISQNYRLNF----PNKRLLPVLTINQASILDRDQATLLEQFPF 175

Query: 176 VY 177
           VY
Sbjct: 176 VY 177

>Sklu_YGOB_EST3 Chr6 (413034..413324,413326..413625) [591 bp, 196
           aa] {ON} ANNOTATED BY YGOB - Ribosomal frameshifting
           (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 196

 Score =  135 bits (341), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 113/186 (60%), Gaps = 9/186 (4%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRP------SERVIPSLTRQDLLVP-HM 53
           MP++ L S +K +DSI+L  WI   +  +  +             +PSL  +D+    H+
Sbjct: 1   MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 54  SAQILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSE 113
           S +I+ N  HF K+T+FY V+NY+V AS RDS   IL VEF+  CVS+FER H+ RITSE
Sbjct: 61  SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSIL-VEFTACCVSNFERLHHSRITSE 119

Query: 114 TINCLMIIGDADLIYVTSNQVMARFKIRVSSISPN-EILPVLKINQTTIFDIDQVGSLST 172
           T N L +IGD  L+++    V  +F I ++  +P   ++P+L++NQ  ++D+DQV S   
Sbjct: 120 TTNTLFVIGDVKLVFMDKASVSQKFGIDITQFNPQLNLVPILRVNQAFVYDMDQVESNRK 179

Query: 173 FPFVYK 178
           FPF Y+
Sbjct: 180 FPFFYQ 185

>Kpol_1062.55 s1062 (125085..125366,125368..125634) [549 bp, 182 aa]
           {ON} (125085..125366,125368..125634) [549 nt, 183 aa]
          Length = 182

 Score =  128 bits (322), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 77/184 (41%), Positives = 107/184 (58%), Gaps = 11/184 (5%)

Query: 1   MPRIILESH-SKPADSIFLQPWIKALVKDNSDQHRPSERVIPSLTRQDL--LVPHMSA-- 55
           MP+IIL S+ S   DS +LQ WI  ++  N D    +  VIP L          +MS+  
Sbjct: 1   MPKIILPSNKSSCVDSTYLQEWIDLIIDRNYDN---TGEVIPILDEYGFNDSQSYMSSVI 57

Query: 56  -QILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSET 114
             I+  P HF K+T F++V +Y V ASIRD   Q+L  EF+  CVS FER +N RIT  T
Sbjct: 58  NLIIKKPYHFAKVTNFFNVVDYSVYASIRDRKFQVL-SEFTSNCVSSFERLYNSRITENT 116

Query: 115 INCLMIIGDADLIYVTSNQVMARFKIRVSSI-SPNEILPVLKINQTTIFDIDQVGSLSTF 173
           INCL +IGD  L ++T  ++   +K+ +SSI + N + PVL INQ  +FD  Q+ S   F
Sbjct: 117 INCLFLIGDCKLKFMTYWEIKELYKLDLSSICNKNSLYPVLSINQARMFDWSQIKSFEKF 176

Query: 174 PFVY 177
            ++Y
Sbjct: 177 DWIY 180

>TPHA0C04310 Chr3 (931642..931905,931907..932248) [606 bp, 201 aa]
           {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 201

 Score =  127 bits (320), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 110/203 (54%), Gaps = 33/203 (16%)

Query: 1   MPRIILESHSKPA-DSIFLQPWIKALVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQ--- 56
           MP+IIL S    + DSIFL+PWIK  ++D        +  I  +   D L+ + + +   
Sbjct: 1   MPKIILPSKVNLSPDSIFLKPWIKEFIEDGK------KNSIGKIGNLDELLNNTNVKLQL 54

Query: 57  ILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETIN 116
           IL  P    K+T  Y++ NY V  SIRD+ HQ LLVEF+  CVS+FER++  RIT +T N
Sbjct: 55  ILKYPNQLVKLTNIYNILNYCVFGSIRDNKHQ-LLVEFTSNCVSNFERNYKIRITDQTKN 113

Query: 117 CLMIIGDADLIYVTSNQVMARFKIR----------------------VSSISPNEILPVL 154
           CL +IGD  + YVT ++++  FKI                       +S    N + P+L
Sbjct: 114 CLFLIGDCIIKYVTHDELLKNFKIDPLQFDNHIGITEYFDFKKYGYILSERRFNRLYPIL 173

