Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.1627.126ON2172179971e-139
Suva_9.1947.126ON2152148431e-115
Smik_9.1847.126ON2142148391e-114
YIL010W (DOT5)7.126ON2152148021e-109
SAKL0F05368g7.126ON2312216542e-86
Kpol_1062.577.126ON2192136481e-85
KAFR0K012007.126ON2021536252e-82
KLLA0D14333g7.126ON2052066211e-81
KNAG0G010207.126ON2071616044e-79
TBLA0A009407.126ON2881485984e-77
NDAI0H013107.126ON2611535895e-76
NCAS0F008107.126ON2311635831e-75
CAGL0C03850g7.126ON2091705724e-74
TDEL0H028807.126ON3541605837e-74
Ecym_83517.126ON2241575482e-70
ZYRO0C05214g7.126ON2701465428e-69
ADL018W7.126ON2441565345e-68
Kwal_55.208397.126ON3051545336e-67
TPHA0C043307.126ON2091515116e-65
KLTH0F12562g7.126ON2931494691e-57
TDEL0C015907.388ON24948682.0
KAFR0I025405.25ON108147649.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.162
         (217 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   388   e-139
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   329   e-115
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   327   e-114
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   313   e-109
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   256   2e-86
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   254   1e-85
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   245   2e-82
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   243   1e-81
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   237   4e-79
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   234   4e-77
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   231   5e-76
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   229   1e-75
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   224   4e-74
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   229   7e-74
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   215   2e-70
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   213   8e-69
ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   210   5e-68
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   209   6e-67
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   201   6e-65
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   185   1e-57
TDEL0C01590 Chr3 complement(275920..276669) [750 bp, 249 aa] {ON...    31   2.0  
KAFR0I02540 Chr9 complement(510159..513404) [3246 bp, 1081 aa] {...    29   9.3  

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  388 bits (997), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 197/217 (90%), Positives = 197/217 (90%)

Query: 1   MGEALRRSTRIAASKRLLEDEESKLXXXXXXXXXXXXXXXXXXXXTSEPVKSEDDSLSAA 60
           MGEALRRSTRIAASKRLLEDEESKL                    TSEPVKSEDDSLSAA
Sbjct: 1   MGEALRRSTRIAASKRLLEDEESKLVPISPPEVPKKKVKTAPKVKTSEPVKSEDDSLSAA 60

Query: 61  TELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120
           TELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED
Sbjct: 61  TELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120

Query: 121 LKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVF
Sbjct: 121 LKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVF 180

Query: 181 VNGKLRFKRIKISPEVSVSDAKKEVLEIAERVEEKLS 217
           VNGKLRFKRIKISPEVSVSDAKKEVLEIAERVEEKLS
Sbjct: 181 VNGKLRFKRIKISPEVSVSDAKKEVLEIAERVEEKLS 217

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  329 bits (843), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 164/214 (76%), Positives = 177/214 (82%)

Query: 1   MGEALRRSTRIAASKRLLEDEESKLXXXXXXXXXXXXXXXXXXXXTSEPVKSEDDSLSAA 60
           MGEALRRS RIA SKRLLE+E SKL                      EPVK ED S   A
Sbjct: 1   MGEALRRSARIATSKRLLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKREDHSSLGA 60

Query: 61  TELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120
            EL++GD IPDLSLL+EDNDP+SLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED
Sbjct: 61  NELKVGDDIPDLSLLNEDNDPVSLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120

Query: 121 LKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LK+HAAVFGLSAD V SQKKFQTKQ LPYHL+SDPKREFIGLLGAKKTPLSGSIRSHFVF
Sbjct: 121 LKEHAAVFGLSADSVISQKKFQTKQKLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180

Query: 181 VNGKLRFKRIKISPEVSVSDAKKEVLEIAERVEE 214
           V+GKLRFKR+KISPEVSV DAKKEV+E+AE+ E+
Sbjct: 181 VDGKLRFKRVKISPEVSVGDAKKEVMELAEKFEK 214

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  327 bits (839), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 181/214 (84%)

Query: 1   MGEALRRSTRIAASKRLLEDEESKLXXXXXXXXXXXXXXXXXXXXTSEPVKSEDDSLSAA 60
           MG+ALRRSTRIAASKR LEDEESK                      SE     D+S S +
Sbjct: 1   MGKALRRSTRIAASKRSLEDEESKFDPISPPEVLKKRVKTDLKVKVSETEDQGDNSASTS 60

