Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Skud_9.165.707ON2262269641e-133
Smik_9.175.707ON2512337651e-103
Suva_9.365.707ON2242267072e-94
YIL152W5.707ON2352357064e-94
TPHA0E001805.707ON1651411141e-06
NDAI0F002705.707ON2981101021e-04
TBLA0I016905.707ON3201001012e-04
ZYRO0B16434g5.707ON237118992e-04
TDEL0B021305.707ON208115966e-04
NCAS0G002105.707ON288109940.001
Kpol_1043.745.707ON177127800.046
KLTH0E00946g5.707ON215160810.052
NOTE: 6 genes in the same pillar as Skud_9.16 were not hit in these BLAST results
LIST: KAFR0D02200 Kwal_55.19675 KLLA0A00506g KNAG0L02160 Cgla_YGOB_Anc_5.707 SAKL0E15026g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Skud_9.16
         (226 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)    375   e-133
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)    299   e-103
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)    276   2e-94
YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative prote...   276   4e-94
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    49   1e-06
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    44   1e-04
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    44   2e-04
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    43   2e-04
TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.70...    42   6e-04
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    41   0.001
Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {...    35   0.046
KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved...    36   0.052

>Skud_9.16 Chr9 (33635..34315) [681 bp, 226 aa] {ON} YIL152W (REAL)
          Length = 226

 Score =  375 bits (964), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 192/226 (84%), Positives = 192/226 (84%)

Query: 1   MSHKRRGLVIYXXXXXXXXXXXXXXXXXXXXPTRRHHHPLKQQSSNSFTEILXXXXXXXX 60
           MSHKRRGLVIY                    PTRRHHHPLKQQSSNSFTEIL        
Sbjct: 1   MSHKRRGLVIYQDQKQQQQPSGQSLSSISWSPTRRHHHPLKQQSSNSFTEILSKSSVQQD 60

Query: 61  XXXXXXHLPISSLVLKQQQQRRNMPSQNSGPPLRKVVQDSQWTSSTIHCPSRKQEKQSLT 120
                 HLPISSLVLKQQQQRRNMPSQNSGPPLRKVVQDSQWTSSTIHCPSRKQEKQSLT
Sbjct: 61  VRQDSSHLPISSLVLKQQQQRRNMPSQNSGPPLRKVVQDSQWTSSTIHCPSRKQEKQSLT 120

Query: 121 FYRTDSKLVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIKLPMNDTIIL 180
           FYRTDSKLVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIKLPMNDTIIL
Sbjct: 121 FYRTDSKLVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIKLPMNDTIIL 180

Query: 181 HSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226
           HSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI
Sbjct: 181 HSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score =  299 bits (765), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 158/233 (67%), Positives = 171/233 (73%), Gaps = 7/233 (3%)

Query: 1   MSHKRRGLVIYXXXXXXXXXXXXXXXXXXXXPTRRHHHPLKQQSSNSFTEILXXXXXXXX 60
           MSHKRRGLVIY                    P +R HHPLKQQS+N+FT IL        
Sbjct: 19  MSHKRRGLVIYQDQKQQQRPSGQSISSISWSPKQRPHHPLKQQSTNNFTAILSKSTVQQD 78

Query: 61  XXXXXXHLPISSLVLKQQQ-------QRRNMPSQNSGPPLRKVVQDSQWTSSTIHCPSRK 113
                 HLPISSLVLKQ+Q       +RRNM  QNSGPPLRK+VQ+SQWTSST HC SRK
Sbjct: 79  VQQDRSHLPISSLVLKQEQHQQNEEQRRRNMQQQNSGPPLRKLVQESQWTSSTSHCHSRK 138

Query: 114 QEKQSLTFYRTDSKLVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIKLP 173
           QEK    FY +DSKLVSQLH+SVKDLD I+QTHKP+FDTIIHDLS T ILSSNELLIKLP
Sbjct: 139 QEKIPQGFYSSDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIHDLSRTTILSSNELLIKLP 198

Query: 174 MNDTIILHSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226
           M +TIILHSR P IN EWLHNK S+P ASLVIDSRSFLILCNNIKWYLHWKFI
Sbjct: 199 MEETIILHSRTPTINEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score =  276 bits (707), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 153/226 (67%), Positives = 165/226 (73%), Gaps = 2/226 (0%)

Query: 1   MSHKRRGLVIYXXXXXXXXXXXXXXXXXXXXPTRRHHHPLKQQSSNSFTEILXXXXXXXX 60
           M HKRRGLVIY                      ++H  PLKQQS+NSFT IL        
Sbjct: 1   MGHKRRGLVIYQDQKQQQHSPGKSISSLAWSAAQQH--PLKQQSTNSFTAILSKSCLRQD 58

Query: 61  XXXXXXHLPISSLVLKQQQQRRNMPSQNSGPPLRKVVQDSQWTSSTIHCPSRKQEKQSLT 120
                 HLPISSLVLKQQQQ++  PSQ+SGPPLRK+VQ+SQWTSS  H PS KQEKQ   
Sbjct: 59  VQQDSSHLPISSLVLKQQQQQQQHPSQSSGPPLRKLVQNSQWTSSATHRPSWKQEKQPKA 118