Query: 155 KINQTTIFDIDQVGSLSTFPFVY 177
           ++NQ  IFD DQV +   +PFVY
Sbjct: 174 QVNQVMIFDWDQVVTFENYPFVY 196

>CAGL0C03828g Chr3 (377164..377430,377432..377707) [543 bp, 180 aa]
           {ON} similar to uniprot|Q03096 Saccharomyces cerevisiae
           YIL009ca
          Length = 180

 Score =  121 bits (303), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 107/183 (58%), Gaps = 6/183 (3%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQILTN 60
           MP  I +S S   +S++L  W++ ++ ++      +  VIP +   +  +P +S +I  N
Sbjct: 1   MPPFIPKSRSNAVESVYLHGWVRDMLLESKTSQNIA--VIPRVDPDEASIPLLSRRIYAN 58

Query: 61  PCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSETINCLMI 120
             HF KIT+F+ V NY V AS++DS HQI L +F+ +CVS+FE  +  RITS+T+N L +
Sbjct: 59  RRHFVKITKFFQVHNYSVYASVKDSQHQI-LSQFTPKCVSEFESRNRSRITSDTVNTLFM 117

Query: 121 IGDADLIYVTSNQVMARFKIRVSSISPN---EILPVLKINQTTIFDIDQVGSLSTFPFVY 177
           IGDA L  +  +++   F  ++ S+        +P L INQ  I D DQV +    PFVY
Sbjct: 118 IGDAKLGIMVVDELRHYFGEKIVSLFNGLDMPYIPYLIINQAFILDYDQVEAFKMTPFVY 177

Query: 178 KFL 180
           +++
Sbjct: 178 QYI 180

>Kwal_YGOB_EST3 s55 complement(581681..581974,581976..582260) [579
           bp, 192 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006)
          Length = 192

 Score =  109 bits (272), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 103/183 (56%), Gaps = 8/183 (4%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQH-----RPS-ERVIPSLTRQDLLVPHMS 54
           MP+       K  +S FL+ WI+  V +    H      P+ ER +PS+ R D  +  +S
Sbjct: 1   MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPM-QLS 59

Query: 55  AQILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSET 114
           +Q+L N  HF KIT F+ + N+ V AS RD + QIL VEF+ +CVS FER H  RIT+ T
Sbjct: 60  SQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL-VEFTPKCVSQFERRHGLRITART 118

Query: 115 INCLMIIGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFP 174
           +N + +IG   + Y+   +V   +       +   +LPVL +N+ T+FD+DQV S   F 
Sbjct: 119 VNTIFLIGAVTIKYIPIYEVRETWCWASDLDTRIPVLPVLVVNECTVFDLDQVESRRKFN 178

Query: 175 FVY 177
           ++Y
Sbjct: 179 YLY 181

>ADL016C Chr4 complement(680590..680914,680916..681199) [609 bp, 202
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YIL009C-A (EST3)
          Length = 202

 Score =  108 bits (270), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/194 (33%), Positives = 99/194 (51%), Gaps = 33/194 (17%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQ---- 56
           MP+++L S +  ADSIFL+ W+              + V+P+L R     P    +    
Sbjct: 1   MPKVVLASRAHKADSIFLREWL-------------VDAVVPALERSGACAPWAGVECFIP 47

Query: 57  --------------ILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDF 102
                         ++ NP  F +I RF  V ++ VCA  RD+   IL VEF+  CVS+F
Sbjct: 48  ALPPATATLSLEPTVIQNPKRFLRIVRFTRVHDFAVCAVARDAGCCIL-VEFTPHCVSNF 106

Query: 103 ERSHNCRITSETINCLMIIGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIF 162
           ER ++ RITS T+N L +IG+  L++   +   A F++  + ++ +  LPVL++    IF
Sbjct: 107 ERRYHQRITSSTVNSLFVIGNTSLLFYARSDAAAAFEVP-ALMNGSSTLPVLRVGDCAIF 165

Query: 163 DIDQVGSLSTFPFV 176
           D DQV S   FP V
Sbjct: 166 DQDQVESHRRFPLV 179

>KLLA0D14289g Chr4 (1215729..1216283) [555 bp, 184 aa] {ON} similar
           to uniprot|Q03096 Saccharomyces cerevisiae YIL009C-A
           EST3 Component of the telomerase holoenzyme involved in
           telomere replication
          Length = 184