Query: 61  TELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120
           TEL+IGD IPDLSLLSEDND ISLK+IA+ENKIVVFFVYPKASTPGCTRQACGFRDNY+D
Sbjct: 61  TELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVVFFVYPKASTPGCTRQACGFRDNYDD 120

Query: 121 LKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LKKH+AVFGLS+D VTSQK+FQTKQNLPYHL+SDPKREFIGLLGAKKTPLSGSIRSHFVF
Sbjct: 121 LKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFVF 180

Query: 181 VNGKLRFKRIKISPEVSVSDAKKEVLEIAERVEE 214
           V+GKLRFKR+KISPEVSV+DAKKE+LE+AE+V+E
Sbjct: 181 VDGKLRFKRVKISPEVSVNDAKKEILELAEKVKE 214

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  313 bits (802), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 177/214 (82%)

Query: 1   MGEALRRSTRIAASKRLLEDEESKLXXXXXXXXXXXXXXXXXXXXTSEPVKSEDDSLSAA 60
           MGEALRRSTRIA SKR+LE+EESKL                     ++ V  E +  S  
Sbjct: 1   MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDV 60

Query: 61  TELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYED 120
            ELEIGD IPDLSLL+EDND ISLK+I + N++VVFFVYP+ASTPGCTRQACGFRDNY++
Sbjct: 61  NELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQE 120

Query: 121 LKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVF 180
           LKK+AAVFGLSAD VTSQKKFQ+KQNLPYHL+SDPKREFIGLLGAKKTPLSGSIRSHF+F
Sbjct: 121 LKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIF 180

Query: 181 VNGKLRFKRIKISPEVSVSDAKKEVLEIAERVEE 214
           V+GKL+FKR+KISPEVSV+DAKKEVLE+AE+ +E
Sbjct: 181 VDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKE 214

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  256 bits (654), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 134/221 (60%), Positives = 159/221 (71%), Gaps = 12/221 (5%)

Query: 5   LRRSTRIAASKRL-------LEDEESKLXXXXXXXXXXXXXXXXXXXXTSEPV-KSEDDS 56
           LRRS R+AASK+L       +E    KL                      +P  KSED+ 
Sbjct: 4   LRRSNRLAASKKLGKGEKPSVEPPAKKLKISRKNKSEDKIEDKTEDEVQDKPADKSEDEP 63

Query: 57  LS----AATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQAC 112
                 A++ELE+GD IPDL L ++D+  ISLKE+AK+N+IVVFF YPKASTPGCTRQ C
Sbjct: 64  TEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVFFAYPKASTPGCTRQVC 123

Query: 113 GFRDNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSG 172
           G+RDNYEDLK+HAAVFGLSAD   +QK FQTKQ+LPY L+SDPKREFIGLLGAKKTP SG
Sbjct: 124 GYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPKREFIGLLGAKKTPQSG 183

Query: 173 SIRSHFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIAERVE 213
            IRSH+VF  GKLRFKR+KISPE SV+D KKEVLE+A+ +E
Sbjct: 184 VIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAKDLE 224

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  254 bits (648), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 152/213 (71%), Gaps = 6/213 (2%)

Query: 4   ALRRSTRIAASKRLLEDEESKLXXXXXXXXXXXXXXXXXXXXTSEPVKSED------DSL 57
           A+RRSTRIA SKR LE +E++                          K +D      +  
Sbjct: 3   AVRRSTRIANSKRKLEADEAERDVASKSGEETTSSKKLKKEKDVRVTKVDDKESKAENKP 62

Query: 58  SAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDN 117
           S   E+EIGD IPDL L ++D   ISL+++AK+N I+VFF YP+A TPGCTRQACGFRD 
Sbjct: 63  SGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYPRAMTPGCTRQACGFRDT 122

Query: 118 YEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSH 177
           Y+DLKKHAAVFGLSAD   SQKKFQ K +LPY L+SDPKREFIGLLGAKKTP SG IRSH
Sbjct: 123 YDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFIGLLGAKKTPQSGIIRSH 182

Query: 178 FVFVNGKLRFKRIKISPEVSVSDAKKEVLEIAE 210
           F+FV+GKLRFKRIKISPE+SV+D KKEVLEI E
Sbjct: 183 FIFVDGKLRFKRIKISPEISVNDGKKEVLEIVE 215

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  245 bits (625), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 107/153 (69%), Positives = 138/153 (90%)