Query: 121 FYRTDSKLVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIKLPMNDTIIL 180
           FY TDS+LVSQLH+SVKDLDTIVQTHKPRFDTIIHDLSHT ILS NELLIKL   DTIIL
Sbjct: 119 FYHTDSRLVSQLHSSVKDLDTIVQTHKPRFDTIIHDLSHTTILSPNELLIKLHTEDTIIL 178

Query: 181 HSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226
           HSR P INAEWL NK S+  ASLVIDSRSFLILC+NIKWYLHWKFI
Sbjct: 179 HSRTPIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224

>YIL152W Chr9 (56545..57252) [708 bp, 235 aa] {ON} Putative protein
           of unknown function
          Length = 235

 Score =  276 bits (706), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 149/235 (63%), Positives = 166/235 (70%), Gaps = 9/235 (3%)

Query: 1   MSHKRRGLVIYXXXXXXXXXXXXXXXXXXX-XPTRRHHHPLKQQSSNSFTEILXXXXXXX 59
           MSHKRRGLVIY                     PTRR HHPLKQQS+NSF+EIL       
Sbjct: 1   MSHKRRGLVIYQDQKQQQQHPPGQSLSSISWSPTRRPHHPLKQQSTNSFSEILSKSSVQP 60

Query: 60  XXXXXXXHLPISSLVLKQQQQRR--------NMPSQNSGPPLRKVVQDSQWTSSTIHCPS 111
                  H+PIS LVLKQ+  ++        N+ SQNS PPLR++VQ+SQWTSS  +   
Sbjct: 61  NVQHDGNHMPISLLVLKQEHHKQQQQQQQRQNIRSQNSTPPLRQLVQESQWTSSASNSSL 120

Query: 112 RKQEKQSLTFYRTDSKLVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIK 171
           +KQEKQ  TFY TDSKLVSQLH+SVKDLD I+QTHKP+FDTII D S   ILSSNELLIK
Sbjct: 121 KKQEKQPQTFYNTDSKLVSQLHSSVKDLDAIIQTHKPKFDTIIRDFSQATILSSNELLIK 180

Query: 172 LPMNDTIILHSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226
           LP + TIILHSR PKINAEWL NK +DPSASLVIDSRSFL LCNNIKWYLHWKFI
Sbjct: 181 LPKDQTIILHSRAPKINAEWLQNKVNDPSASLVIDSRSFLTLCNNIKWYLHWKFI 235

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 27/141 (19%)

Query: 108 HCPSRKQEKQSLT--------FYRTDSKL---------------VSQLHTSVKDLDTIVQ 144
           H  SRK+ K++++        + +T SKL               VS L  S+   + +++
Sbjct: 15  HLDSRKKNKKAISELLATKKKYNKTYSKLKLNNNFHNFKCSSASVSDLRLSINKFNMLLK 74

Query: 145 THKPRFDTIIHDLSHTAILSSNELLIKLPMNDTIILHSRIPKINAEWLHNKTSDPSASLV 204
               ++D I HD++    LS NE ++    + T+ILHS    +      N  +     + 
Sbjct: 75  ASSNKYDEI-HDINSIEKLSQNEFIVTTIDSKTLILHSNEKNVVNS---NNYTLKYQQVA 130

Query: 205 IDSRSFLILCNNIKWYLHWKF 225
           I+S+ +L L N++ WYL WKF
Sbjct: 131 INSKYYLSLYNDLNWYLDWKF 151

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 59/110 (53%), Gaps = 13/110 (11%)

Query: 126 SKLVSQLHTSVKDLDTIVQTHKP-RFDTIIHDLSHTAILSSNELLIK--------LPMND 176
           S L+  L  S+ DLDT ++T     +DT++  ++   +LS +E+ I            + 
Sbjct: 193 SALLQSLQKSLCDLDTSLKTLSYHSYDTLL-TVTSFEMLSDHEIKINSVKNYTAGFTTDV 251

Query: 177 TIILHSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226
           T++LHS+I  +N    +N   D    L +DS+ +L L  N+KWYL WKFI
Sbjct: 252 TMLLHSKIS-LNVPLPNNLHKD--YKLALDSKVYLELAPNVKWYLVWKFI 298

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 5/100 (5%)

Query: 128 LVSQLHTSVKDLDTIVQTHKP-RFDTIIHDLSHTAILSSNELLIKLPMNDTIILHSRIPK 186
           LV+ LHT + +L+T + + +  +FD I   +S    LS  ELL+    N +++LHS    
Sbjct: 225 LVNGLHTILSNLNTRIHSSRNLKFDKIFQ-ISKLTKLSDTELLVITNTNSSLLLHSD-ST 282

Query: 187 INAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226
           I     +N T      +  +S S L +  ++ WYL WKFI
Sbjct: 283 IGQSEFNNYT--LKEKVATNSISILKITEDLNWYLKWKFI 320

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 16/118 (13%)