 Score = 97.8 bits (242), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 97/186 (52%), Gaps = 10/186 (5%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALV-----KDNSDQHRPSER-VIPSLTRQDLLVPHMS 54
           MP ++L S     DS+FLQ WIK  V     K+   +  P +R ++  L   D++     
Sbjct: 1   MPNVVLSSRLTNNDSVFLQEWIKPSVRPYYLKNEKTKFWPEQRELVTDLLEHDIIESAFQ 60

Query: 55  AQILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSET 114
             +   P  F +I +F+ V++Y V A+IRDST  ++L  F+ +CV D+E  +N RIT  T
Sbjct: 61  TALNPAPQRFVRIVKFHRVNDYTVYATIRDST-ALILCYFTVDCVLDYETINNDRITLNT 119

Query: 115 INCLMIIGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFP 174
           +N L +IG+  L +    +    F      +    ++PVLKI +  +FD DQ+ S   F 
Sbjct: 120 LNTLFVIGNVTLQFWNHRECKLWFNQDFPGL---RMVPVLKIEKARMFDRDQISSNVQFE 176

Query: 175 FVYKFL 180
           +VY  L
Sbjct: 177 WVYDTL 182

>Kthe_YGOB_EST3 Chr6 complement(1055444..1055740,1055742..1056026)
           [582 bp, 193 aa] {ON} ANNOTATED BY YGOB - Ribosomal
           frameshifting (Farabaugh, J Mol Evol 63:545, 2006).
           Replaces KLTH0F12606g.
          Length = 193

 Score = 96.3 bits (238), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/184 (33%), Positives = 104/184 (56%), Gaps = 8/184 (4%)

Query: 1   MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRP------SERVIPSLTRQDLLVPHMS 54
           M +I+  +  K  +S+FL+ WI + V     +H P          +P L +    VP  S
Sbjct: 1   MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVPFKS 60

Query: 55  AQILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSEECVSDFERSHNCRITSET 114
            +IL N  HF KIT F+ V  + V AS RD+  +IL VEF+ +CVS FER ++ RIT++T
Sbjct: 61  -EILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL-VEFTPQCVSAFERLNSIRITAKT 118

Query: 115 INCLMIIGDADLIYVTSNQVMARFKIRVSSISPNEILPVLKINQTTIFDIDQVGSLSTFP 174
           +N +++IG   L Y+  ++   ++ + +       ++PVL + Q  +FD+DQV +  +F 
Sbjct: 119 VNTILLIGSGTLKYLPVHEAYTQWSLSIPLDPRVPVVPVLVVEQCAVFDLDQVEARPSFD 178

Query: 175 FVYK 178
           ++Y+
Sbjct: 179 YLYQ 182

>TBLA0A00960 Chr1 complement(212858..213151,213153..213506) [648 bp,
           215 aa] {ON} Anc_7.128 YIL009C-A ribosomal frameshifting
          Length = 215

 Score = 97.1 bits (240), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 112/212 (52%), Gaps = 46/212 (21%)

Query: 13  ADSIFLQPWIKALVK---------DN--SDQHRP----------------SERVIPSLTR 45
           A S+FL+ W+K L++         DN  S+Q +P                 ERVI  ++ 
Sbjct: 6   AQSVFLKKWLKNLIQPLYSGIFKNDNNYSEQFQPISDCEWSELPNKFIPQGERVIRQISS 65

Query: 46  QDL---------LVPHMSAQILTNPCHFTKITRFYDVSNYKVCASIRDSTHQILLVEFSE 96
           +++         ++P  S+ +  N  H  KIT+F+ V+NYK+CAS++D+  QIL VE + 
Sbjct: 66  EEMKMFGADSYNVIPLSSSLLSNNN-HIIKITKFFKVNNYKICASVQDAECQIL-VELTP 123

Query: 97  ECVSDFERSHNCRITSETINCLMIIGDADLIYVTSNQVMARFKIR--------VSSISPN 148
            CV+++ER    R+TS T++CL +IGD  L +   N+V+  F           ++++  +
Sbjct: 124 ICVTEYERKTRDRMTSNTLDCLFVIGDCRLYFQNKNEVLHNFNCNTFRNIIPGLNALDRD 183

Query: 149 EILPVLKINQTTIFDIDQVGSLSTFPFVYKFL 180
            ++PVL INQ    D     SLST PF++ +L
Sbjct: 184 SLIPVLVINQIICVDRHPSKSLSTLPFLHSYL 215

>ZYRO0C05258g Chr3 complement(410397..410660) [264 bp, 87 aa]
          {OFF} some similarities with uniprot|Q03096
          Saccharomyces cerevisiae YIL009C-A
          Length = 87