Query: 59  AATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNY 118
           +++EL+IGD +PD++L+++DN  ISL+E+AK NKI+V F YPKASTPGCTRQACGFRDNY
Sbjct: 47  SSSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNY 106

Query: 119 EDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHF 178
           +++KKHAAVFGLSAD V SQK+FQ KQNLP+ L+SDPKRE IG+LGAKKTP SG IRSH+
Sbjct: 107 DEIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHW 166

Query: 179 VFVNGKLRFKRIKISPEVSVSDAKKEVLEIAER 211
           VF++GKLRF+ IK+SPE S+S++KKEV+E+AE+
Sbjct: 167 VFLDGKLRFRNIKVSPERSISESKKEVMELAEK 199

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  243 bits (621), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 121/206 (58%), Positives = 153/206 (74%), Gaps = 6/206 (2%)

Query: 5   LRRSTRIAASKRLLEDEESKLXXXXXXXXXXXXXXXXXXXXTSEPVKSEDDSLSAATELE 64
           LRRS RI+A K  L+ E ++                       + VK+ED S +   EL+
Sbjct: 4   LRRSNRISAKKEPLDSESAE-----PIKVKAKTESKVTKPNGKKEVKNED-SANKLAELQ 57

Query: 65  IGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDLKKH 124
           IGD IPDL+LL++D++PISLKE+A +NK+VVFF YPKASTPGCTRQACG+RDNY +LK+H
Sbjct: 58  IGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFAYPKASTPGCTRQACGYRDNYSELKEH 117

Query: 125 AAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVFVNGK 184
           AAVFGLSAD   SQK FQTKQ LP+ L+SDPKREFIG LGAKKT +SG +RSH++F NGK
Sbjct: 118 AAVFGLSADAPKSQKSFQTKQALPFDLLSDPKREFIGALGAKKTAVSGVVRSHWIFKNGK 177

Query: 185 LRFKRIKISPEVSVSDAKKEVLEIAE 210
           L  KR+++SPEVS+ + KKEVLE+A+
Sbjct: 178 LEVKRVQVSPEVSIEEGKKEVLELAK 203

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  237 bits (604), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 134/161 (83%)

Query: 52  SEDDSLSAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQA 111
           +ED  L  A  LEIGD IPDL+L+ ++ + +SL E+A  NKI+V F YP+ASTPGCTRQA
Sbjct: 47  TEDKPLVDAKVLEIGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQA 106

Query: 112 CGFRDNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLS 171
           CGFRDNY +LKKHAAV+GLSAD V SQKKFQTKQNLPY+L+SDPKREFIG+LGAKKT  S
Sbjct: 107 CGFRDNYAELKKHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQS 166

Query: 172 GSIRSHFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIAERV 212
           G IRS+++F NGKLR K+IK+SPE SV+++K EVLE+ + +
Sbjct: 167 GIIRSYWIFFNGKLRIKKIKVSPEASVAESKAEVLELVKEL 207

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  234 bits (598), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 124/148 (83%)

Query: 62  ELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121
           ELE+GD +PD  L +++N+ ISLK++ +EN+IVV F YPKA+TPGCTRQACG RDNY DL
Sbjct: 126 ELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYNDL 185

Query: 122 KKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVFV 181
           KK+A VFG+SAD V++QK FQ KQNLPY L+SD  RE IG LG KKTP SG IRSHF+ V
Sbjct: 186 KKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFIIV 245

Query: 182 NGKLRFKRIKISPEVSVSDAKKEVLEIA 209
           NGKL+FKR+KISPEVSVSD KKEVLEI+
Sbjct: 246 NGKLKFKRVKISPEVSVSDCKKEVLEIS 273

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  231 bits (589), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 134/153 (87%)

Query: 62  ELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121
           ELEIGD IPD++L +++   ISLKEIAK NKI+V F +P+ASTPGCTRQACGFRDNY++L
Sbjct: 108 ELEIGDDIPDITLSNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDEL 167

Query: 122 KKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVFV 181
           KK+A VFGLSAD ++SQKKF+ KQ+LPY L+SDPKR+ IGLLGAKKTP SG++RS+++FV
Sbjct: 168 KKNAIVFGLSADAISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFV 227

Query: 182 NGKLRFKRIKISPEVSVSDAKKEVLEIAERVEE 214
            GKL  KRIK+SPE+SV+++KKEV+E A+++ E
Sbjct: 228 EGKLSIKRIKVSPEISVAESKKEVIEFAKKLSE 260