Query: 115 EKQSLTFYRTDSKLVSQLHTSVKDLDTIVQT--HKPRFDTIIHDLSHTAILSSNELLI-- 170
           EK + +  +  + LV+QL  ++ D + +V+T      +D ++ D+ H   LS  E+++  
Sbjct: 130 EKCASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILV-DIRHAIWLSPFEIMVIS 188

Query: 171 KLPMNDTIILHS--RIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226
             P     ILHS   IPK          + PS  L I S+  L L N++ WYL WKF+
Sbjct: 189 DDPRVKRAILHSHKAIPKF--------VNSPS-RLAICSKCCLTLYNDMNWYLKWKFL 237

>TDEL0B02130 Chr2 (379880..380506) [627 bp, 208 aa] {ON} Anc_5.707
           YIL152W
          Length = 208

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 53/115 (46%), Gaps = 7/115 (6%)

Query: 112 RKQEKQSLTFYRTDSKLVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIK 171
           R+   Q L   R D  L + +  ++  L+T +Q      D ++       +LS +ELL+ 
Sbjct: 101 RRSRDQGLETSR-DKSLSTAVSVALSHLNTRIQVLSGELDQLMA-FERLVLLSQHELLV- 157

Query: 172 LPMNDTIILHSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNIKWYLHWKFI 226
           +      +LHS IP          +   +  L ++S+ + +L N++ W++ WKF 
Sbjct: 158 VTQRKIFVLHSVIPLTR----EGVSRFGALKLAVNSQCYYVLYNDVVWFMRWKFF 208

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 10/109 (9%)

Query: 128 LVSQLHTSVKDLDTIVQTHKPRFDTIIHDLSHTAILSSNELLIKLPMN-DTIILHSRIPK 186
            V+ L   + DLDT+++T K      +  ++    LS  EL +   M+   IILH++   
Sbjct: 177 FVTSLQKYLCDLDTMMKTSKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSI 236

Query: 187 INA---EWLHNKTSD------PSASLVIDSRSFLILCNNIKWYLHWKFI 226
            N    +++H+ + +       S  L I+S+SF+ + ++I WY+ WKFI
Sbjct: 237 NNIPILKFIHDVSINTKIQVTESLKLAINSKSFIKVSDDINWYIDWKFI 285

>Kpol_1043.74 s1043 complement(158958..159491) [534 bp, 177 aa] {ON}
           complement(158958..159491) [534 nt, 178 aa]
          Length = 177

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 62/127 (48%), Gaps = 13/127 (10%)

Query: 103 TSSTIHCPSRKQEKQSLTFYRTDSKLVSQLHTSVKDLDTIVQTHKP-RFDTIIHDLSHTA 161
           T++ I+  S  Q    L+  +    L+S LH S+   +TIV++    +FD + H L H  
Sbjct: 57  TTANIYSTSNNQ----LSVSKYSPSLLS-LHNSLYVFNTIVRSGSLLKFDHVWHIL-HFQ 110

Query: 162 ILSSNELLIKL----PMNDTIILHSRIPKINAEWLHNKTSDPSASLVIDSRSFLILCNNI 217
           +LS  ++   +     M   IIL+      N   +   T+   A + I+S SF+ L  N+
Sbjct: 111 LLSQFQIYCLVVDHNEMTKNIILYKNNNNNNNANITLPTT--FAKIAINSNSFVHLYGNV 168

Query: 218 KWYLHWK 224
            WYLHW+
Sbjct: 169 NWYLHWR 175

>KLTH0E00946g Chr5 (91205..91852) [648 bp, 215 aa] {ON} conserved
           hypothetical protein
          Length = 215

 Score = 35.8 bits (81), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 71/160 (44%), Gaps = 27/160 (16%)

Query: 82  RNMPSQNSGPPLRKVVQ----DSQWTSSTIHCPSRKQEKQSLTFYRTDSKLVSQLHTSVK 137
           R+ P  + G  LR V Q    D   T +  H  +R +++  L F      LV++L   V 
Sbjct: 68  RSRPKSHDGS-LRSVAQVIGSDYHLTPTKPHYRARAKKRYDLAF-PAGKALVNRLLKCVS 125

Query: 138 DLDT-------IVQTHKPRFDTIIHDLSHTAILSSNELLI--KLPMNDTIILHSRIPKIN 188
             +T        + TH+  +D  +H + +T +LS  ELL     P+   +++   +P   
Sbjct: 126 AFETNRRLQRHGLSTHE--YDRKLH-VQYTKLLSPTELLAVAAGPLGREVLILHMLPS-- 180

Query: 189 AEWLHNKTSDPSAS--LVIDSRSFLILCNNIKWYLHWKFI 226
                 K ++P +   L++ S +  +L   ++WY  W+ I
Sbjct: 181 -----TKDAEPKSGSQLLLSSNASALLYPGLRWYFEWRVI 215

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.131    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,570,532
Number of extensions: 789585
Number of successful extensions: 2748
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2834
Number of HSP's successfully gapped: 32
Length of query: 226
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 120
Effective length of database: 41,326,803
Effective search space: 4959216360
Effective search space used: 4959216360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)