 Score = 81.3 bits (199), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 42/90 (46%), Positives = 61/90 (67%), Gaps = 4/90 (4%)

Query: 1  MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRPSERVIPSLTRQDLLVPHMSAQILTN 60
          MP+ I+    KP DS+FLQPWI+  + ++    R  +R+IP +  QDL  P +S+++L+N
Sbjct: 1  MPQAIVSV--KPFDSVFLQPWIQTALAEHDP--RLGDRLIPPVPTQDLSQPELSSKVLSN 56

Query: 61 PCHFTKITRFYDVSNYKVCASIRDSTHQIL 90
            HF K+TRF+DV +Y V ASIRDS  Q+L
Sbjct: 57 IRHFVKVTRFFDVDHYTVYASIRDSKAQLL 86

>Sklu_YGOB_Anc_7.128 Chr6 (413034..413330) [297 bp, 98 aa] {OFF}
          ANNOTATED BY YGOB -
          Length = 98

 Score = 58.5 bits (140), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 54/97 (55%), Gaps = 7/97 (7%)

Query: 1  MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRP------SERVIPSLTRQDLLVP-HM 53
          MP++ L S +K +DSI+L  WI   +  +  +             +PSL  +D+    H+
Sbjct: 1  MPKVALSSRNKESDSIYLHNWIVHSILPHVREKWAIGIIGDVRSFVPSLDDKDITSDVHL 60

Query: 54 SAQILTNPCHFTKITRFYDVSNYKVCASIRDSTHQIL 90
          S +I+ N  HF K+T+FY V+NY+V AS RDS   IL
Sbjct: 61 SRKIILNHRHFIKLTKFYQVNNYQVYASARDSLCSIL 97

>Kwal_55.20848 s55 complement(581970..582260) [291 bp, 96 aa]
          {OFF} [contig 138] FULL
          Length = 96

 Score = 51.2 bits (121), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 52/96 (54%), Gaps = 7/96 (7%)

Query: 1  MPRIILESHSKPADSIFLQPWIKALVKDNSDQH-----RPS-ERVIPSLTRQDLLVPHMS 54
          MP+       K  +S FL+ WI+  V +    H      P+ ER +PS+ R D  +  +S
Sbjct: 1  MPKPSAIYKKKQRESCFLRSWIQQDVCEVVKGHVSLPVWPAVERFVPSIVRSDGPM-QLS 59

Query: 55 AQILTNPCHFTKITRFYDVSNYKVCASIRDSTHQIL 90
          +Q+L N  HF KIT F+ + N+ V AS RD + QIL
Sbjct: 60 SQLLQNRRHFLKITGFHKIHNFAVYASGRDDSCQIL 95

>KLTH0F12606g Chr6 complement(1055736..1056026) [291 bp, 96 aa]
          {OFF} no similarity
          Length = 96

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 48/96 (50%), Gaps = 7/96 (7%)

Query: 1  MPRIILESHSKPADSIFLQPWIKALVKDNSDQHRP------SERVIPSLTRQDLLVPHMS 54
          M +I+  +  K  +S+FL+ WI + V     +H P          +P L +    VP   
Sbjct: 1  MNKIVSSAKEKQNESVFLREWILSDVLAVMKEHAPLPIWPAVPNFVPPLAKLHGHVP-FK 59

Query: 55 AQILTNPCHFTKITRFYDVSNYKVCASIRDSTHQIL 90
          ++IL N  HF KIT F+ V  + V AS RD+  +IL
Sbjct: 60 SEILLNRRHFLKITNFHRVEKFAVFASGRDNNCRIL 95

>Kpol_1066.52 s1066 complement(101570..103612) [2043 bp, 680 aa]
           {ON} complement(101570..103612) [2043 nt, 681 aa]
          Length = 680

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 5/46 (10%)

Query: 116 NCLMIIGDADLI-----YVTSNQVMARFKIRVSSISPNEILPVLKI 156
           N L+I+ D DL+     + T+N+++   K + S  SPN   PVLK+
Sbjct: 535 NNLLIVEDNDLVKLFNTFPTTNEIVLEVKEKDSQSSPNVSKPVLKV 580

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,168,540
Number of extensions: 692423
Number of successful extensions: 2498
Number of sequences better than 10.0: 36
Number of HSP's gapped: 2501
Number of HSP's successfully gapped: 36
Length of query: 180
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 77
Effective length of database: 41,670,801
Effective search space: 3208651677
Effective search space used: 3208651677
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)