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  229 bits (583), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 109/163 (66%), Positives = 136/163 (83%), Gaps = 3/163 (1%)

Query: 47  SEPVKSEDDSLSAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPG 106
           S  VK+ D   S   EL+IGD IPD+ L  E+   +SLK++ +ENKIVVFF +PKA+TPG
Sbjct: 70  STAVKNTD---SIYKELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFPKANTPG 126

Query: 107 CTRQACGFRDNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAK 166
           CTRQACGFRDNY++LK+HAAV+G+SADPVT+QKKF+TKQNLPY L+SD KR+FIGLLGAK
Sbjct: 127 CTRQACGFRDNYKELKEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFIGLLGAK 186

Query: 167 KTPLSGSIRSHFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIA 209
           KTP SG IRS+F+FV+GKL+ KR+KISPE+SV +A+KEV   A
Sbjct: 187 KTPQSGVIRSYFIFVDGKLKVKRVKISPELSVEEARKEVSAFA 229

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  224 bits (572), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 134/170 (78%), Gaps = 4/170 (2%)

Query: 46  TSEPVKS----EDDSLSAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPK 101
           T EPVK     E+   S    LE+GD IPD++L ++D   +SLK +AKENK+++ F+YPK
Sbjct: 37  TKEPVKKPNTKEEKVSSDEAILEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPK 96

Query: 102 ASTPGCTRQACGFRDNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIG 161
           ASTPGCTRQACGFRDN++DLK+H  V GLS D   +Q KF+ K +LPY L+ DP REFIG
Sbjct: 97  ASTPGCTRQACGFRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIG 156

Query: 162 LLGAKKTPLSGSIRSHFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIAER 211
           +LGAKKTP SGSIRSHFVF +GKL+FKR+KISPE+SV+D KKEVLE+A++
Sbjct: 157 MLGAKKTPASGSIRSHFVFADGKLKFKRLKISPEISVADGKKEVLELAKQ 206

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  229 bits (583), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 99/160 (61%), Positives = 133/160 (83%)

Query: 50  VKSEDDSLSAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTR 109
           V  + D  + +TEL+IGD IPD++L ++D   +SL+++AKE+KI++ F YPKASTPGCTR
Sbjct: 189 VAEDSDQTAQSTELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTR 248

Query: 110 QACGFRDNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTP 169
           QACG+RDNY++LK+HAAVFGLS D  ++QKKFQTKQ+LP+ L+ DP R  IG LGAKKT 
Sbjct: 249 QACGYRDNYDELKEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTA 308

Query: 170 LSGSIRSHFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIA 209
            SG++RSH+VF +GKL++KR+K+SPEVS+ D KKEVLE+A
Sbjct: 309 QSGTLRSHWVFFDGKLKYKRVKVSPEVSIQDGKKEVLELA 348

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  215 bits (548), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 131/157 (83%)

Query: 55  DSLSAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGF 114
           + +    ELE+GD++P+++L ++D+  ++LK++AK+NKIV+ F YPKA+TPGCTRQACGF
Sbjct: 63  EKVGGPKELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIVLIFAYPKANTPGCTRQACGF 122

Query: 115 RDNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSI 174
           RDNYE+L+KHA +FG+S+D V SQK FQ+KQ+LP+ L+SDP RE IG+LGAKKT  +G I
Sbjct: 123 RDNYEELQKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSDPDRELIGMLGAKKTAQAGVI 182

Query: 175 RSHFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIAER 211
           RSH++F NGKL++KR+K+SPE S+S+  +EVL + ++
Sbjct: 183 RSHWIFCNGKLKYKRVKVSPETSISEGLEEVLGLIKK 219

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  213 bits (542), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 123/146 (84%)

Query: 66  GDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDLKKHA 125
           GD IPD+ L ++D   ISLK+++ E+KIVV F YPKASTPGCTRQACGFRDNYED+K+HA
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 126 AVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVFVNGKL 185
           AVFGLSAD V +QKKFQ KQ+LP+ L+SDP+R  +GLLGAKK+P SG IRSH+VF +G L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 186 RFKRIKISPEVSVSDAKKEVLEIAER 211
           + KR+KISPEVS+ + KKEVLE+ ++
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELVKQ 240

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  210 bits (534), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 95/156 (60%), Positives = 122/156 (78%)

Query: 56  SLSAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFR 115
           S     EL++GD +P+++L ++D   + L ++ K+NKIVV F YPKASTPGCTRQACGFR
Sbjct: 80  STGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFR 139

Query: 116 DNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIR 175
           DNY++L+KHA VFG+SAD V SQK FQ KQ LP+ L+SDPKRE IG LGA+KT  +G IR
Sbjct: 140 DNYQELQKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPKRELIGALGARKTAQTGVIR 199

Query: 176 SHFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIAER 211
           SH+VFV+GKL  KRIKISPE+S++D   EVL  A++
Sbjct: 200 SHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKK 235

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  209 bits (533), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 98/154 (63%), Positives = 122/154 (79%), Gaps = 1/154 (0%)

Query: 56  SLSAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFR 115
           S S+  ELE+GD +PD+ L ++D + +SLK++A+ENK+V+ F YPKASTPGCT QACGFR
Sbjct: 40  SDSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGCTTQACGFR 99

Query: 116 DNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIR 175
           DNYEDLK+  AVFGLSAD   +Q+KFQ   +LP+ L+SDPKRE IGLLGAKK+P SG+ R
Sbjct: 100 DNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKKSP-SGTKR 158

Query: 176 SHFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIA 209
           SH+VF NGKL  KRI +SPEVS+ DAK E  E A
Sbjct: 159 SHWVFANGKLINKRIAVSPEVSIRDAKTEAHEAA 192

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  201 bits (511), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 84/151 (55%), Positives = 128/151 (84%), Gaps = 1/151 (0%)

Query: 62  ELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121
           E+++GD IPDL+L +++ + +SL+++A++NKI+  FVYP+ASTPGCTRQACGFRDN++DL
Sbjct: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119

Query: 122 KKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVFV 181
           KK++ + GLS D +T+QK F+TKQNLPY L+ D +++ I +LG KK P SG IRS+F+FV
Sbjct: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFV 178

Query: 182 NGKLRFKRIKISPEVSVSDAKKEVLEIAERV 212
           +GKL+ KR+K+SPEVS++++KKE+L++ + +
Sbjct: 179 DGKLKLKRVKVSPEVSITESKKEILDLVKEL 209

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  185 bits (469), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 121/149 (81%), Gaps = 1/149 (0%)

Query: 62  ELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFFVYPKASTPGCTRQACGFRDNYEDL 121
           ELE GD +PD+ L +++ + +SLK + ++NK+VV F YPKASTPGCT+QACGFRDNYE+L
Sbjct: 43  ELEEGDEVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAYPKASTPGCTKQACGFRDNYEEL 102

Query: 122 KKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDPKREFIGLLGAKKTPLSGSIRSHFVFV 181
           KK+AAVFGLS D   +Q+KF+ K +LP+ L+SDP+R+ IG LGA K+P SG+ RS++VFV
Sbjct: 103 KKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKLIGPLGASKSP-SGTKRSYWVFV 161

Query: 182 NGKLRFKRIKISPEVSVSDAKKEVLEIAE 210
            GKLR KRI +SPE SVS+AKKE +E A+
Sbjct: 162 QGKLRTKRISVSPEASVSEAKKEAIEAAQ 190

>TDEL0C01590 Chr3 complement(275920..276669) [750 bp, 249 aa] {ON}
           Anc_7.388 YBL064C
          Length = 249

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 95  VFFVYPKASTPGCTRQACGFRDNYEDLKKHAA-VFGLSADPVTSQKKF 141
           VFF +P   TP CT +   F     +  K    + GLSA+ V S KK+
Sbjct: 68  VFFSHPADFTPVCTTELGAFSKLKPEFDKRGVKLIGLSAEDVESHKKW 115

>KAFR0I02540 Chr9 complement(510159..513404) [3246 bp, 1081 aa] {ON}
           Anc_5.25 YGR274C
          Length = 1081

 Score = 29.3 bits (64), Expect = 9.3,   Method: Composition-based stats.
 Identities = 12/47 (25%), Positives = 26/47 (55%)

Query: 51  KSEDDSLSAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVVFF 97
           K   +S ++  +L IGD+ P   +   + DP++L +    NK++ ++
Sbjct: 511 KDVRESFTSTADLTIGDTAPIYLMEYSEQDPLALSKFGMANKLINYY 557

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,162,377
Number of extensions: 798997
Number of successful extensions: 1727
Number of sequences better than 10.0: 44
Number of HSP's gapped: 1717
Number of HSP's successfully gapped: 44
Length of query: 217
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 112
Effective length of database: 41,441,469
Effective search space: 4641444528
Effective search space used: 4641444528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)